F454576

General Info

Members Datasets Scaffolds Average Seq Length
494 364 986 161

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10332189|Ga0157377_103321892
Length 193
Sequence VGGFPDGGDVAGQIIRGQGESQGKDRNRGDHDMSKSNVGSRIIWQGLALAGMLAVATTSAATAGECPTGKMQPNVRPMVDTKPVGVTDVTLGAINLEKQPANIRDRELRFRKLTIEPGGIVPWHSHDDRPALIFVQQGEIVEYASNCADPIVHKAGEIRPEVAGTSHWWKNLGKETVILYVGDVRKDPHDHNM

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
88 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
281 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
284 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
290 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
295 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
298 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
299 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
300 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
301 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
302 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
303 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
304 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
305 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
306 2791355199
307 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
308 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
309 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
310 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
311 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
312 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
313 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
314 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
315 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
316 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
317 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
318 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
319 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
320 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
321 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
322 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
323 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
324 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
325 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
326 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
327 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
328 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
329 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
330 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
331 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
332 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
333 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
334 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
335 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
336 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
337 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
338 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
339 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
340 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
341 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
342 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
343 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
344 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
345 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
346 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
347 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
348 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
349 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
350 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
351 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
352 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
353 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
354 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
355 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
356 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
357 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
358 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
359 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
360 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
361 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
362 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
363 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
364 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86
Metatranscriptomes 0.2
Isolates 13.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.13
Nodule 12.15
Rhizoplane 4.25
Rhizosphere 65.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10332189 3300014745 Bacteria 1014
2 JGI25406J46586_10000021 3300003203 Bacteria 84514
3 JGI25406J46586_10000269 3300003203 Bacteria 23146
4 JGI25153J46596_10001525 3300003215 Bacteria 13779
5 JGI25153J46596_10092651 3300003215 Bacteria 727
6 rootH1_10052972 3300003323 Bacteria 2039
7 JGI25404J52841_10001159 3300003659 Bacteria 4478
8 Ga0055542_1010894 3300003762 Bacteria 1638
9 Ga0065715_10434397 3300005293 Bacteria 826
10 Ga0070658_10027153 3300005327 Bacteria 4596
11 Ga0070676_11076471 3300005328 Bacteria 606
12 Ga0070690_100375878 3300005330 Bacteria 1038
13 Ga0070670_100246784 3300005331 Bacteria 1555
14 Ga0068869_100030035 3300005334 Bacteria 3811
15 Ga0068869_100353379 3300005334 Bacteria 1198
16 Ga0068868_100041625 3300005338 Bacteria 3579
17 Ga0068868_100052187 3300005338 Bacteria 3219
18 Ga0070689_100288144 3300005340 Bacteria 1364
19 Ga0070691_10162003 3300005341 Bacteria 1154
20 Ga0070661_101566760 3300005344 Bacteria 557
21 Ga0070668_100051404 3300005347 Bacteria 3175
22 Ga0070668_100082936 3300005347 Bacteria 2515
23 Ga0070671_101120231 3300005355 Bacteria 692
24 Ga0070674_100569520 3300005356 Bacteria 953
25 Ga0070659_101149127 3300005366 Bacteria 685
26 Ga0070667_100032145 3300005367 Bacteria 4376
27 Ga0070667_100075279 3300005367 Bacteria 2882
28 Ga0070667_100352113 3300005367 Bacteria 1333
29 Ga0070714_100231318 3300005435 Bacteria 1703
30 Ga0070713_100011978 3300005436 Bacteria 6344
31 Ga0070713_100126199 3300005436 Bacteria 2251
32 Ga0070710_10005542 3300005437 Bacteria 6006
33 Ga0070710_10658562 3300005437 Bacteria 735
34 Ga0070701_11088363 3300005438 Bacteria 562
35 Ga0070711_100025201 3300005439 Bacteria 3888
36 Ga0070694_100274270 3300005444 Bacteria 1284
37 Ga0070663_100018999 3300005455 Bacteria 4520
38 Ga0070678_100018567 3300005456 Bacteria 4509
39 Ga0070662_100033672 3300005457 Bacteria 3609
40 Ga0070681_10863291 3300005458 Bacteria 823
41 Ga0068867_100448311 3300005459 Bacteria 1099
42 Ga0070698_100205498 3300005471 Bacteria 1905
43 Ga0070699_100898153 3300005518 Bacteria 811
44 Ga0070697_101479297 3300005536 Bacteria 607
45 Ga0070686_100313720 3300005544 Bacteria 1167
46 Ga0070695_100086361 3300005545 Bacteria 2085
47 Ga0070693_100663598 3300005547 Bacteria 760
48 Ga0070665_100027551 3300005548 Bacteria 5723
49 Ga0070665_100102260 3300005548 Bacteria 2869
50 Ga0070665_100128801 3300005548 Bacteria 2533
51 Ga0070665_100249038 3300005548 Bacteria 1777
52 Ga0070665_100801661 3300005548 Bacteria 955
53 Ga0068855_100062964 3300005563 Bacteria 4329
54 Ga0068857_100385194 3300005577 Bacteria 1303
55 Ga0070702_100061499 3300005615 Bacteria 2187
56 Ga0068852_100031085 3300005616 Bacteria 4401
57 Ga0068852_100129486 3300005616 Bacteria 2322
58 Ga0068859_100302822 3300005617 Bacteria 1692
59 Ga0068859_101146427 3300005617 Bacteria 856
60 Ga0068864_100168122 3300005618 Bacteria 1998
61 Ga0068866_10341206 3300005718 Bacteria 949
62 Ga0068861_100252418 3300005719 Bacteria 1506
63 Ga0068870_10078063 3300005840 Bacteria 1823
64 Ga0068863_100241446 3300005841 Bacteria 1744
65 Ga0068863_100931960 3300005841 Bacteria 870
66 Ga0068858_100030613 3300005842 Bacteria 4997
67 Ga0068858_100416546 3300005842 Bacteria 1292
68 Ga0068860_100073510 3300005843 Bacteria 3250
69 Ga0068862_100195390 3300005844 Bacteria 1822
70 Ga0068862_100216766 3300005844 Bacteria 1731
71 Ga0068862_101615070 3300005844 Bacteria 655
72 Ga0081455_10001978 3300005937 Bacteria 24467
73 Ga0081455_10001988 3300005937 Bacteria 24413
74 Ga0081455_10005841 3300005937 Bacteria 13387
75 Ga0081455_10055382 3300005937 Bacteria 3373
76 Ga0081455_10064180 3300005937 Bacteria 3077
77 Ga0081455_10163717 3300005937 Bacteria 1702
78 Ga0081538_10100867 3300005981 Bacteria 1454
79 Ga0081540_1003793 3300005983 Bacteria 11827
80 Ga0081540_1005364 3300005983 Bacteria 9592
81 Ga0081540_1007737 3300005983 Bacteria 7610
82 Ga0081540_1008398 3300005983 Bacteria 7218
83 Ga0081540_1008775 3300005983 Bacteria 7026
84 Ga0081540_1054690 3300005983 Bacteria 1949
85 Ga0081540_1213207 3300005983 Bacteria 693
86 Ga0081539_10000051 3300005985 Bacteria 268337
87 Ga0081539_10000220 3300005985 Bacteria 133834
88 Ga0081539_10065243 3300005985 Bacteria 1978
89 Ga0081539_10065465 3300005985 Bacteria 1974
90 Ga0081539_10087430 3300005985 Bacteria 1619
91 Ga0081539_10211473 3300005985 Bacteria 888
92 Ga0070717_10017426 3300006028 Bacteria 5589
93 Ga0070717_10056529 3300006028 Bacteria 3242
94 Ga0075365_10023353 3300006038 Bacteria 3889
95 Ga0075365_10075169 3300006038 Bacteria 2279
96 Ga0075365_10079247 3300006038 Bacteria 2222
97 Ga0075365_10086319 3300006038 Bacteria 2133
98 Ga0075368_10031264 3300006042 Bacteria 2063
99 Ga0075368_10138173 3300006042 Bacteria 1015
100 Ga0075363_100023206 3300006048 Bacteria 3142
101 Ga0075363_100414454 3300006048 Bacteria 793
102 Ga0075364_10096829 3300006051 Bacteria 1962
103 Ga0070712_100054757 3300006175 Bacteria 2790
104 Ga0075362_10098900 3300006177 Bacteria 1362
105 Ga0075362_10104857 3300006177 Bacteria 1325
106 Ga0075367_10284477 3300006178 Bacteria 1040
107 Ga0075369_10029535 3300006186 Bacteria 2303
108 Ga0075366_10008087 3300006195 Bacteria 5831
109 Ga0075366_10059696 3300006195 Bacteria 2265
110 Ga0097621_100215602 3300006237 Bacteria 1671
111 Ga0075370_10028392 3300006353 Bacteria 3110
112 Ga0068871_100209190 3300006358 Bacteria 1687
113 Ga0075428_100221126 3300006844 Bacteria 2045
114 Ga0075433_10919741 3300006852 Bacteria 763
115 Ga0075434_100219108 3300006871 Bacteria 1923
116 Ga0075434_100942501 3300006871 Bacteria 878
117 Ga0097620_100302831 3300006931 Bacteria 1692
118 Ga0097620_101146337 3300006931 Bacteria 856
119 Ga0099794_10258909 3300007265 Bacteria 898
120 Ga0105250_10064381 3300009092 Bacteria 1477
121 Ga0111539_10008430 3300009094 Bacteria 13114
122 Ga0105245_11531304 3300009098 Bacteria 718
123 Ga0114129_10915782 3300009147 Bacteria 1110
124 Ga0114129_11093844 3300009147 Bacteria 998
125 Ga0105243_10748271 3300009148 Bacteria 958
126 Ga0105241_10600075 3300009174 Bacteria 994
127 Ga0105248_10030358 3300009177 Bacteria 6034
128 Ga0105248_10773326 3300009177 Bacteria 1084
129 Ga0105237_10075090 3300009545 Bacteria 3372
130 Ga0105237_10992145 3300009545 Bacteria 847
131 Ga0105238_10413996 3300009551 Bacteria 1342
132 Ga0105238_10472435 3300009551 Bacteria 1253
133 Ga0099796_10061243 3300010159 Bacteria 1334
134 Ga0105239_10929964 3300010375 Bacteria 998
135 Ga0105246_10148698 3300011119 Bacteria 1770
136 Ga0157318_1012961 3300012482 Bacteria 651
137 Ga0157335_1025211 3300012492 Bacteria 592
138 Ga0157370_10297259 3300013104 Bacteria 1491
139 Ga0163162_10018772 3300013306 Bacteria 6779
140 Ga0163162_10498041 3300013306 Bacteria 1349
141 Ga0157375_10351831 3300013308 Bacteria 1639
142 Ga0163163_10722437 3300014325 Bacteria 1060
143 Ga0157380_10583537 3300014326 Bacteria 1103
144 Ga0157379_10489621 3300014968 Bacteria 1139
145 Ga0182007_10068280 3300015262 Bacteria 1165
146 Ga0163161_10243605 3300017792 Bacteria 1399
147 Ga0163161_10263980 3300017792 Bacteria 1345
148 Ga0163161_10550934 3300017792 Bacteria 945
149 Ga0209148_1001164 3300025254 Bacteria 15296
150 Ga0209233_1010791 3300025261 Bacteria 2716
151 Ga0209455_1022200 3300025272 Bacteria 1214
152 Ga0209758_1002906 3300025297 Bacteria 16534
153 Ga0209758_1004503 3300025297 Bacteria 11559
154 Ga0207692_10000456 3300025898 Bacteria 14471
155 Ga0207642_10116144 3300025899 Bacteria 1372
156 Ga0207688_10025283 3300025901 Bacteria 3261
157 Ga0207699_10001376 3300025906 Bacteria 11583
158 Ga0207645_10413022 3300025907 Bacteria 909
159 Ga0207643_10198539 3300025908 Bacteria 1221
160 Ga0207705_10033730 3300025909 Bacteria 3657
161 Ga0207705_10438775 3300025909 Bacteria 1012
162 Ga0207654_10012598 3300025911 Bacteria 4335
163 Ga0207671_10106556 3300025914 Bacteria 2128
164 Ga0207693_10141461 3300025915 Bacteria 1892
165 Ga0207663_10003756 3300025916 Bacteria 7488
166 Ga0207657_10078838 3300025919 Bacteria 2772
167 Ga0207657_10159047 3300025919 Bacteria 1836
168 Ga0207649_11088856 3300025920 Bacteria 630
169 Ga0207694_10852004 3300025924 Bacteria 770
170 Ga0207687_11017051 3300025927 Bacteria 711
171 Ga0207700_10017248 3300025928 Bacteria 4819
172 Ga0207700_10044019 3300025928 Bacteria 3283
173 Ga0207664_10034282 3300025929 Bacteria 3909
174 Ga0207690_10332047 3300025932 Bacteria 1198
175 Ga0207690_11115222 3300025932 Bacteria 658
176 Ga0207706_10025090 3300025933 Bacteria 5344
177 Ga0207686_10334505 3300025934 Bacteria 1136
178 Ga0207670_10312829 3300025936 Bacteria 1233
179 Ga0207669_10721375 3300025937 Bacteria 821
180 Ga0207704_10177775 3300025938 Bacteria 1534
181 Ga0207704_10289888 3300025938 Bacteria 1248
182 Ga0207711_10075422 3300025941 Bacteria 2935
183 Ga0207711_10079519 3300025941 Bacteria 2862
184 Ga0207711_10522992 3300025941 Bacteria 1106
185 Ga0207689_10020163 3300025942 Bacteria 5615
186 Ga0207689_10021152 3300025942 Bacteria 5469
187 Ga0207667_10161076 3300025949 Bacteria 2308
188 Ga0207712_10394620 3300025961 Bacteria 1161
189 Ga0207668_10010843 3300025972 Bacteria 5520
190 Ga0207668_10298546 3300025972 Bacteria 1328
191 Ga0207677_10187150 3300026023 Bacteria 1634
192 Ga0207703_10266393 3300026035 Bacteria 1550
193 Ga0207703_10291912 3300026035 Bacteria 1484
194 Ga0207639_10256115 3300026041 Bacteria 1528
195 Ga0207678_10031887 3300026067 Bacteria 4594
196 Ga0207678_10050635 3300026067 Bacteria 3588
197 Ga0207678_10060281 3300026067 Bacteria 3264
198 Ga0207702_10049798 3300026078 Bacteria 3535
199 Ga0207641_10079024 3300026088 Bacteria 2851
200 Ga0207676_10037016 3300026095 Bacteria 3716
201 Ga0207674_10514210 3300026116 Bacteria 1156
202 Ga0207675_100004262 3300026118 Bacteria 13835
203 Ga0207675_100071196 3300026118 Bacteria 3250
204 Ga0207683_10017904 3300026121 Bacteria 6041
205 Ga0207698_10138952 3300026142 Bacteria 2089
206 Ga0207698_10699348 3300026142 Bacteria 1008
207 Ga0209813_10067153 3300027866 Bacteria 1158
208 Ga0207428_10337917 3300027907 Bacteria 1110
209 Ga0268266_10039534 3300028379 Bacteria 4018
210 Ga0268266_10192446 3300028379 Bacteria 1863
211 Ga0268266_10271751 3300028379 Bacteria 1573
212 Ga0268266_10828575 3300028379 Bacteria 894
213 Ga0268265_10024207 3300028380 Bacteria 4292
214 Ga0268265_10075615 3300028380 Bacteria 2639
215 Ga0268265_10135173 3300028380 Bacteria 2056
216 Ga0307517_10000483 3300028786 Bacteria 68332
217 Ga0307509_10146403 3300031507 Bacteria 2287
218 Ga0307408_100258510 3300031548 Bacteria 1440
219 Ga0307408_100371157 3300031548 Bacteria 1220
220 Ga0307508_10086954 3300031616 Bacteria 2710
221 Ga0307508_10716241 3300031616 Bacteria 611
222 Ga0265314_10400592 3300031711 Bacteria 742
223 Ga0307516_10009045 3300031730 Bacteria 11159
224 Ga0307516_10275088 3300031730 Bacteria 1368
225 Ga0307516_10410279 3300031730 Bacteria 1013
226 Ga0307516_10674085 3300031730 Bacteria 690
227 Ga0307413_10036106 3300031824 Bacteria 2843
228 Ga0307407_10209086 3300031903 Bacteria 1313
229 Ga0307412_10197509 3300031911 Bacteria 1525
230 Ga0307416_100721397 3300032002 Bacteria 1087
231 Ga0307416_100745891 3300032002 Bacteria 1071
232 Ga0307510_10001008 3300033180 Bacteria 29864
233 Ga0307510_10196689 3300033180 Bacteria 1556
234 Ga0373930_0055651 3300034816 Bacteria 873
235 Ga0373932_0091435 3300035112 Bacteria 977
236 Ga0373936_0088087 3300035113 Bacteria 1299
237 Ga0373931_0563123 3300035691 Bacteria 741
238 Ga0373927_0004609 3300035695 Bacteria 9608
239 Ga0373927_0367472 3300035695 Bacteria 948
240 Ga0373927_0475865 3300035695 Bacteria 825
241 Ga0373933_0000259 3300035724 Bacteria 34812
242 Ga0373947_0096267 3300035725 Bacteria 1853
243 Ga0395900_0161423 3300037418 Bacteria 2286
244 Ga0395905_0020297 3300037471 Bacteria 6295
245 Ga0395905_0231914 3300037471 Bacteria 1726
246 Ga0395901_1432692 3300038443 Bacteria 648
247 Ga0451791_0914412 3300041451 Bacteria 822
248 Ga0451798_0200657 3300041458 Bacteria 1337
249 Ga0451807_1458333 3300041486 Bacteria 645
250 Ga0451839_0524548 3300041496 Bacteria 532
251 Ga0451841_1210409 3300041498 Bacteria 1879
252 Ga0451849_1522652 3300041505 Bacteria 1232
253 Ga0451853_3930811 3300041512 Bacteria 1591
254 Ga0439459_0013678 3300042438 Bacteria 1463
255 Ga0466969_0089864 3300044656 Bacteria 1456
256 Ga0466969_0396690 3300044656 Bacteria 626
257 Ga0466972_0000850 3300044658 Bacteria 14632
258 Ga0466966_0000398 3300044684 Bacteria 28025
259 Ga0466961_0000005 3300044693 Bacteria 173105
260 Ga0466959_0012763 3300045049 Bacteria 6079
261 Ga0495603_0060763 3300046455 Bacteria 2232
262 Ga0495590_0144991 3300046457 Bacteria 858
263 Ga0495629_0027490 3300046459 Bacteria 4039
264 Ga0495638_0007340 3300046460 Bacteria 7912
265 Ga0495651_0030168 3300046462 Bacteria 4228
266 Ga0495650_0258674 3300046471 Bacteria 590
267 Ga0495580_0192581 3300046472 Bacteria 1406
268 Ga0495582_0094526 3300046473 Bacteria 1669
269 Ga0495639_0169968 3300046475 Bacteria 1058
270 Ga0495662_0148113 3300046476 Bacteria 1156
271 Ga0495664_0027419 3300046477 Bacteria 3321
272 Ga0495664_0501499 3300046477 Bacteria 725
273 Ga0495584_0066289 3300046491 Bacteria 1816
274 Ga0495584_0473585 3300046491 Bacteria 637
275 Ga0495585_0088581 3300046492 Bacteria 1669
276 Ga0495594_0113416 3300046499 Bacteria 1529
277 Ga0495607_0112690 3300046501 Bacteria 1440
278 Ga0495606_0024526 3300046507 Bacteria 4343
279 Ga0495606_0087215 3300046507 Bacteria 1927
280 Ga0495606_0236419 3300046507 Bacteria 1021
281 Ga0495608_0388643 3300046511 Bacteria 855
282 Ga0495608_0480678 3300046511 Bacteria 754
283 Ga0495610_0026154 3300046512 Bacteria 3120
284 Ga0495620_0064743 3300046515 Bacteria 1511
285 Ga0495628_0382436 3300046516 Bacteria 1030
286 Ga0495632_0020619 3300046519 Bacteria 3565
287 Ga0495643_0044657 3300046522 Bacteria 2407
288 Ga0495644_0370333 3300046523 Bacteria 565
289 Ga0495648_0074757 3300046524 Bacteria 1951
290 Ga0495663_0056740 3300046525 Bacteria 1224
291 Ga0495652_0072645 3300046529 Bacteria 2866
292 Ga0495652_0116353 3300046529 Bacteria 2141
293 Ga0495654_0258902 3300046530 Bacteria 722
294 Ga0495640_0006880 3300046533 Bacteria 8959
295 Ga0495640_0094312 3300046533 Bacteria 1971
296 Ga0495587_0026481 3300046536 Bacteria 3536
297 Ga0495598_0152021 3300046537 Bacteria 808
298 Ga0495609_0016837 3300046538 Bacteria 3403
299 Ga0495597_0076276 3300046542 Bacteria 1438
300 Ga0495645_0046341 3300046543 Bacteria 3169
301 Ga0495622_0044363 3300046557 Bacteria 2066
302 Ga0495622_0074787 3300046557 Bacteria 1562
303 Ga0495622_0242022 3300046557 Bacteria 795
304 Ga0495633_0111807 3300046558 Bacteria 1266
305 Ga0495667_0254537 3300046559 Bacteria 1117
306 Ga0495656_0015466 3300046615 Bacteria 2880
307 Ga0495656_0063766 3300046615 Bacteria 1616
308 Ga0495668_0058123 3300046616 Bacteria 2134
309 Ga0495668_0477028 3300046616 Bacteria 687
310 Ga0495634_0038079 3300046642 Bacteria 3280
311 Ga0495625_0075449 3300046660 Bacteria 2359
312 Ga0495625_0278162 3300046660 Bacteria 1078
313 Ga0495625_0852994 3300046660 Bacteria 526
314 Ga0495635_0003249 3300046663 Bacteria 11213
315 Ga0495588_0063338 3300046674 Bacteria 1917
316 Ga0495657_0002292 3300046675 Bacteria 16171
317 Ga0495599_0008570 3300046678 Bacteria 6225
318 Ga0495623_0020342 3300046679 Bacteria 4289
319 Ga0495646_0012566 3300046680 Bacteria 5380
320 Ga0495646_0091134 3300046680 Bacteria 1760
321 Ga0495613_0126940 3300046689 Bacteria 1829
322 Ga0495613_0303800 3300046689 Bacteria 1104
323 Ga0495613_0327693 3300046689 Bacteria 1056
324 Ga0495624_0522918 3300046690 Bacteria 709
325 Ga0495670_0434727 3300046691 Bacteria 710
326 Ga0495671_0040638 3300046692 Bacteria 2345
327 Ga0495671_0119209 3300046692 Bacteria 1288
328 Ga0495649_0196956 3300046694 Bacteria 1047
329 Ga0495589_0033890 3300046794 Bacteria 2563
330 Ga0495600_0002145 3300046809 Bacteria 11183
331 Ga0495600_0672498 3300046809 Bacteria 624
332 Ga0495581_0046986 3300047315 Bacteria 2495
333 Ga0495581_0750332 3300047315 Bacteria 561
334 Ga0495604_0014542 3300047317 Bacteria 6277
335 Ga0495604_0644129 3300047317 Bacteria 676
336 Ga0495636_0067491 3300047318 Bacteria 1522
337 Ga0495674_0009927 3300047319 Bacteria 9028
338 Ga0495674_1369108 3300047319 Bacteria 528
339 Ga0495676_0077279 3300047321 Bacteria 2539
340 Ga0495676_0729430 3300047321 Bacteria 640
341 Ga0495680_0000920 3300047322 Bacteria 32673
342 Ga0495683_0112249 3300047323 Bacteria 1300
343 Ga0495675_0003133 3300047444 Bacteria 9927
344 Ga0495673_0103398 3300047469 Bacteria 1148
345 Ga0495673_0267731 3300047469 Bacteria 620
346 Ga0495686_0037828 3300047472 Bacteria 3090
347 Ga0495602_0003728 3300048088 Bacteria 15826
348 Ga0495602_0105152 3300048088 Bacteria 2308
349 Ga0496100_0762068 3300048903 Bacteria 757
350 Ga0496101_0803860 3300048904 Bacteria 741
351 Ga0496102_0109234 3300048905 Bacteria 2577
352 Ga0496104_0055220 3300048907 Bacteria 3755
353 Ga0496105_0487160 3300048908 Bacteria 969
354 Ga0496105_1215356 3300048908 Bacteria 554
355 Ga0496106_0054533 3300048909 Bacteria 3020
356 Ga0496106_0400666 3300048909 Bacteria 1103
357 Ga0496107_0027504 3300048910 Bacteria 4038
358 Ga0496108_0559535 3300048911 Bacteria 997
359 Ga0496110_0366579 3300048913 Bacteria 1312
360 Ga0496111_0157094 3300048914 Bacteria 1688
361 Ga0496111_0463725 3300048914 Bacteria 934
362 Ga0496111_0873447 3300048914 Bacteria 648
363 Ga0496112_0000018 3300048915 Bacteria 188820
364 Ga0496114_0024532 3300048917 Bacteria 4924
365 Ga0496115_0421326 3300048918 Bacteria 1081
366 Ga0496115_1051233 3300048918 Bacteria 620
367 Ga0496121_0205957 3300048924 Bacteria 1397
368 Ga0496121_0237186 3300048924 Bacteria 1273
369 Ga0496122_0030489 3300048925 Bacteria 4518
370 Ga0496124_0080696 3300048927 Bacteria 2676
371 Ga0496124_0355128 3300048927 Bacteria 1035
372 Ga0496124_0374476 3300048927 Bacteria 998
373 Ga0496125_0092132 3300048928 Bacteria 2267
374 Ga0496125_0156305 3300048928 Bacteria 1557
375 Ga0496125_0159478 3300048928 Bacteria 1535
376 Ga0496126_0003109 3300048929 Bacteria 21428
377 Ga0496126_0311688 3300048929 Bacteria 1295
378 Ga0501031_0477355 3300049568 Bacteria 805
379 Ga0501048_0423943 3300049582 Bacteria 952
380 Ga0501071_0124844 3300049587 Bacteria 1910
381 Ga0501075_0489839 3300049591 Bacteria 938
382 Ga0501076_0851472 3300049592 Bacteria 752
383 Ga0501257_162574 3300049686 Bacteria 622
384 Ga0501044_0341728 3300049823 Bacteria 1418
385 nmdc:mga03683_212988_c1 3300050489 Bacteria 889
386 nmdc:mga03n38_220289_c1 3300050490 Bacteria 990
387 nmdc:mga03n38_63215_c1 3300050490 Bacteria 1691
388 nmdc:mga0yw44_112336_c1 3300050492 Bacteria 1747
389 nmdc:mga0yw44_11924_c1 3300050492 Bacteria 4511
390 nmdc:mga0k408_630458_c1 3300050493 Bacteria 631
391 nmdc:mga06z11_127821_c1 3300050494 Bacteria 1424
392 nmdc:mga06z11_278665_c1 3300050494 Bacteria 990
393 nmdc:mga04h51_107700_c1 3300050495 Bacteria 1023
394 nmdc:mga07m45_47137_c1 3300050496 Bacteria 2422
395 nmdc:mga05p37_1463434_c1 3300050507 Bacteria 683
396 nmdc:mga05p37_840710_c1 3300050507 Bacteria 998
397 nmdc:mga08y16_79307_c1 3300050511 Bacteria 3422
398 nmdc:mga0a205_982780_c1 3300050515 Bacteria 691
399 Ga0495655_0039985 3300053083 Bacteria 1192
400 Ga0495595_0018656 3300053084 Bacteria 3001
401 Ga0495619_0043790 3300053085 Bacteria 2936
402 Ga0495619_0856862 3300053085 Bacteria 613
403 Ga0500646_0312666 3300053090 Bacteria 566
404 Ga0500583_0051217 3300053092 Bacteria 1917
405 Ga0500641_0004265 3300053096 Bacteria 5048
406 Ga0500557_000003 3300053105 Bacteria 228429
407 Ga0500562_105973 3300053108 Bacteria 766
408 Ga0500595_002820 3300053119 Bacteria 8360
409 Ga0500595_008808 3300053119 Bacteria 4101
410 Ga0500595_117626 3300053119 Bacteria 752
411 Ga0500642_0000138 3300053130 Bacteria 32489
412 Ga0500642_0294178 3300053130 Bacteria 735
413 Ga0500658_0039308 3300053134 Bacteria 1890
414 Ga0500568_0327261 3300053139 Bacteria 556
415 Ga0500588_0087472 3300053146 Bacteria 1054
416 Ga0500590_140708 3300053148 Bacteria 1103
417 Ga0500627_0317788 3300053158 Bacteria 677
418 Ga0500636_0431415 3300053177 Bacteria 602
419 Ga0500636_0509694 3300053177 Bacteria 529
420 Ga0500637_0212876 3300053178 Bacteria 1096
421 Ga0500637_0417748 3300053178 Bacteria 691
422 Ga0500625_004251 3300053729 Bacteria 5814
423 Ga0587071_067065 3300060344 Bacteria 774
424 Ga0501082_1015064 3300060353 Bacteria 725
425 2507507496 2507262055 Bacteria 8048963
426 2508541612 2508501009 Bacteria 7784016
427 2508692846 2508501042 Bacteria 8719808
428 2513636861 2513237094 Bacteria 8789602
429 2513693702 2513237101 Bacteria 7952346
430 2513860768 2513237137 Bacteria 9558895
431 2515626239 2515154112 Bacteria 8294334
432 2524436116 2524023205 Bacteria 8918781
433 2723843526 2721755755 Bacteria 8322773
434 2793083941
435 2844318698 2844315083 Bacteria 8138177
436 2874598611 2874590934 Bacteria 8299676
437 2874611564 2874604998 Bacteria 7834745
438 2874652065 2874645413 Bacteria 8214782
439 2876768258 2876761206 Bacteria 10111113
440 2876778650 2876771140 Bacteria 8287509
441 2876813663 2876808645 Bacteria 8824342
442 2876823454 2876818435 Bacteria 8274608
443 2879082443 2879074833 Bacteria 8279565
444 2879117415 2879110137 Bacteria 8907982
445 2879131776 2879127579 Bacteria 8294491
446 2879150112 2879142872 Bacteria 8267021
447 2889037836 2889033259 Bacteria 9099371
448 2903728829 2903727486 Bacteria 8281579
449 2906604473 2906602504 Bacteria 8295279
450 2906627769 2906626472 Bacteria 8826946
451 2922361781 2922361189 Bacteria 7436256
452 2922386977 2922386360 Bacteria 7017218
453 2935609997 2935608549 Bacteria 8203142
454 2935634882 2935630451 Bacteria 8169952
455 2935651974 2935648319 Bacteria 8801166
456 2935660053 2935656913 Bacteria 8965014
457 2935823157 2935819856 Bacteria 8261050
458 2935848739 2935847175 Bacteria 8228321
459 2935909455 2935908558 Bacteria 8568796
460 2935926936 2935926038 Bacteria 8601059
461 2935937220 2935934488 Bacteria 8602579
462 2935944477 2935942939 Bacteria 8599779
463 2935952914 2935951376 Bacteria 8602333
464 2935969754 2935967501 Bacteria 8603075
465 2935976353 2935975950 Bacteria 8347125
466 2935987198 2935984226 Bacteria 8302647
467 2936014469 2936011229 Bacteria 8801034
468 2936023691 2936019824 Bacteria 8804134
469 2936031334 2936028420 Bacteria 8965941
470 2936049575 2936046547 Bacteria 8903709
471 2936061210 2936055302 Bacteria 8785755
472 2941511787 2941507105 Bacteria 8166816
473 2941519489 2941515067 Bacteria 8166720
474 2941527818 2941523033 Bacteria 8169134
475 3005600492 3005594810 Bacteria 8716512
476 3005720198 3005718088 Bacteria 8283608
477 8006928604 8006926726 Bacteria 6749210
478 8006966895 8006964411 Bacteria 8966052
479 8006973178 8006964411 Bacteria 8966052
480 8006991464 8006984368 Bacteria 9651211
481 8006994597 8006994254 Bacteria 8309700
482 8016594551 8016583857 Bacteria 10421953
483 8016638989 8016630954 Bacteria 9217207
484 8019619988 8019619141 Bacteria 9218857
485 8019633119 8019629233 Bacteria 8687553
486 8019646781 8019638758 Bacteria 9062356
487 8019649550 8019648815 Bacteria 10014479
488 8019660990 8019659431 Bacteria 8577854
489 8019670560 8019668869 Bacteria 8791617
490 8019685674 8019678201 Bacteria 8863603
491 8019691251 8019687851 Bacteria 8712826
492 8056680937 8056673599 Bacteria 7871253
493 8056973106 8056967851 Bacteria 9038162
494 Ga0157377_10332189
495 JGI25406J46586_10000021
496 JGI25406J46586_10000269
497 JGI25153J46596_10001525
498 JGI25153J46596_10092651
499 rootH1_10052972
500 JGI25404J52841_10001159
501 Ga0055542_1010894
502 Ga0065715_10434397
503 Ga0070658_10027153
504 Ga0070676_11076471
505 Ga0070690_100375878
506 Ga0070670_100246784
507 Ga0068869_100030035
508 Ga0068869_100353379
509 Ga0068868_100041625
510 Ga0068868_100052187
511 Ga0070689_100288144
512 Ga0070691_10162003
513 Ga0070661_101566760
514 Ga0070668_100051404
515 Ga0070668_100082936
516 Ga0070671_101120231
517 Ga0070674_100569520
518 Ga0070659_101149127
519 Ga0070667_100032145
520 Ga0070667_100075279
521 Ga0070667_100352113
522 Ga0070714_100231318
523 Ga0070713_100011978
524 Ga0070713_100126199
525 Ga0070710_10005542
526 Ga0070710_10658562
527 Ga0070701_11088363
528 Ga0070711_100025201
529 Ga0070694_100274270
530 Ga0070663_100018999
531 Ga0070678_100018567
532 Ga0070662_100033672
533 Ga0070681_10863291
534 Ga0068867_100448311
535 Ga0070698_100205498
536 Ga0070699_100898153
537 Ga0070697_101479297
538 Ga0070686_100313720
539 Ga0070695_100086361
540 Ga0070693_100663598
541 Ga0070665_100027551
542 Ga0070665_100102260
543 Ga0070665_100128801
544 Ga0070665_100249038
545 Ga0070665_100801661
546 Ga0068855_100062964
547 Ga0068857_100385194
548 Ga0070702_100061499
549 Ga0068852_100031085
550 Ga0068852_100129486
551 Ga0068859_100302822
552 Ga0068859_101146427
553 Ga0068864_100168122
554 Ga0068866_10341206
555 Ga0068861_100252418
556 Ga0068870_10078063
557 Ga0068863_100241446
558 Ga0068863_100931960
559 Ga0068858_100030613
560 Ga0068858_100416546
561 Ga0068860_100073510
562 Ga0068862_100195390
563 Ga0068862_100216766
564 Ga0068862_101615070
565 Ga0081455_10001978
566 Ga0081455_10001988
567 Ga0081455_10005841
568 Ga0081455_10055382
569 Ga0081455_10064180
570 Ga0081455_10163717
571 Ga0081538_10100867
572 Ga0081540_1003793
573 Ga0081540_1005364
574 Ga0081540_1007737
575 Ga0081540_1008398
576 Ga0081540_1008775
577 Ga0081540_1054690
578 Ga0081540_1213207
579 Ga0081539_10000051
580 Ga0081539_10000220
581 Ga0081539_10065243
582 Ga0081539_10065465
583 Ga0081539_10087430
584 Ga0081539_10211473
585 Ga0070717_10017426
586 Ga0070717_10056529
587 Ga0075365_10023353
588 Ga0075365_10075169
589 Ga0075365_10079247
590 Ga0075365_10086319
591 Ga0075368_10031264
592 Ga0075368_10138173
593 Ga0075363_100023206
594 Ga0075363_100414454
595 Ga0075364_10096829
596 Ga0070712_100054757
597 Ga0075362_10098900
598 Ga0075362_10104857
599 Ga0075367_10284477
600 Ga0075369_10029535
601 Ga0075366_10008087
602 Ga0075366_10059696
603 Ga0097621_100215602
604 Ga0075370_10028392
605 Ga0068871_100209190
606 Ga0075428_100221126
607 Ga0075433_10919741
608 Ga0075434_100219108
609 Ga0075434_100942501
610 Ga0097620_100302831
611 Ga0097620_101146337
612 Ga0099794_10258909
613 Ga0105250_10064381
614 Ga0111539_10008430
615 Ga0105245_11531304
616 Ga0114129_10915782
617 Ga0114129_11093844
618 Ga0105243_10748271
619 Ga0105241_10600075
620 Ga0105248_10030358
621 Ga0105248_10773326
622 Ga0105237_10075090
623 Ga0105237_10992145
624 Ga0105238_10413996
625 Ga0105238_10472435
626 Ga0099796_10061243
627 Ga0105239_10929964
628 Ga0105246_10148698
629 Ga0157318_1012961
630 Ga0157335_1025211
631 Ga0157370_10297259
632 Ga0163162_10018772
633 Ga0163162_10498041
634 Ga0157375_10351831
635 Ga0163163_10722437
636 Ga0157380_10583537
637 Ga0157379_10489621
638 Ga0182007_10068280
639 Ga0163161_10243605
640 Ga0163161_10263980
641 Ga0163161_10550934
642 Ga0209148_1001164
643 Ga0209233_1010791
644 Ga0209455_1022200
645 Ga0209758_1002906
646 Ga0209758_1004503
647 Ga0207692_10000456
648 Ga0207642_10116144
649 Ga0207688_10025283
650 Ga0207699_10001376
651 Ga0207645_10413022
652 Ga0207643_10198539
653 Ga0207705_10033730
654 Ga0207705_10438775
655 Ga0207654_10012598
656 Ga0207671_10106556
657 Ga0207693_10141461
658 Ga0207663_10003756
659 Ga0207657_10078838
660 Ga0207657_10159047
661 Ga0207649_11088856
662 Ga0207694_10852004
663 Ga0207687_11017051
664 Ga0207700_10017248
665 Ga0207700_10044019
666 Ga0207664_10034282
667 Ga0207690_10332047
668 Ga0207690_11115222
669 Ga0207706_10025090
670 Ga0207686_10334505
671 Ga0207670_10312829
672 Ga0207669_10721375
673 Ga0207704_10177775
674 Ga0207704_10289888
675 Ga0207711_10075422
676 Ga0207711_10079519
677 Ga0207711_10522992
678 Ga0207689_10020163
679 Ga0207689_10021152
680 Ga0207667_10161076
681 Ga0207712_10394620
682 Ga0207668_10010843
683 Ga0207668_10298546
684 Ga0207677_10187150
685 Ga0207703_10266393
686 Ga0207703_10291912
687 Ga0207639_10256115
688 Ga0207678_10031887
689 Ga0207678_10050635
690 Ga0207678_10060281
691 Ga0207702_10049798
692 Ga0207641_10079024
693 Ga0207676_10037016
694 Ga0207674_10514210
695 Ga0207675_100004262
696 Ga0207675_100071196
697 Ga0207683_10017904
698 Ga0207698_10138952
699 Ga0207698_10699348
700 Ga0209813_10067153
701 Ga0207428_10337917
702 Ga0268266_10039534
703 Ga0268266_10192446
704 Ga0268266_10271751
705 Ga0268266_10828575
706 Ga0268265_10024207
707 Ga0268265_10075615
708 Ga0268265_10135173
709 Ga0307517_10000483
710 Ga0307509_10146403
711 Ga0307408_100258510
712 Ga0307408_100371157
713 Ga0307508_10086954
714 Ga0307508_10716241
715 Ga0265314_10400592
716 Ga0307516_10009045
717 Ga0307516_10275088
718 Ga0307516_10410279
719 Ga0307516_10674085
720 Ga0307413_10036106
721 Ga0307407_10209086
722 Ga0307412_10197509
723 Ga0307416_100721397
724 Ga0307416_100745891
725 Ga0307510_10001008
726 Ga0307510_10196689
727 Ga0373930_0055651
728 Ga0373932_0091435
729 Ga0373936_0088087
730 Ga0373931_0563123
731 Ga0373927_0004609
732 Ga0373927_0367472
733 Ga0373927_0475865
734 Ga0373933_0000259
735 Ga0373947_0096267
736 Ga0395900_0161423
737 Ga0395905_0020297
738 Ga0395905_0231914
739 Ga0395901_1432692
740 Ga0451791_0914412
741 Ga0451798_0200657
742 Ga0451807_1458333
743 Ga0451839_0524548
744 Ga0451841_1210409
745 Ga0451849_1522652
746 Ga0451853_3930811
747 Ga0439459_0013678
748 Ga0466969_0089864
749 Ga0466969_0396690
750 Ga0466972_0000850
751 Ga0466966_0000398
752 Ga0466961_0000005
753 Ga0466959_0012763
754 Ga0495603_0060763
755 Ga0495590_0144991
756 Ga0495629_0027490
757 Ga0495638_0007340
758 Ga0495651_0030168
759 Ga0495650_0258674
760 Ga0495580_0192581
761 Ga0495582_0094526
762 Ga0495639_0169968
763 Ga0495662_0148113
764 Ga0495664_0027419
765 Ga0495664_0501499
766 Ga0495584_0066289
767 Ga0495584_0473585
768 Ga0495585_0088581
769 Ga0495594_0113416
770 Ga0495607_0112690
771 Ga0495606_0024526
772 Ga0495606_0087215
773 Ga0495606_0236419
774 Ga0495608_0388643
775 Ga0495608_0480678
776 Ga0495610_0026154
777 Ga0495620_0064743
778 Ga0495628_0382436
779 Ga0495632_0020619
780 Ga0495643_0044657
781 Ga0495644_0370333
782 Ga0495648_0074757
783 Ga0495663_0056740
784 Ga0495652_0072645
785 Ga0495652_0116353
786 Ga0495654_0258902
787 Ga0495640_0006880
788 Ga0495640_0094312
789 Ga0495587_0026481
790 Ga0495598_0152021
791 Ga0495609_0016837
792 Ga0495597_0076276
793 Ga0495645_0046341
794 Ga0495622_0044363
795 Ga0495622_0074787
796 Ga0495622_0242022
797 Ga0495633_0111807
798 Ga0495667_0254537
799 Ga0495656_0015466
800 Ga0495656_0063766
801 Ga0495668_0058123
802 Ga0495668_0477028
803 Ga0495634_0038079
804 Ga0495625_0075449
805 Ga0495625_0278162
806 Ga0495625_0852994
807 Ga0495635_0003249
808 Ga0495588_0063338
809 Ga0495657_0002292
810 Ga0495599_0008570
811 Ga0495623_0020342
812 Ga0495646_0012566
813 Ga0495646_0091134
814 Ga0495613_0126940
815 Ga0495613_0303800
816 Ga0495613_0327693
817 Ga0495624_0522918
818 Ga0495670_0434727
819 Ga0495671_0040638
820 Ga0495671_0119209
821 Ga0495649_0196956
822 Ga0495589_0033890
823 Ga0495600_0002145
824 Ga0495600_0672498
825 Ga0495581_0046986
826 Ga0495581_0750332
827 Ga0495604_0014542
828 Ga0495604_0644129
829 Ga0495636_0067491
830 Ga0495674_0009927
831 Ga0495674_1369108
832 Ga0495676_0077279
833 Ga0495676_0729430
834 Ga0495680_0000920
835 Ga0495683_0112249
836 Ga0495675_0003133
837 Ga0495673_0103398
838 Ga0495673_0267731
839 Ga0495686_0037828
840 Ga0495602_0003728
841 Ga0495602_0105152
842 Ga0496100_0762068
843 Ga0496101_0803860
844 Ga0496102_0109234
845 Ga0496104_0055220
846 Ga0496105_0487160
847 Ga0496105_1215356
848 Ga0496106_0054533
849 Ga0496106_0400666
850 Ga0496107_0027504
851 Ga0496108_0559535
852 Ga0496110_0366579
853 Ga0496111_0157094
854 Ga0496111_0463725
855 Ga0496111_0873447
856 Ga0496112_0000018
857 Ga0496114_0024532
858 Ga0496115_0421326
859 Ga0496115_1051233
860 Ga0496121_0205957
861 Ga0496121_0237186
862 Ga0496122_0030489
863 Ga0496124_0080696
864 Ga0496124_0355128
865 Ga0496124_0374476
866 Ga0496125_0092132
867 Ga0496125_0156305
868 Ga0496125_0159478
869 Ga0496126_0003109
870 Ga0496126_0311688
871 Ga0501031_0477355
872 Ga0501048_0423943
873 Ga0501071_0124844
874 Ga0501075_0489839
875 Ga0501076_0851472
876 Ga0501257_162574
877 Ga0501044_0341728
878 nmdc:mga03683_212988_c1
879 nmdc:mga03n38_220289_c1
880 nmdc:mga03n38_63215_c1
881 nmdc:mga0yw44_112336_c1
882 nmdc:mga0yw44_11924_c1
883 nmdc:mga0k408_630458_c1
884 nmdc:mga06z11_127821_c1
885 nmdc:mga06z11_278665_c1
886 nmdc:mga04h51_107700_c1
887 nmdc:mga07m45_47137_c1
888 nmdc:mga05p37_1463434_c1
889 nmdc:mga05p37_840710_c1
890 nmdc:mga08y16_79307_c1
891 nmdc:mga0a205_982780_c1
892 Ga0495655_0039985
893 Ga0495595_0018656
894 Ga0495619_0043790
895 Ga0495619_0856862
896 Ga0500646_0312666
897 Ga0500583_0051217
898 Ga0500641_0004265
899 Ga0500557_000003
900 Ga0500562_105973
901 Ga0500595_002820
902 Ga0500595_008808
903 Ga0500595_117626
904 Ga0500642_0000138
905 Ga0500642_0294178
906 Ga0500658_0039308
907 Ga0500568_0327261
908 Ga0500588_0087472
909 Ga0500590_140708
910 Ga0500627_0317788
911 Ga0500636_0431415
912 Ga0500636_0509694
913 Ga0500637_0212876
914 Ga0500637_0417748
915 Ga0500625_004251
916 Ga0587071_067065
917 Ga0501082_1015064
918 2507507496
919 2508541612
920 2508692846
921 2513636861
922 2513693702
923 2513860768
924 2515626239
925 2524436116
926 2723843526
927 2793083941
928 2844318698
929 2874598611
930 2874611564
931 2874652065
932 2876768258
933 2876778650
934 2876813663
935 2876823454
936 2879082443
937 2879117415
938 2879131776
939 2879150112
940 2889037836
941 2903728829
942 2906604473
943 2906627769
944 2922361781
945 2922386977
946 2935609997
947 2935634882
948 2935651974
949 2935660053
950 2935823157
951 2935848739
952 2935909455
953 2935926936
954 2935937220
955 2935944477
956 2935952914
957 2935969754
958 2935976353
959 2935987198
960 2936014469
961 2936023691
962 2936031334
963 2936049575
964 2936061210
965 2941511787
966 2941519489
967 2941527818
968 3005600492
969 3005720198
970 8006928604
971 8006966895
972 8006973178
973 8006991464
974 8006994597
975 8016594551
976 8016638989
977 8019619988
978 8019633119
979 8019646781
980 8019649550
981 8019660990
982 8019670560
983 8019685674
984 8019691251
985 8056680937
986 8056973106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

111

182

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a7s-assembly1.cif.gz_A catalytic domain of uch37 0.6986 97 120
7piz-assembly2.cif.gz_B the structure of phosphoglucomutase from candida albicans 0.5765 116 161
6pvd-assembly2.cif.gz_C structure of human mait a-f7 tcr in complex with human mr1-nv18.1 0.5762 50 155
5lax-assembly1.cif.gz_B crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40 0.5724 50 153
6h6d-assembly2.cif.gz_D crystal structures of the murine class i major histocompatibility complex h-2db in complex with adenovirus-derived peptide ad10 0.5469 48 156
ID Description Score Start End Superfamily
af_A0A1D8PSF4_189_362_3.30.450.190 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.77 126 149 3.30.450.190
af_A4I161_1_232_3.40.532.10 Alpha Beta;3-Layer(aba) Sandwich;Ubiquitin C-terminal Hydrolase UCH-l3;Peptidase C12, ubiquitin carboxyl-terminal hydrolase 0.7668 99 122 3.40.532.10
af_Q54JZ8_205_474_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.763 126 155 3.50.50.60
af_B6SI96_1_222_3.40.532.10 Alpha Beta;3-Layer(aba) Sandwich;Ubiquitin C-terminal Hydrolase UCH-l3;Peptidase C12, ubiquitin carboxyl-terminal hydrolase 0.7498 98 122 3.40.532.10
af_A0A5S9MNN1_63_201_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6875 86 123 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A101VLS8-F1-model_v4 Cupin 0.7111 29 156
AF-A0A257G663-F1-model_v4 Cupin 0.7077 29 155
AF-V4Q675-F1-model_v4 Cupin type-2 domain-containing protein 0.7035 29 161
AF-A0A4Q5MHA6-F1-model_v4 deleted 0.7034 29 159
AF-A0A536Y9Q6-F1-model_v4 Cupin domain-containing protein 0.697 29 153

Map