F454574

General Info

Members Datasets Scaffolds Average Seq Length
494 190 487 71

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10038544|Ga0182008_100385442
Length 87
Sequence MAQWPGGGKTLARTPAVNRINPRKLLLSKWTAAHPQNREKHFLVTELFRDEDGTVLEIELQAVLTRRTEQCDWHALQDDSRWKMGWR

Samples

Sample ID Description Type Environment
1 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
2 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
3 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
4 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
5 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
6 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
87 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
93 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
96 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
97 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
98 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
99 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
100 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
101 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
102 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
190 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 2.23
Rhizosphere 80.97
Stem 0
Stem Tuber 0
Unclassified 12.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000219 3300002771 Bacteria 21336
2 JGI25164J39214_1000160 3300002772 Bacteria 63841
3 JGI25165J46597_1000290 3300003214 Bacteria 63841
4 rootH1_10184217 3300003323 Bacteria 1526
5 JGI26143J51219_1001913 3300003502 Bacteria 883
6 Ga0055525_1004420 3300003759 Bacteria 1210
7 Ga0055536_1000831 3300003781 Bacteria 20372
8 Ga0055530_10001294 3300003791 Bacteria 18901
9 Ga0055540_1000277 3300003792 Bacteria 46097
10 Ga0055531_10000123 3300003794 Bacteria 86722
11 Ga0065714_10292984 3300005288 Bacteria 705
12 Ga0065714_10324050 3300005288 Bacteria 665
13 Ga0065704_10272377 3300005289 Bacteria 940
14 Ga0065704_10332961 3300005289 Bacteria 835
15 Ga0070669_100016874 3300005353 Bacteria 5213
16 Ga0070663_100643430 3300005455 Bacteria 896
17 Ga0070662_100006388 3300005457 Bacteria 7595
18 Ga0070684_102310428 3300005535 Bacteria 507
19 Ga0070665_100135885 3300005548 Bacteria 2461
20 Ga0068855_102447657 3300005563 Bacteria 520
21 Ga0075432_10333871 3300006058 Bacteria 638
22 Ga0075362_10069147 3300006177 Bacteria 1609
23 Ga0075362_10198328 3300006177 Bacteria 976
24 Ga0075436_100285929 3300006914 Bacteria 1180
25 Ga0105251_10005928 3300009011 Bacteria 7897
26 Ga0105251_10014133 3300009011 Bacteria 4430
27 Ga0105244_10002038 3300009036 Bacteria 15563
28 Ga0105244_10003864 3300009036 Bacteria 10554
29 Ga0105244_10008293 3300009036 Bacteria 6502
30 Ga0105244_10008504 3300009036 Bacteria 6403
31 Ga0105244_10185560 3300009036 Bacteria 985
32 Ga0105244_10244717 3300009036 Bacteria 837
33 Ga0105244_10357175 3300009036 Bacteria 673
34 Ga0105244_10367224 3300009036 Bacteria 663
35 Ga0105250_10000637 3300009092 Bacteria 22489
36 Ga0105250_10002425 3300009092 Bacteria 9368
37 Ga0105250_10004161 3300009092 Bacteria 6711
38 Ga0105250_10007509 3300009092 Bacteria 4678
39 Ga0105250_10016955 3300009092 Bacteria 2963
40 Ga0105247_10789102 3300009101 Bacteria 724
41 Ga0105243_10000335 3300009148 Bacteria 51380
42 Ga0105238_12619295 3300009551 Bacteria 541
43 Ga0105249_10048077 3300009553 Bacteria 3890
44 Ga0105246_10000484 3300011119 Bacteria 21488
45 Ga0157345_1000093 3300012498 Bacteria 18946
46 Ga0157373_10024960 3300013100 Bacteria 4327
47 Ga0157373_10031898 3300013100 Bacteria 3794
48 Ga0157373_10127924 3300013100 Bacteria 1786
49 Ga0157371_10001483 3300013102 Bacteria 24268
50 Ga0157371_10013719 3300013102 Bacteria 6144
51 Ga0157371_10080369 3300013102 Bacteria 2309
52 Ga0157371_10891076 3300013102 Bacteria 674
53 Ga0157370_10082381 3300013104 Bacteria 3026
54 Ga0157370_10275500 3300013104 Bacteria 1554
55 Ga0157370_10371403 3300013104 Bacteria 1318
56 Ga0157370_10812084 3300013104 Bacteria 851
57 Ga0157370_11257937 3300013104 Bacteria 667
58 Ga0157369_10080665 3300013105 Bacteria 3484
59 Ga0157369_11622259 3300013105 Bacteria 658
60 Ga0163162_10420602 3300013306 Bacteria 1469
61 Ga0157372_10005543 3300013307 Bacteria 13421
62 Ga0157375_10002693 3300013308 Bacteria 15384
63 Ga0157375_10207106 3300013308 Bacteria 2118
64 Ga0182008_10027585 3300014497 Bacteria 2875
65 Ga0182008_10038544 3300014497 Bacteria 2390
66 Ga0182008_10093506 3300014497 Bacteria 1483
67 Ga0182008_10094922 3300014497 Bacteria 1471
68 Ga0182006_1001263 3300015261 Bacteria 15628
69 Ga0182006_1005730 3300015261 Bacteria 5862
70 Ga0182006_1007576 3300015261 Bacteria 4961
71 Ga0182006_1011993 3300015261 Bacteria 3796
72 Ga0182006_1062211 3300015261 Bacteria 1405
73 Ga0182007_10394185 3300015262 Bacteria 527
74 Ga0182005_1010587 3300015265 Bacteria 2648
75 Ga0182005_1050625 3300015265 Bacteria 1129
76 Ga0182005_1082582 3300015265 Bacteria 888
77 Ga0182005_1084976 3300015265 Bacteria 876
78 Ga0182005_1282369 3300015265 Bacteria 521
79 Ga0163161_10312678 3300017792 Bacteria 1240
80 Ga0163161_10564864 3300017792 Bacteria 934
81 Ga0163161_10866091 3300017792 Bacteria 763
82 Ga0209760_100258 3300025207 Bacteria 21118
83 Ga0209563_100745 3300025230 Bacteria 10006
84 Ga0207427_100007 3300025231 Bacteria 746220
85 Ga0209437_100006 3300025233 Bacteria 1042724
86 Ga0209233_1000059 3300025261 Bacteria 414562
87 Ga0209675_1004773 3300025291 Bacteria 5894
88 Ga0209676_1000010 3300025292 Bacteria 954025
89 Ga0209676_1000350 3300025292 Bacteria 87204
90 Ga0209050_1000019 3300025298 Bacteria 608757
91 Ga0209051_1000383 3300025303 Bacteria 62847
92 Ga0209257_1000357 3300025304 Bacteria 93431
93 Ga0207696_1000138 3300025711 Bacteria 127572
94 Ga0207696_1000213 3300025711 Bacteria 87128
95 Ga0207696_1001517 3300025711 Bacteria 12461
96 Ga0207696_1004910 3300025711 Bacteria 5661
97 Ga0207696_1005878 3300025711 Bacteria 5029
98 Ga0207655_1000954 3300025728 Bacteria 29930
99 Ga0207655_1003342 3300025728 Bacteria 12014
100 Ga0207655_1003350 3300025728 Bacteria 11997
101 Ga0207655_1004455 3300025728 Bacteria 9930
102 Ga0207655_1044087 3300025728 Bacteria 1878
103 Ga0207655_1086263 3300025728 Bacteria 1117
104 Ga0207655_1170114 3300025728 Bacteria 673
105 Ga0207713_1000078 3300025735 Bacteria 175087
106 Ga0207713_1000080 3300025735 Bacteria 168403
107 Ga0207713_1001355 3300025735 Bacteria 19964
108 Ga0207713_1002469 3300025735 Bacteria 13448
109 Ga0207713_1004556 3300025735 Bacteria 8973
110 Ga0207713_1017757 3300025735 Bacteria 3549
111 Ga0207713_1058630 3300025735 Bacteria 1482
112 Ga0207713_1119592 3300025735 Bacteria 885
113 Ga0207681_10002703 3300025923 Bacteria 11237
114 Ga0207694_10318231 3300025924 Bacteria 1284
115 Ga0207690_10783313 3300025932 Bacteria 787
116 Ga0207706_10006616 3300025933 Bacteria 10731
117 Ga0207709_10000189 3300025935 Bacteria 82404
118 Ga0207709_10000872 3300025935 Bacteria 23023
119 Ga0207712_10050565 3300025961 Bacteria 2902
120 Ga0207678_11449954 3300026067 Bacteria 606
121 Ga0209973_1041515 3300027252 Unclassified 675
122 Ga0209371_1000232 3300027312 Bacteria 70412
123 Ga0209996_1000737 3300027395 Bacteria 3902
124 Ga0209995_1004792 3300027471 Bacteria 2173
125 Ga0209968_1089703 3300027526 Bacteria 557
126 Ga0209999_1050007 3300027543 Bacteria 789
127 Ga0209982_1007213 3300027552 Bacteria 1624
128 Ga0209983_1006766 3300027665 Bacteria 2352
129 Ga0209971_1002809 3300027682 Bacteria 4162
130 Ga0209974_10015914 3300027876 Bacteria 2497
131 Ga0207428_10698270 3300027907 Bacteria 726
132 Ga0268266_10023011 3300028379 Bacteria 5303
133 Ga0268256_1000169 3300030500 Bacteria 81272
134 Ga0307511_10082885 3300030521 Bacteria 2238
135 Ga0307511_10264082 3300030521 Bacteria 813
136 Ga0307408_100000020 3300031548 Bacteria 340408
137 Ga0237819_01066 3300038705 Bacteria 8134
138 Ga0436363_0395710 3300039450 Bacteria 2957
139 Ga0439438_011224 3300041405 Bacteria 2799
140 Ga0439447_000778 3300041407 Bacteria 11699
141 Ga0439447_025955 3300041407 Bacteria 1506
142 Ga0439466_0005240 3300041411 Bacteria 4965
143 Ga0439466_0009049 3300041411 Bacteria 3739
144 Ga0439466_0020295 3300041411 Bacteria 2368
145 Ga0439445_0077619 3300042004 Bacteria 925
146 Ga0439432_000220 3300042006 Bacteria 20561
147 Ga0439452_000610 3300042010 Bacteria 18093
148 Ga0439452_009024 3300042010 Bacteria 2965
149 Ga0439455_0241271 3300042012 Bacteria 528
150 Ga0439456_036070 3300042013 Bacteria 1066
151 Ga0439456_127875 3300042013 Bacteria 585
152 Ga0439463_004963 3300042016 Bacteria 3318
153 Ga0439463_019638 3300042016 Bacteria 1683
154 Ga0439463_085001 3300042016 Bacteria 814
155 Ga0450911_001528 3300042115 Bacteria 5252
156 Ga0450902_004872 3300042137 Bacteria 2010
157 Ga0450902_015570 3300042137 Bacteria 1234
158 Ga0450904_002812 3300042139 Bacteria 1983
159 Ga0450905_028469 3300042142 Bacteria 852
160 Ga0439464_0003742 3300042439 Bacteria 3861
161 Ga0439460_0348601 3300042461 Bacteria 522
162 Ga0450893_0001539 3300042532 Bacteria 3543
163 Ga0450901_041431 3300042533 Bacteria 520
164 Ga0495617_008360 3300046452 Bacteria 3570
165 Ga0495617_028463 3300046452 Bacteria 1877
166 Ga0495617_062862 3300046452 Bacteria 1226
167 Ga0495617_078257 3300046452 Bacteria 1084
168 Ga0495617_163761 3300046452 Bacteria 704
169 Ga0495627_000953 3300046453 Bacteria 19856
170 Ga0495627_001633 3300046453 Bacteria 12509
171 Ga0495627_001765 3300046453 Bacteria 11626
172 Ga0495627_038206 3300046453 Bacteria 1485
173 Ga0495627_057684 3300046453 Bacteria 1154
174 Ga0495627_157468 3300046453 Bacteria 632
175 Ga0495591_000205 3300046458 Bacteria 60191
176 Ga0495591_001566 3300046458 Bacteria 13931
177 Ga0495591_001624 3300046458 Bacteria 13596
178 Ga0495591_001930 3300046458 Bacteria 12142
179 Ga0495591_003045 3300046458 Bacteria 8905
180 Ga0495591_010727 3300046458 Bacteria 3525
181 Ga0495591_022260 3300046458 Bacteria 2052
182 Ga0495638_0002867 3300046460 Bacteria 13805
183 Ga0495638_0018152 3300046460 Bacteria 4675
184 Ga0495638_0039292 3300046460 Bacteria 3004
185 Ga0495638_0370118 3300046460 Bacteria 751
186 Ga0495653_0026756 3300046463 Bacteria 4622
187 Ga0495653_0033640 3300046463 Bacteria 4059
188 Ga0495650_0002459 3300046471 Bacteria 14936
189 Ga0495650_0002495 3300046471 Bacteria 14777
190 Ga0495650_0019040 3300046471 Bacteria 3392
191 Ga0495650_0019226 3300046471 Bacteria 3372
192 Ga0495650_0051365 3300046471 Bacteria 1699
193 Ga0495650_0097187 3300046471 Bacteria 1110
194 Ga0495605_0000909 3300046474 Bacteria 20347
195 Ga0495605_0002004 3300046474 Bacteria 12877
196 Ga0495605_0107017 3300046474 Bacteria 1279
197 Ga0495584_0035313 3300046491 Bacteria 2527
198 Ga0495584_0111830 3300046491 Bacteria 1382
199 Ga0495584_0175866 3300046491 Bacteria 1088
200 Ga0495584_0238552 3300046491 Bacteria 924
201 Ga0495584_0523008 3300046491 Bacteria 604
202 Ga0495585_0001101 3300046492 Bacteria 22238
203 Ga0495585_0001554 3300046492 Bacteria 17806
204 Ga0495585_0002369 3300046492 Bacteria 13524
205 Ga0495585_0003939 3300046492 Bacteria 9818
206 Ga0495585_0008256 3300046492 Bacteria 6321
207 Ga0495585_0154832 3300046492 Bacteria 1193
208 Ga0495596_0028451 3300046500 Bacteria 2244
209 Ga0495596_0031249 3300046500 Bacteria 2128
210 Ga0495596_0123131 3300046500 Bacteria 1006
211 Ga0495607_0000288 3300046501 Bacteria 53438
212 Ga0495607_0001843 3300046501 Bacteria 18048
213 Ga0495607_0003902 3300046501 Bacteria 11232
214 Ga0495607_0005045 3300046501 Bacteria 9577
215 Ga0495607_0027538 3300046501 Bacteria 3512
216 Ga0495607_0072145 3300046501 Bacteria 1923
217 Ga0495607_0093372 3300046501 Bacteria 1625
218 Ga0495607_0115698 3300046501 Bacteria 1415
219 Ga0495607_0179871 3300046501 Bacteria 1061
220 Ga0495583_0003204 3300046506 Bacteria 12808
221 Ga0495583_0011870 3300046506 Bacteria 4972
222 Ga0495606_0000151 3300046507 Bacteria 119548
223 Ga0495606_0003494 3300046507 Bacteria 16641
224 Ga0495606_0017942 3300046507 Bacteria 5325
225 Ga0495606_0044797 3300046507 Bacteria 2939
226 Ga0495606_0129613 3300046507 Bacteria 1500
227 Ga0495610_0002277 3300046512 Bacteria 16214
228 Ga0495610_0024792 3300046512 Bacteria 3231
229 Ga0495610_0025389 3300046512 Bacteria 3181
230 Ga0495610_0054372 3300046512 Bacteria 1934
231 Ga0495610_0056210 3300046512 Bacteria 1893
232 Ga0495610_0156452 3300046512 Bacteria 967
233 Ga0495616_0001700 3300046513 Bacteria 15013
234 Ga0495616_0001714 3300046513 Bacteria 14956
235 Ga0495616_0011921 3300046513 Bacteria 4952
236 Ga0495616_0399277 3300046513 Bacteria 565
237 Ga0495620_0000454 3300046515 Bacteria 27182
238 Ga0495620_0000851 3300046515 Bacteria 18847
239 Ga0495620_0001961 3300046515 Bacteria 12055
240 Ga0495620_0009088 3300046515 Bacteria 5302
241 Ga0495620_0029795 3300046515 Bacteria 2521
242 Ga0495620_0415860 3300046515 Bacteria 509
243 Ga0495628_0064323 3300046516 Bacteria 2872
244 Ga0495630_0002286 3300046517 Bacteria 13336
245 Ga0495630_0006836 3300046517 Bacteria 8131
246 Ga0495631_0000488 3300046518 Bacteria 26555
247 Ga0495631_0001163 3300046518 Bacteria 16265
248 Ga0495631_0002717 3300046518 Bacteria 9815
249 Ga0495631_0045294 3300046518 Bacteria 1937
250 Ga0495631_0119549 3300046518 Bacteria 1133
251 Ga0495631_0191065 3300046518 Bacteria 876
252 Ga0495632_0001292 3300046519 Bacteria 21166
253 Ga0495632_0005155 3300046519 Bacteria 8717
254 Ga0495632_0010935 3300046519 Bacteria 5326
255 Ga0495632_0016059 3300046519 Bacteria 4175
256 Ga0495632_0016134 3300046519 Bacteria 4164
257 Ga0495632_0040405 3300046519 Bacteria 2349
258 Ga0495632_0085935 3300046519 Bacteria 1496
259 Ga0495632_0105329 3300046519 Bacteria 1327
260 Ga0495632_0117470 3300046519 Bacteria 1245
261 Ga0495632_0128774 3300046519 Bacteria 1179
262 Ga0495632_0235788 3300046519 Bacteria 824
263 Ga0495637_0001989 3300046520 Bacteria 11563
264 Ga0495637_0005094 3300046520 Bacteria 6741
265 Ga0495637_0008309 3300046520 Bacteria 5104
266 Ga0495637_0016433 3300046520 Bacteria 3458
267 Ga0495637_0016709 3300046520 Bacteria 3428
268 Ga0495637_0093469 3300046520 Bacteria 1183
269 Ga0495637_0118538 3300046520 Bacteria 1020
270 Ga0495637_0202656 3300046520 Bacteria 728
271 Ga0495643_0005003 3300046522 Bacteria 9086
272 Ga0495643_0013306 3300046522 Bacteria 4928
273 Ga0495643_0038767 3300046522 Bacteria 2608
274 Ga0495643_0153990 3300046522 Bacteria 1136
275 Ga0495643_0158373 3300046522 Bacteria 1116
276 Ga0495643_0184883 3300046522 Bacteria 1010
277 Ga0495648_0003731 3300046524 Bacteria 13287
278 Ga0495648_0003891 3300046524 Bacteria 12947
279 Ga0495648_0006276 3300046524 Bacteria 9725
280 Ga0495648_0038739 3300046524 Bacteria 3043
281 Ga0495648_0092969 3300046524 Bacteria 1683
282 Ga0495648_0144797 3300046524 Bacteria 1246
283 Ga0495666_0001124 3300046526 Bacteria 12812
284 Ga0495666_0083132 3300046526 Bacteria 1513
285 Ga0495654_0000405 3300046530 Bacteria 36817
286 Ga0495654_0001918 3300046530 Bacteria 13798
287 Ga0495654_0002652 3300046530 Bacteria 11375
288 Ga0495654_0003715 3300046530 Bacteria 9262
289 Ga0495654_0005089 3300046530 Bacteria 7689
290 Ga0495654_0030526 3300046530 Bacteria 2741
291 Ga0495654_0061166 3300046530 Bacteria 1809
292 Ga0495654_0113263 3300046530 Bacteria 1235
293 Ga0495654_0159504 3300046530 Bacteria 991
294 Ga0495654_0237459 3300046530 Bacteria 764
295 Ga0495665_0149609 3300046531 Bacteria 1219
296 Ga0495587_0011114 3300046536 Bacteria 5710
297 Ga0495587_0094872 3300046536 Bacteria 1722
298 Ga0495609_0000006 3300046538 Bacteria 431833
299 Ga0495609_0001176 3300046538 Bacteria 18064
300 Ga0495609_0008391 3300046538 Bacteria 5061
301 Ga0495609_0010324 3300046538 Bacteria 4483
302 Ga0495609_0011794 3300046538 Bacteria 4155
303 Ga0495609_0079386 3300046538 Bacteria 1435
304 Ga0495609_0145650 3300046538 Bacteria 1009
305 Ga0495609_0316665 3300046538 Bacteria 633
306 Ga0495597_0003333 3300046542 Bacteria 9467
307 Ga0495597_0054361 3300046542 Bacteria 1759
308 Ga0495597_0110888 3300046542 Bacteria 1150
309 Ga0495645_0770889 3300046543 Bacteria 579
310 Ga0495633_0004331 3300046558 Bacteria 9060
311 Ga0495668_0005345 3300046616 Bacteria 8758
312 Ga0495668_0022695 3300046616 Bacteria 3586
313 Ga0495668_0059904 3300046616 Bacteria 2100
314 Ga0495634_0002180 3300046642 Bacteria 16448
315 Ga0495611_0080023 3300046648 Bacteria 1501
316 Ga0495625_0005248 3300046660 Bacteria 11916
317 Ga0495625_0006726 3300046660 Bacteria 10184
318 Ga0495625_0125222 3300046660 Bacteria 1745
319 Ga0495625_0136127 3300046660 Bacteria 1660
320 Ga0495625_0217840 3300046660 Bacteria 1252
321 Ga0495635_0000990 3300046663 Bacteria 18718
322 Ga0495661_0001172 3300046665 Bacteria 22850
323 Ga0495661_0012125 3300046665 Bacteria 5825
324 Ga0495661_0015712 3300046665 Bacteria 5045
325 Ga0495661_0025451 3300046665 Bacteria 3822
326 Ga0495661_0190312 3300046665 Bacteria 1081
327 Ga0495661_0218193 3300046665 Bacteria 989
328 Ga0495657_0030373 3300046675 Bacteria 3785
329 Ga0495599_0105225 3300046678 Bacteria 1758
330 Ga0495623_0001930 3300046679 Bacteria 13925
331 Ga0495623_0005963 3300046679 Bacteria 7939
332 Ga0495646_0021532 3300046680 Bacteria 4071
333 Ga0495613_0095020 3300046689 Bacteria 2156
334 Ga0495624_0775076 3300046690 Bacteria 567
335 Ga0495670_0210594 3300046691 Bacteria 1031
336 Ga0495671_0002745 3300046692 Bacteria 11024
337 Ga0495671_0018697 3300046692 Bacteria 3674
338 Ga0495671_0027476 3300046692 Bacteria 2939
339 Ga0495671_0089641 3300046692 Bacteria 1506
340 Ga0495671_0124778 3300046692 Bacteria 1255
341 Ga0495671_0313712 3300046692 Bacteria 753
342 Ga0495671_0548392 3300046692 Bacteria 550
343 Ga0495671_0613012 3300046692 Bacteria 517
344 Ga0495671_0637218 3300046692 Bacteria 506
345 Ga0495649_0003038 3300046694 Bacteria 11507
346 Ga0495649_0004810 3300046694 Bacteria 8744
347 Ga0495649_0008852 3300046694 Bacteria 6027
348 Ga0495649_0020971 3300046694 Bacteria 3662
349 Ga0495649_0022909 3300046694 Bacteria 3491
350 Ga0495649_0073760 3300046694 Bacteria 1828
351 Ga0495649_0176158 3300046694 Bacteria 1117
352 Ga0495589_0001025 3300046794 Bacteria 16878
353 Ga0495589_0300142 3300046794 Bacteria 744
354 Ga0495600_0102592 3300046809 Bacteria 1864
355 Ga0495600_0715641 3300046809 Bacteria 601
356 Ga0495660_0002035 3300046810 Bacteria 13141
357 Ga0495660_0002728 3300046810 Bacteria 11144
358 Ga0495660_0003972 3300046810 Bacteria 9028
359 Ga0495660_0004059 3300046810 Bacteria 8941
360 Ga0495660_0005931 3300046810 Bacteria 7276
361 Ga0495660_0016581 3300046810 Bacteria 4247
362 Ga0495660_0020852 3300046810 Bacteria 3756
363 Ga0495660_0056103 3300046810 Bacteria 2130
364 Ga0495660_0198847 3300046810 Bacteria 958
365 Ga0495604_0014914 3300047317 Bacteria 6199
366 Ga0495604_0178984 3300047317 Bacteria 1484
367 Ga0495674_0003856 3300047319 Bacteria 14564
368 Ga0495672_0002299 3300047320 Bacteria 17724
369 Ga0495672_0007113 3300047320 Bacteria 8479
370 Ga0495672_0050040 3300047320 Bacteria 2470
371 Ga0495672_0197415 3300047320 Bacteria 1008
372 Ga0495676_0003312 3300047321 Bacteria 14561
373 Ga0495680_0025280 3300047322 Bacteria 4917
374 Ga0495680_0121427 3300047322 Bacteria 1928
375 Ga0495683_0000806 3300047323 Bacteria 22310
376 Ga0495683_0146394 3300047323 Bacteria 1103
377 Ga0495683_0185090 3300047323 Bacteria 948
378 Ga0495675_0081868 3300047444 Bacteria 2032
379 Ga0495679_001860 3300047446 Bacteria 11364
380 Ga0495679_002188 3300047446 Bacteria 10231
381 Ga0495679_003492 3300047446 Bacteria 7525
382 Ga0495679_005331 3300047446 Bacteria 5716
383 Ga0495679_006441 3300047446 Bacteria 5052
384 Ga0495679_067388 3300047446 Bacteria 1037
385 Ga0495673_0001688 3300047469 Bacteria 16955
386 Ga0495673_0003362 3300047469 Bacteria 10583
387 Ga0495673_0004551 3300047469 Bacteria 8653
388 Ga0495673_0004808 3300047469 Bacteria 8360
389 Ga0495673_0007851 3300047469 Bacteria 6069
390 Ga0495673_0009883 3300047469 Bacteria 5237
391 Ga0495673_0103092 3300047469 Bacteria 1150
392 Ga0495673_0149182 3300047469 Bacteria 905
393 Ga0495673_0254076 3300047469 Bacteria 641
394 Ga0495681_0001617 3300047470 Bacteria 16762
395 Ga0495681_0001778 3300047470 Bacteria 15885
396 Ga0495681_0005183 3300047470 Bacteria 8766
397 Ga0495681_0012153 3300047470 Bacteria 5073
398 Ga0495681_0013285 3300047470 Bacteria 4786
399 Ga0495681_0018533 3300047470 Bacteria 3833
400 Ga0495681_0110650 3300047470 Bacteria 1190
401 Ga0495681_0213729 3300047470 Bacteria 776
402 Ga0495681_0393180 3300047470 Bacteria 520
403 Ga0495684_0032714 3300047471 Bacteria 3994
404 Ga0495686_0004004 3300047472 Bacteria 12328
405 Ga0495686_0005736 3300047472 Bacteria 9706
406 Ga0495593_0003875 3300047673 Bacteria 8939
407 Ga0495593_0088352 3300047673 Bacteria 1597
408 Ga0495602_0323493 3300048088 Bacteria 1121
409 Ga0495626_0002705 3300048091 Bacteria 11975
410 Ga0495626_0025110 3300048091 Bacteria 2916
411 Ga0495626_0038765 3300048091 Bacteria 2257
412 Ga0495626_0106584 3300048091 Bacteria 1217
413 Ga0495626_0129897 3300048091 Bacteria 1076
414 Ga0495626_0280265 3300048091 Bacteria 662
415 Ga0495626_0389683 3300048091 Bacteria 539
416 Ga0495626_0389688 3300048091 Bacteria 539
417 Ga0496100_0647955 3300048903 Bacteria 822
418 Ga0496102_0000897 3300048905 Bacteria 28235
419 Ga0496102_0030996 3300048905 Bacteria 4791
420 Ga0496103_0001672 3300048906 Bacteria 14511
421 Ga0496106_0145919 3300048909 Bacteria 1864
422 Ga0496106_0546602 3300048909 Bacteria 929
423 Ga0496110_0793118 3300048913 Bacteria 851
424 Ga0496112_0247958 3300048915 Bacteria 1732
425 Ga0496115_0052124 3300048918 Bacteria 3282
426 Ga0496116_0003051 3300048919 Bacteria 16928
427 Ga0496116_0004738 3300048919 Bacteria 12845
428 Ga0496116_0006230 3300048919 Bacteria 10884
429 Ga0496116_0008850 3300048919 Bacteria 8666
430 Ga0496116_0031227 3300048919 Bacteria 3818
431 Ga0496116_0319835 3300048919 Bacteria 727
432 Ga0496117_0000951 3300048920 Bacteria 44280
433 Ga0496117_0004144 3300048920 Bacteria 16212
434 Ga0496117_0005741 3300048920 Bacteria 12893
435 Ga0496117_0041041 3300048920 Bacteria 3395
436 Ga0496117_0068092 3300048920 Bacteria 2405
437 Ga0496117_0098018 3300048920 Bacteria 1865
438 Ga0496117_0548787 3300048920 Bacteria 550
439 Ga0496118_0009822 3300048921 Bacteria 9579
440 Ga0496118_0010381 3300048921 Bacteria 9231
441 Ga0496118_0011218 3300048921 Bacteria 8773
442 Ga0496118_0024388 3300048921 Bacteria 5220
443 Ga0496118_0329770 3300048921 Bacteria 823
444 Ga0496118_0392202 3300048921 Bacteria 724
445 Ga0496118_0402525 3300048921 Bacteria 710
446 Ga0496118_0553311 3300048921 Bacteria 560
447 Ga0496118_0570411 3300048921 Bacteria 547
448 Ga0496119_0100806 3300048922 Bacteria 1621
449 Ga0496120_0106027 3300048923 Bacteria 1476
450 Ga0496121_0000518 3300048924 Bacteria 73428
451 Ga0496121_0001706 3300048924 Bacteria 36029
452 Ga0496121_0002316 3300048924 Bacteria 29512
453 Ga0496121_0008345 3300048924 Bacteria 12230
454 Ga0496121_0103203 3300048924 Bacteria 2194
455 Ga0496121_0404638 3300048924 Bacteria 893
456 Ga0496121_0557515 3300048924 Bacteria 715
457 Ga0496122_0004139 3300048925 Bacteria 18319
458 Ga0496122_0011827 3300048925 Bacteria 8775
459 Ga0496122_0092796 3300048925 Bacteria 2050
460 Ga0496122_0143126 3300048925 Bacteria 1491
461 Ga0496123_0003178 3300048926 Bacteria 18749
462 Ga0496123_0007295 3300048926 Bacteria 10487
463 Ga0496123_0019576 3300048926 Bacteria 5331
464 Ga0496123_0063397 3300048926 Bacteria 2361
465 Ga0496124_0002322 3300048927 Bacteria 25089
466 Ga0496124_0017209 3300048927 Bacteria 6823
467 Ga0496124_0032254 3300048927 Bacteria 4627
468 Ga0496124_0232404 3300048927 Bacteria 1377
469 Ga0496124_0416324 3300048927 Bacteria 928
470 Ga0496125_0009805 3300048928 Bacteria 9761
471 Ga0496125_0030832 3300048928 Bacteria 4788
472 Ga0496125_0044646 3300048928 Bacteria 3743
473 Ga0496125_0596905 3300048928 Bacteria 603
474 Ga0496126_0265634 3300048929 Bacteria 1426
475 Ga0496126_0429391 3300048929 Bacteria 1067
476 Ga0496126_1388555 3300048929 Bacteria 507
477 Ga0495678_001621 3300049459 Bacteria 17159
478 Ga0495678_002275 3300049459 Bacteria 13325
479 Ga0495678_008845 3300049459 Bacteria 5035
480 Ga0495678_018141 3300049459 Bacteria 3171
481 Ga0495678_090654 3300049459 Bacteria 1077
482 Ga0495682_0001846 3300049460 Bacteria 10628
483 Ga0495682_0010148 3300049460 Bacteria 3657
484 Ga0495682_0064900 3300049460 Bacteria 1316
485 nmdc:mga00v17_976641_c1 3300050491 Bacteria 534
486 nmdc:mga08x19_162920_c1 3300050514 Bacteria 1515
487 Ga0500572_000925 3300053111 Bacteria 9055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002771 JGI25163J39215_1000219 JGI25163J39215_100021922 71
2 3300002772 JGI25164J39214_1000160 JGI25164J39214_100016049 71
3 3300003214 JGI25165J46597_1000290 JGI25165J46597_100029049 71
4 3300003323 rootH1_10184217 rootH1_101842173 71
5 3300003502 JGI26143J51219_1001913 JGI26143J51219_10019132 71
6 3300003759 Ga0055525_1004420 Ga0055525_10044202 71
7 3300003781 Ga0055536_1000831 Ga0055536_100083117 71
8 3300003791 Ga0055530_10001294 Ga0055530_100012945 71
9 3300003792 Ga0055540_1000277 Ga0055540_100027717 71
10 3300003794 Ga0055531_10000123 Ga0055531_1000012333 71
11 3300005288 Ga0065714_10292984 Ga0065714_102929842 71
12 3300005288 Ga0065714_10324050 Ga0065714_103240501 71
13 3300005289 Ga0065704_10272377 Ga0065704_102723771 71
14 3300005289 Ga0065704_10332961 Ga0065704_103329612 71
15 3300005353 Ga0070669_100016874 Ga0070669_1000168745 71
16 3300005455 Ga0070663_100643430 Ga0070663_1006434301 71
17 3300005457 Ga0070662_100006388 Ga0070662_1000063888 71
18 3300005535 Ga0070684_102310428 Ga0070684_1023104281 71
19 3300005548 Ga0070665_100135885 Ga0070665_1001358852 71
20 3300005563 Ga0068855_102447657 Ga0068855_1024476572 71
21 3300006058 Ga0075432_10333871 Ga0075432_103338711 71
22 3300006177 Ga0075362_10069147 Ga0075362_100691472 71
23 3300006177 Ga0075362_10198328 Ga0075362_101983281 71
24 3300006914 Ga0075436_100285929 Ga0075436_1002859292 71
25 3300009011 Ga0105251_10005928 Ga0105251_100059283 71
26 3300009011 Ga0105251_10014133 Ga0105251_100141332 71
27 3300009036 Ga0105244_10002038 Ga0105244_100020382 71
28 3300009036 Ga0105244_10003864 Ga0105244_100038642 71
29 3300009036 Ga0105244_10008293 Ga0105244_100082937 71
30 3300009036 Ga0105244_10008504 Ga0105244_100085047 71
31 3300009036 Ga0105244_10185560 Ga0105244_101855602 71
32 3300009036 Ga0105244_10244717 Ga0105244_102447172 71
33 3300009036 Ga0105244_10357175 Ga0105244_103571751 71
34 3300009036 Ga0105244_10367224 Ga0105244_103672241 71
35 3300009092 Ga0105250_10000637 Ga0105250_100006375 71
36 3300009092 Ga0105250_10002425 Ga0105250_100024257 71
37 3300009092 Ga0105250_10004161 Ga0105250_100041617 71
38 3300009092 Ga0105250_10007509 Ga0105250_100075092 71
39 3300009092 Ga0105250_10016955 Ga0105250_100169554 71
40 3300009101 Ga0105247_10789102 Ga0105247_107891022 71
41 3300009148 Ga0105243_10000335 Ga0105243_1000033532 71
42 3300009551 Ga0105238_12619295 Ga0105238_126192952 71
43 3300009553 Ga0105249_10048077 Ga0105249_100480771 71
44 3300011119 Ga0105246_10000484 Ga0105246_1000048421 71
45 3300012498 Ga0157345_1000093 Ga0157345_10000937 71
46 3300013100 Ga0157373_10024960 Ga0157373_100249604 71
47 3300013100 Ga0157373_10031898 Ga0157373_100318982 71
48 3300013100 Ga0157373_10127924 Ga0157373_101279243 71
49 3300013102 Ga0157371_10001483 Ga0157371_1000148312 71
50 3300013102 Ga0157371_10013719 Ga0157371_100137195 71
51 3300013102 Ga0157371_10080369 Ga0157371_100803693 71
52 3300013102 Ga0157371_10891076 Ga0157371_108910761 71
53 3300013104 Ga0157370_10082381 Ga0157370_100823813 71
54 3300013104 Ga0157370_10275500 Ga0157370_102755002 71
55 3300013104 Ga0157370_10371403 Ga0157370_103714032 71
56 3300013104 Ga0157370_10812084 Ga0157370_108120842 71
57 3300013104 Ga0157370_11257937 Ga0157370_112579372 71
58 3300013105 Ga0157369_10080665 Ga0157369_100806654 71
59 3300013105 Ga0157369_11622259 Ga0157369_116222591 71
60 3300013306 Ga0163162_10420602 Ga0163162_104206022 71
61 3300013307 Ga0157372_10005543 Ga0157372_100055432 71
62 3300013308 Ga0157375_10002693 Ga0157375_100026932 71
63 3300013308 Ga0157375_10207106 Ga0157375_102071062 71
64 3300014497 Ga0182008_10027585 Ga0182008_100275853 71
65 3300014497 Ga0182008_10038544 Ga0182008_100385442 71
66 3300014497 Ga0182008_10093506 Ga0182008_100935062 71
67 3300014497 Ga0182008_10094922 Ga0182008_100949222 71
68 3300015261 Ga0182006_1001263 Ga0182006_100126317 71
69 3300015261 Ga0182006_1005730 Ga0182006_10057305 71
70 3300015261 Ga0182006_1007576 Ga0182006_10075762 71
71 3300015261 Ga0182006_1011993 Ga0182006_10119933 71
72 3300015261 Ga0182006_1062211 Ga0182006_10622112 71
73 3300015262 Ga0182007_10394185 Ga0182007_103941852 71
74 3300015265 Ga0182005_1010587 Ga0182005_10105872 71
75 3300015265 Ga0182005_1050625 Ga0182005_10506252 71
76 3300015265 Ga0182005_1082582 Ga0182005_10825822 71
77 3300015265 Ga0182005_1084976 Ga0182005_10849761 71
78 3300015265 Ga0182005_1282369 Ga0182005_12823692 71
79 3300017792 Ga0163161_10312678 Ga0163161_103126782 71
80 3300017792 Ga0163161_10564864 Ga0163161_105648642 71
81 3300017792 Ga0163161_10866091 Ga0163161_108660912 71
82 3300025207 Ga0209760_100258 Ga0209760_1002584 71
83 3300025230 Ga0209563_100745 Ga0209563_1007454 71
84 3300025231 Ga0207427_100007 Ga0207427_100007632 71
85 3300025233 Ga0209437_100006 Ga0209437_100006898 71
86 3300025261 Ga0209233_1000059 Ga0209233_100005997 71
87 3300025291 Ga0209675_1004773 Ga0209675_10047734 71
88 3300025292 Ga0209676_1000010 Ga0209676_1000010846 71
89 3300025292 Ga0209676_1000350 Ga0209676_100035057 71
90 3300025298 Ga0209050_1000019 Ga0209050_100001917 71
91 3300025303 Ga0209051_1000383 Ga0209051_100038350 71
92 3300025304 Ga0209257_1000357 Ga0209257_100035738 71
93 3300025711 Ga0207696_1000138 Ga0207696_100013889 71
94 3300025711 Ga0207696_1000213 Ga0207696_100021317 71
95 3300025711 Ga0207696_1001517 Ga0207696_10015172 71
96 3300025711 Ga0207696_1004910 Ga0207696_10049107 71
97 3300025711 Ga0207696_1005878 Ga0207696_10058785 71
98 3300025728 Ga0207655_1000954 Ga0207655_100095420 71
99 3300025728 Ga0207655_1003342 Ga0207655_100334214 71
100 3300025728 Ga0207655_1003350 Ga0207655_10033506 71
101 3300025728 Ga0207655_1004455 Ga0207655_10044553 71
102 3300025728 Ga0207655_1044087 Ga0207655_10440873 71
103 3300025728 Ga0207655_1086263 Ga0207655_10862632 71
104 3300025728 Ga0207655_1170114 Ga0207655_11701141 71
105 3300025735 Ga0207713_1000078 Ga0207713_100007866 71
106 3300025735 Ga0207713_1000080 Ga0207713_1000080124 71
107 3300025735 Ga0207713_1001355 Ga0207713_100135510 71
108 3300025735 Ga0207713_1002469 Ga0207713_10024697 71
109 3300025735 Ga0207713_1004556 Ga0207713_10045569 71
110 3300025735 Ga0207713_1017757 Ga0207713_10177574 71
111 3300025735 Ga0207713_1058630 Ga0207713_10586302 71
112 3300025735 Ga0207713_1119592 Ga0207713_11195922 71
113 3300025923 Ga0207681_10002703 Ga0207681_100027035 71
114 3300025924 Ga0207694_10318231 Ga0207694_103182311 71
115 3300025932 Ga0207690_10783313 Ga0207690_107833132 71
116 3300025933 Ga0207706_10006616 Ga0207706_100066166 71
117 3300025935 Ga0207709_10000189 Ga0207709_1000018948 71
118 3300025935 Ga0207709_10000872 Ga0207709_1000087217 71
119 3300025961 Ga0207712_10050565 Ga0207712_100505651 71
120 3300026067 Ga0207678_11449954 Ga0207678_114499541 71
121 3300027252 Ga0209973_1041515 Ga0209973_10415151 71
122 3300027312 Ga0209371_1000232 Ga0209371_100023228 71
123 3300027395 Ga0209996_1000737 Ga0209996_10007375 71
124 3300027471 Ga0209995_1004792 Ga0209995_10047922 71
125 3300027526 Ga0209968_1089703 Ga0209968_10897032 71
126 3300027543 Ga0209999_1050007 Ga0209999_10500072 71
127 3300027552 Ga0209982_1007213 Ga0209982_10072133 71
128 3300027665 Ga0209983_1006766 Ga0209983_10067663 71
129 3300027682 Ga0209971_1002809 Ga0209971_10028094 71
130 3300027876 Ga0209974_10015914 Ga0209974_100159143 71
131 3300027907 Ga0207428_10698270 Ga0207428_106982702 71
132 3300028379 Ga0268266_10023011 Ga0268266_100230115 71
133 3300030500 Ga0268256_1000169 Ga0268256_100016947 71
134 3300030521 Ga0307511_10082885 Ga0307511_100828852 71
135 3300030521 Ga0307511_10264082 Ga0307511_102640822 71
136 3300031548 Ga0307408_100000020 Ga0307408_10000002014 71
137 3300038705 Ga0237819_01066 Ga0237819_01066_7466_7681 71
138 3300039450 Ga0436363_0395710 Ga0436363_0395710_2272_2514 71
139 3300041405 Ga0439438_011224 Ga0439438_011224_1435_1650 71
140 3300041407 Ga0439447_000778 Ga0439447_000778_7694_7909 71
141 3300041407 Ga0439447_025955 Ga0439447_025955_173_388 71
142 3300041411 Ga0439466_0005240 Ga0439466_0005240_1871_2086 71
143 3300041411 Ga0439466_0009049 Ga0439466_0009049_851_1066 71
144 3300041411 Ga0439466_0020295 Ga0439466_0020295_402_617 71
145 3300042004 Ga0439445_0077619 Ga0439445_0077619_302_517 71
146 3300042006 Ga0439432_000220 Ga0439432_000220_7542_7757 71
147 3300042010 Ga0439452_000610 Ga0439452_000610_10165_10380 71
148 3300042010 Ga0439452_009024 Ga0439452_009024_2637_2864 71
149 3300042012 Ga0439455_0241271 Ga0439455_0241271_275_502 71
150 3300042013 Ga0439456_036070 Ga0439456_036070_674_889 71
151 3300042013 Ga0439456_127875 Ga0439456_127875_213_428 71
152 3300042016 Ga0439463_004963 Ga0439463_004963_2330_2545 71
153 3300042016 Ga0439463_019638 Ga0439463_019638_1219_1434 71
154 3300042016 Ga0439463_085001 Ga0439463_085001_304_519 71
155 3300042115 Ga0450911_001528 Ga0450911_001528_3343_3558 71
156 3300042137 Ga0450902_004872 Ga0450902_004872_925_1140 71
157 3300042137 Ga0450902_015570 Ga0450902_015570_951_1166 71
158 3300042139 Ga0450904_002812 Ga0450904_002812_965_1180 71
159 3300042142 Ga0450905_028469 Ga0450905_028469_493_756 71
160 3300042439 Ga0439464_0003742 Ga0439464_0003742_2776_3003 71
161 3300042461 Ga0439460_0348601 Ga0439460_0348601_151_366 71
162 3300042532 Ga0450893_0001539 Ga0450893_0001539_263_478 71
163 3300042533 Ga0450901_041431 Ga0450901_041431_168_383 71
164 3300046452 Ga0495617_008360 Ga0495617_008360_3241_3456 71
165 3300046452 Ga0495617_028463 Ga0495617_028463_612_827 71
166 3300046452 Ga0495617_062862 Ga0495617_062862_415_630 71
167 3300046452 Ga0495617_078257 Ga0495617_078257_477_692 71
168 3300046452 Ga0495617_163761 Ga0495617_163761_72_287 71
169 3300046453 Ga0495627_000953 Ga0495627_000953_12341_12559 71
170 3300046453 Ga0495627_001633 Ga0495627_001633_11255_11470 71
171 3300046453 Ga0495627_001765 Ga0495627_001765_10540_10755 71
172 3300046453 Ga0495627_038206 Ga0495627_038206_224_439 71
173 3300046453 Ga0495627_057684 Ga0495627_057684_913_1128 71
174 3300046453 Ga0495627_157468 Ga0495627_157468_383_598 71
175 3300046458 Ga0495591_000205 Ga0495591_000205_46095_46310 71
176 3300046458 Ga0495591_001566 Ga0495591_001566_1065_1280 71
177 3300046458 Ga0495591_001624 Ga0495591_001624_1041_1256 71
178 3300046458 Ga0495591_001930 Ga0495591_001930_1041_1256 71
179 3300046458 Ga0495591_003045 Ga0495591_003045_7825_8043 71
180 3300046458 Ga0495591_010727 Ga0495591_010727_2797_3012 71
181 3300046458 Ga0495591_022260 Ga0495591_022260_457_672 71
182 3300046460 Ga0495638_0002867 Ga0495638_0002867_9250_9465 71
183 3300046460 Ga0495638_0018152 Ga0495638_0018152_4283_4498 71
184 3300046460 Ga0495638_0039292 Ga0495638_0039292_1828_2043 71
185 3300046460 Ga0495638_0370118 Ga0495638_0370118_148_363 71
186 3300046463 Ga0495653_0026756 Ga0495653_0026756_3292_3507 71
187 3300046463 Ga0495653_0033640 Ga0495653_0033640_3623_3838 71
188 3300046471 Ga0495650_0002459 Ga0495650_0002459_8889_9104 71
189 3300046471 Ga0495650_0002495 Ga0495650_0002495_3652_3867 71
190 3300046471 Ga0495650_0019040 Ga0495650_0019040_846_1061 71
191 3300046471 Ga0495650_0019226 Ga0495650_0019226_726_941 71
192 3300046471 Ga0495650_0051365 Ga0495650_0051365_157_390 71
193 3300046471 Ga0495650_0097187 Ga0495650_0097187_238_453 71
194 3300046474 Ga0495605_0000909 Ga0495605_0000909_14799_15014 71
195 3300046474 Ga0495605_0002004 Ga0495605_0002004_826_1041 71
196 3300046474 Ga0495605_0107017 Ga0495605_0107017_989_1204 71
197 3300046491 Ga0495584_0035313 Ga0495584_0035313_841_1056 71
198 3300046491 Ga0495584_0111830 Ga0495584_0111830_167_382 71
199 3300046491 Ga0495584_0175866 Ga0495584_0175866_627_842 71
200 3300046491 Ga0495584_0238552 Ga0495584_0238552_689_904 71
201 3300046491 Ga0495584_0523008 Ga0495584_0523008_186_401 71
202 3300046492 Ga0495585_0001101 Ga0495585_0001101_8159_8374 71
203 3300046492 Ga0495585_0001554 Ga0495585_0001554_13977_14192 71
204 3300046492 Ga0495585_0002369 Ga0495585_0002369_11194_11412 71
205 3300046492 Ga0495585_0003939 Ga0495585_0003939_3543_3758 71
206 3300046492 Ga0495585_0008256 Ga0495585_0008256_2715_2930 71
207 3300046492 Ga0495585_0154832 Ga0495585_0154832_74_289 71
208 3300046500 Ga0495596_0028451 Ga0495596_0028451_1672_1887 71
209 3300046500 Ga0495596_0031249 Ga0495596_0031249_1782_1997 71
210 3300046500 Ga0495596_0123131 Ga0495596_0123131_18_236 71
211 3300046501 Ga0495607_0000288 Ga0495607_0000288_40030_40245 71
212 3300046501 Ga0495607_0001843 Ga0495607_0001843_5347_5562 71
213 3300046501 Ga0495607_0003902 Ga0495607_0003902_3295_3510 71
214 3300046501 Ga0495607_0005045 Ga0495607_0005045_472_687 71
215 3300046501 Ga0495607_0027538 Ga0495607_0027538_3204_3419 71
216 3300046501 Ga0495607_0072145 Ga0495607_0072145_1316_1531 71
217 3300046501 Ga0495607_0093372 Ga0495607_0093372_265_480 71
218 3300046501 Ga0495607_0115698 Ga0495607_0115698_1162_1377 71
219 3300046501 Ga0495607_0179871 Ga0495607_0179871_110_325 71
220 3300046506 Ga0495583_0003204 Ga0495583_0003204_5511_5726 71
221 3300046506 Ga0495583_0011870 Ga0495583_0011870_423_638 71
222 3300046507 Ga0495606_0000151 Ga0495606_0000151_104317_104532 71
223 3300046507 Ga0495606_0003494 Ga0495606_0003494_4329_4547 71
224 3300046507 Ga0495606_0017942 Ga0495606_0017942_1059_1274 71
225 3300046507 Ga0495606_0044797 Ga0495606_0044797_1948_2163 71
226 3300046507 Ga0495606_0129613 Ga0495606_0129613_1042_1257 71
227 3300046512 Ga0495610_0002277 Ga0495610_0002277_12525_12743 71
228 3300046512 Ga0495610_0024792 Ga0495610_0024792_464_679 71
229 3300046512 Ga0495610_0025389 Ga0495610_0025389_1964_2179 71
230 3300046512 Ga0495610_0054372 Ga0495610_0054372_1327_1542 71
231 3300046512 Ga0495610_0056210 Ga0495610_0056210_1111_1326 71
232 3300046512 Ga0495610_0156452 Ga0495610_0156452_327_542 71
233 3300046513 Ga0495616_0001700 Ga0495616_0001700_3736_3951 71
234 3300046513 Ga0495616_0001714 Ga0495616_0001714_3670_3885 71
235 3300046513 Ga0495616_0011921 Ga0495616_0011921_728_943 71
236 3300046513 Ga0495616_0399277 Ga0495616_0399277_33_248 71
237 3300046515 Ga0495620_0000454 Ga0495620_0000454_18291_18506 71
238 3300046515 Ga0495620_0000851 Ga0495620_0000851_14141_14356 71
239 3300046515 Ga0495620_0001961 Ga0495620_0001961_10852_11067 71
240 3300046515 Ga0495620_0009088 Ga0495620_0009088_942_1157 71
241 3300046515 Ga0495620_0029795 Ga0495620_0029795_1048_1263 71
242 3300046515 Ga0495620_0415860 Ga0495620_0415860_56_274 71
243 3300046516 Ga0495628_0064323 Ga0495628_0064323_2422_2637 71
244 3300046517 Ga0495630_0002286 Ga0495630_0002286_12295_12510 71
245 3300046517 Ga0495630_0006836 Ga0495630_0006836_1697_1912 71
246 3300046518 Ga0495631_0000488 Ga0495631_0000488_14251_14466 71
247 3300046518 Ga0495631_0001163 Ga0495631_0001163_3707_3922 71
248 3300046518 Ga0495631_0002717 Ga0495631_0002717_9539_9772 71
249 3300046518 Ga0495631_0045294 Ga0495631_0045294_613_828 71
250 3300046518 Ga0495631_0119549 Ga0495631_0119549_21_236 71
251 3300046518 Ga0495631_0191065 Ga0495631_0191065_490_705 71
252 3300046519 Ga0495632_0001292 Ga0495632_0001292_2267_2482 71
253 3300046519 Ga0495632_0005155 Ga0495632_0005155_864_1079 71
254 3300046519 Ga0495632_0010935 Ga0495632_0010935_1832_2047 71
255 3300046519 Ga0495632_0016059 Ga0495632_0016059_2937_3170 71
256 3300046519 Ga0495632_0016134 Ga0495632_0016134_1819_2052 71
257 3300046519 Ga0495632_0040405 Ga0495632_0040405_1062_1277 71
258 3300046519 Ga0495632_0085935 Ga0495632_0085935_203_418 71
259 3300046519 Ga0495632_0105329 Ga0495632_0105329_930_1145 71
260 3300046519 Ga0495632_0117470 Ga0495632_0117470_178_393 71
261 3300046519 Ga0495632_0128774 Ga0495632_0128774_687_902 71
262 3300046519 Ga0495632_0235788 Ga0495632_0235788_288_503 71
263 3300046520 Ga0495637_0001989 Ga0495637_0001989_7624_7839 71
264 3300046520 Ga0495637_0005094 Ga0495637_0005094_6495_6710 71
265 3300046520 Ga0495637_0008309 Ga0495637_0008309_3953_4168 71
266 3300046520 Ga0495637_0016433 Ga0495637_0016433_2908_3123 71
267 3300046520 Ga0495637_0016709 Ga0495637_0016709_849_1067 71
268 3300046520 Ga0495637_0093469 Ga0495637_0093469_880_1095 71
269 3300046520 Ga0495637_0118538 Ga0495637_0118538_34_249 71
270 3300046520 Ga0495637_0202656 Ga0495637_0202656_200_415 71
271 3300046522 Ga0495643_0005003 Ga0495643_0005003_7870_8088 71
272 3300046522 Ga0495643_0013306 Ga0495643_0013306_3662_3877 71
273 3300046522 Ga0495643_0038767 Ga0495643_0038767_1817_2032 71
274 3300046522 Ga0495643_0153990 Ga0495643_0153990_215_430 71
275 3300046522 Ga0495643_0158373 Ga0495643_0158373_749_964 71
276 3300046522 Ga0495643_0184883 Ga0495643_0184883_186_401 71
277 3300046524 Ga0495648_0003731 Ga0495648_0003731_1053_1268 71
278 3300046524 Ga0495648_0003891 Ga0495648_0003891_12001_12216 71
279 3300046524 Ga0495648_0006276 Ga0495648_0006276_1028_1243 71
280 3300046524 Ga0495648_0038739 Ga0495648_0038739_321_536 71
281 3300046524 Ga0495648_0092969 Ga0495648_0092969_419_634 71
282 3300046524 Ga0495648_0144797 Ga0495648_0144797_141_356 71
283 3300046526 Ga0495666_0001124 Ga0495666_0001124_517_732 71
284 3300046526 Ga0495666_0083132 Ga0495666_0083132_735_950 71
285 3300046530 Ga0495654_0000405 Ga0495654_0000405_27796_28029 71
286 3300046530 Ga0495654_0001918 Ga0495654_0001918_1041_1256 71
287 3300046530 Ga0495654_0002652 Ga0495654_0002652_10120_10335 71
288 3300046530 Ga0495654_0003715 Ga0495654_0003715_308_523 71
289 3300046530 Ga0495654_0005089 Ga0495654_0005089_979_1194 71
290 3300046530 Ga0495654_0030526 Ga0495654_0030526_169_387 71
291 3300046530 Ga0495654_0061166 Ga0495654_0061166_1014_1229 71
292 3300046530 Ga0495654_0113263 Ga0495654_0113263_245_460 71
293 3300046530 Ga0495654_0159504 Ga0495654_0159504_38_256 71
294 3300046530 Ga0495654_0237459 Ga0495654_0237459_407_622 71
295 3300046531 Ga0495665_0149609 Ga0495665_0149609_263_478 71
296 3300046536 Ga0495587_0011114 Ga0495587_0011114_204_419 71
297 3300046536 Ga0495587_0094872 Ga0495587_0094872_481_696 71
298 3300046538 Ga0495609_0000006 Ga0495609_0000006_44767_44982 71
299 3300046538 Ga0495609_0001176 Ga0495609_0001176_13130_13345 71
300 3300046538 Ga0495609_0008391 Ga0495609_0008391_904_1119 71
301 3300046538 Ga0495609_0010324 Ga0495609_0010324_1062_1277 71
302 3300046538 Ga0495609_0011794 Ga0495609_0011794_1397_1612 71
303 3300046538 Ga0495609_0079386 Ga0495609_0079386_193_408 71
304 3300046538 Ga0495609_0145650 Ga0495609_0145650_278_496 71
305 3300046538 Ga0495609_0316665 Ga0495609_0316665_387_602 71
306 3300046542 Ga0495597_0003333 Ga0495597_0003333_8194_8409 71
307 3300046542 Ga0495597_0054361 Ga0495597_0054361_799_1014 71
308 3300046542 Ga0495597_0110888 Ga0495597_0110888_899_1114 71
309 3300046543 Ga0495645_0770889 Ga0495645_0770889_304_519 71
310 3300046558 Ga0495633_0004331 Ga0495633_0004331_1069_1284 71
311 3300046616 Ga0495668_0005345 Ga0495668_0005345_1026_1244 71
312 3300046616 Ga0495668_0022695 Ga0495668_0022695_3319_3534 71
313 3300046616 Ga0495668_0059904 Ga0495668_0059904_101_316 71
314 3300046642 Ga0495634_0002180 Ga0495634_0002180_14285_14500 71
315 3300046648 Ga0495611_0080023 Ga0495611_0080023_734_949 71
316 3300046660 Ga0495625_0005248 Ga0495625_0005248_10660_10875 71
317 3300046660 Ga0495625_0006726 Ga0495625_0006726_8923_9138 71
318 3300046660 Ga0495625_0125222 Ga0495625_0125222_788_1003 71
319 3300046660 Ga0495625_0136127 Ga0495625_0136127_827_1042 71
320 3300046660 Ga0495625_0217840 Ga0495625_0217840_904_1119 71
321 3300046663 Ga0495635_0000990 Ga0495635_0000990_14001_14216 71
322 3300046665 Ga0495661_0001172 Ga0495661_0001172_3315_3530 71
323 3300046665 Ga0495661_0012125 Ga0495661_0012125_3357_3572 71
324 3300046665 Ga0495661_0015712 Ga0495661_0015712_1187_1402 71
325 3300046665 Ga0495661_0025451 Ga0495661_0025451_756_971 71
326 3300046665 Ga0495661_0190312 Ga0495661_0190312_64_279 71
327 3300046665 Ga0495661_0218193 Ga0495661_0218193_616_831 71
328 3300046675 Ga0495657_0030373 Ga0495657_0030373_486_701 71
329 3300046678 Ga0495599_0105225 Ga0495599_0105225_814_1029 71
330 3300046679 Ga0495623_0001930 Ga0495623_0001930_11716_11931 71
331 3300046679 Ga0495623_0005963 Ga0495623_0005963_368_583 71
332 3300046680 Ga0495646_0021532 Ga0495646_0021532_2024_2239 71
333 3300046689 Ga0495613_0095020 Ga0495613_0095020_1685_1900 71
334 3300046690 Ga0495624_0775076 Ga0495624_0775076_291_506 71
335 3300046691 Ga0495670_0210594 Ga0495670_0210594_642_857 71
336 3300046692 Ga0495671_0002745 Ga0495671_0002745_4200_4418 71
337 3300046692 Ga0495671_0018697 Ga0495671_0018697_280_495 71
338 3300046692 Ga0495671_0027476 Ga0495671_0027476_356_589 71
339 3300046692 Ga0495671_0089641 Ga0495671_0089641_554_769 71
340 3300046692 Ga0495671_0124778 Ga0495671_0124778_80_295 71
341 3300046692 Ga0495671_0313712 Ga0495671_0313712_116_331 71
342 3300046692 Ga0495671_0548392 Ga0495671_0548392_74_289 71
343 3300046692 Ga0495671_0613012 Ga0495671_0613012_138_353 71
344 3300046692 Ga0495671_0637218 Ga0495671_0637218_219_434 71
345 3300046694 Ga0495649_0003038 Ga0495649_0003038_10530_10745 71
346 3300046694 Ga0495649_0004810 Ga0495649_0004810_7647_7862 71
347 3300046694 Ga0495649_0008852 Ga0495649_0008852_2320_2535 71
348 3300046694 Ga0495649_0020971 Ga0495649_0020971_237_452 71
349 3300046694 Ga0495649_0022909 Ga0495649_0022909_2321_2536 71
350 3300046694 Ga0495649_0073760 Ga0495649_0073760_805_1020 71
351 3300046694 Ga0495649_0176158 Ga0495649_0176158_462_677 71
352 3300046794 Ga0495589_0001025 Ga0495589_0001025_3547_3762 71
353 3300046794 Ga0495589_0300142 Ga0495589_0300142_21_236 71
354 3300046809 Ga0495600_0102592 Ga0495600_0102592_688_903 71
355 3300046809 Ga0495600_0715641 Ga0495600_0715641_264_479 71
356 3300046810 Ga0495660_0002035 Ga0495660_0002035_851_1066 71
357 3300046810 Ga0495660_0002728 Ga0495660_0002728_9906_10121 71
358 3300046810 Ga0495660_0003972 Ga0495660_0003972_7774_7992 71
359 3300046810 Ga0495660_0004059 Ga0495660_0004059_866_1081 71
360 3300046810 Ga0495660_0005931 Ga0495660_0005931_5962_6177 71
361 3300046810 Ga0495660_0016581 Ga0495660_0016581_3131_3346 71
362 3300046810 Ga0495660_0020852 Ga0495660_0020852_668_883 71
363 3300046810 Ga0495660_0056103 Ga0495660_0056103_161_376 71
364 3300046810 Ga0495660_0198847 Ga0495660_0198847_178_393 71
365 3300047317 Ga0495604_0014914 Ga0495604_0014914_5086_5301 71
366 3300047317 Ga0495604_0178984 Ga0495604_0178984_689_904 71
367 3300047319 Ga0495674_0003856 Ga0495674_0003856_12389_12604 71
368 3300047320 Ga0495672_0002299 Ga0495672_0002299_8402_8635 71
369 3300047320 Ga0495672_0007113 Ga0495672_0007113_2958_3173 71
370 3300047320 Ga0495672_0050040 Ga0495672_0050040_1052_1267 71
371 3300047320 Ga0495672_0197415 Ga0495672_0197415_608_823 71
372 3300047321 Ga0495676_0003312 Ga0495676_0003312_1934_2149 71
373 3300047322 Ga0495680_0025280 Ga0495680_0025280_327_542 71
374 3300047322 Ga0495680_0121427 Ga0495680_0121427_212_427 71
375 3300047323 Ga0495683_0000806 Ga0495683_0000806_8023_8238 71
376 3300047323 Ga0495683_0146394 Ga0495683_0146394_53_271 71
377 3300047323 Ga0495683_0185090 Ga0495683_0185090_691_906 71
378 3300047444 Ga0495675_0081868 Ga0495675_0081868_968_1183 71
379 3300047446 Ga0495679_001860 Ga0495679_001860_3090_3305 71
380 3300047446 Ga0495679_002188 Ga0495679_002188_9122_9337 71
381 3300047446 Ga0495679_003492 Ga0495679_003492_6917_7132 71
382 3300047446 Ga0495679_005331 Ga0495679_005331_892_1110 71
383 3300047446 Ga0495679_006441 Ga0495679_006441_3205_3423 71
384 3300047446 Ga0495679_067388 Ga0495679_067388_706_924 71
385 3300047469 Ga0495673_0001688 Ga0495673_0001688_8134_8349 71
386 3300047469 Ga0495673_0003362 Ga0495673_0003362_995_1210 71
387 3300047469 Ga0495673_0004551 Ga0495673_0004551_824_1039 71
388 3300047469 Ga0495673_0004808 Ga0495673_0004808_1047_1262 71
389 3300047469 Ga0495673_0007851 Ga0495673_0007851_3014_3229 71
390 3300047469 Ga0495673_0009883 Ga0495673_0009883_3292_3507 71
391 3300047469 Ga0495673_0103092 Ga0495673_0103092_364_579 71
392 3300047469 Ga0495673_0149182 Ga0495673_0149182_634_849 71
393 3300047469 Ga0495673_0254076 Ga0495673_0254076_269_484 71
394 3300047470 Ga0495681_0001617 Ga0495681_0001617_14327_14542 71
395 3300047470 Ga0495681_0001778 Ga0495681_0001778_4642_4857 71
396 3300047470 Ga0495681_0005183 Ga0495681_0005183_7533_7748 71
397 3300047470 Ga0495681_0012153 Ga0495681_0012153_619_834 71
398 3300047470 Ga0495681_0013285 Ga0495681_0013285_3386_3604 71
399 3300047470 Ga0495681_0018533 Ga0495681_0018533_3122_3337 71
400 3300047470 Ga0495681_0110650 Ga0495681_0110650_69_284 71
401 3300047470 Ga0495681_0213729 Ga0495681_0213729_532_747 71
402 3300047470 Ga0495681_0393180 Ga0495681_0393180_129_344 71
403 3300047471 Ga0495684_0032714 Ga0495684_0032714_2339_2554 71
404 3300047472 Ga0495686_0004004 Ga0495686_0004004_7839_8054 71
405 3300047472 Ga0495686_0005736 Ga0495686_0005736_1946_2161 71
406 3300047673 Ga0495593_0003875 Ga0495593_0003875_870_1085 71
407 3300047673 Ga0495593_0088352 Ga0495593_0088352_62_277 71
408 3300048088 Ga0495602_0323493 Ga0495602_0323493_11_226 71
409 3300048091 Ga0495626_0002705 Ga0495626_0002705_10764_10979 71
410 3300048091 Ga0495626_0025110 Ga0495626_0025110_973_1188 71
411 3300048091 Ga0495626_0038765 Ga0495626_0038765_1166_1384 71
412 3300048091 Ga0495626_0106584 Ga0495626_0106584_216_431 71
413 3300048091 Ga0495626_0129897 Ga0495626_0129897_61_279 71
414 3300048091 Ga0495626_0280265 Ga0495626_0280265_308_523 71
415 3300048091 Ga0495626_0389683 Ga0495626_0389683_54_269 71
416 3300048091 Ga0495626_0389688 Ga0495626_0389688_54_269 71
417 3300048903 Ga0496100_0647955 Ga0496100_0647955_503_718 71
418 3300048905 Ga0496102_0000897 Ga0496102_0000897_13825_14040 71
419 3300048905 Ga0496102_0030996 Ga0496102_0030996_3325_3540 71
420 3300048906 Ga0496103_0001672 Ga0496103_0001672_12523_12738 71
421 3300048909 Ga0496106_0145919 Ga0496106_0145919_902_1117 71
422 3300048909 Ga0496106_0546602 Ga0496106_0546602_341_556 71
423 3300048913 Ga0496110_0793118 Ga0496110_0793118_545_760 71
424 3300048915 Ga0496112_0247958 Ga0496112_0247958_359_574 71
425 3300048918 Ga0496115_0052124 Ga0496115_0052124_2104_2319 71
426 3300048919 Ga0496116_0003051 Ga0496116_0003051_4327_4542 71
427 3300048919 Ga0496116_0004738 Ga0496116_0004738_11729_11944 71
428 3300048919 Ga0496116_0006230 Ga0496116_0006230_1058_1273 71
429 3300048919 Ga0496116_0008850 Ga0496116_0008850_7381_7596 71
430 3300048919 Ga0496116_0031227 Ga0496116_0031227_3030_3245 71
431 3300048919 Ga0496116_0319835 Ga0496116_0319835_140_355 71
432 3300048920 Ga0496117_0000951 Ga0496117_0000951_17490_17705 71
433 3300048920 Ga0496117_0004144 Ga0496117_0004144_1862_2077 71
434 3300048920 Ga0496117_0005741 Ga0496117_0005741_597_812 71
435 3300048920 Ga0496117_0041041 Ga0496117_0041041_724_939 71
436 3300048920 Ga0496117_0068092 Ga0496117_0068092_53_271 71
437 3300048920 Ga0496117_0098018 Ga0496117_0098018_213_428 71
438 3300048920 Ga0496117_0548787 Ga0496117_0548787_147_362 71
439 3300048921 Ga0496118_0009822 Ga0496118_0009822_219_434 71
440 3300048921 Ga0496118_0010381 Ga0496118_0010381_1982_2197 71
441 3300048921 Ga0496118_0011218 Ga0496118_0011218_7511_7726 71
442 3300048921 Ga0496118_0024388 Ga0496118_0024388_4426_4641 71
443 3300048921 Ga0496118_0329770 Ga0496118_0329770_37_252 71
444 3300048921 Ga0496118_0392202 Ga0496118_0392202_122_337 71
445 3300048921 Ga0496118_0402525 Ga0496118_0402525_153_368 71
446 3300048921 Ga0496118_0553311 Ga0496118_0553311_42_257 71
447 3300048921 Ga0496118_0570411 Ga0496118_0570411_149_364 71
448 3300048922 Ga0496119_0100806 Ga0496119_0100806_1045_1260 71
449 3300048923 Ga0496120_0106027 Ga0496120_0106027_219_434 71
450 3300048924 Ga0496121_0000518 Ga0496121_0000518_17676_17891 71
451 3300048924 Ga0496121_0001706 Ga0496121_0001706_17952_18167 71
452 3300048924 Ga0496121_0002316 Ga0496121_0002316_29070_29288 71
453 3300048924 Ga0496121_0008345 Ga0496121_0008345_11204_11419 71
454 3300048924 Ga0496121_0103203 Ga0496121_0103203_1058_1273 71
455 3300048924 Ga0496121_0404638 Ga0496121_0404638_123_338 71
456 3300048924 Ga0496121_0557515 Ga0496121_0557515_377_640 71
457 3300048925 Ga0496122_0004139 Ga0496122_0004139_13756_13971 71
458 3300048925 Ga0496122_0011827 Ga0496122_0011827_5309_5524 71
459 3300048925 Ga0496122_0092796 Ga0496122_0092796_803_1018 71
460 3300048925 Ga0496122_0143126 Ga0496122_0143126_234_449 71
461 3300048926 Ga0496123_0003178 Ga0496123_0003178_17993_18208 71
462 3300048926 Ga0496123_0007295 Ga0496123_0007295_994_1209 71
463 3300048926 Ga0496123_0019576 Ga0496123_0019576_3217_3432 71
464 3300048926 Ga0496123_0063397 Ga0496123_0063397_1371_1586 71
465 3300048927 Ga0496124_0002322 Ga0496124_0002322_10082_10297 71
466 3300048927 Ga0496124_0017209 Ga0496124_0017209_1480_1695 71
467 3300048927 Ga0496124_0032254 Ga0496124_0032254_378_593 71
468 3300048927 Ga0496124_0232404 Ga0496124_0232404_1012_1227 71
469 3300048927 Ga0496124_0416324 Ga0496124_0416324_448_663 71
470 3300048928 Ga0496125_0009805 Ga0496125_0009805_273_488 71
471 3300048928 Ga0496125_0030832 Ga0496125_0030832_580_795 71
472 3300048928 Ga0496125_0044646 Ga0496125_0044646_2974_3189 71
473 3300048928 Ga0496125_0596905 Ga0496125_0596905_359_574 71
474 3300048929 Ga0496126_0265634 Ga0496126_0265634_195_410 71
475 3300048929 Ga0496126_0429391 Ga0496126_0429391_265_480 71
476 3300048929 Ga0496126_1388555 Ga0496126_1388555_258_473 71
477 3300049459 Ga0495678_001621 Ga0495678_001621_4377_4592 71
478 3300049459 Ga0495678_002275 Ga0495678_002275_1048_1263 71
479 3300049459 Ga0495678_008845 Ga0495678_008845_4424_4639 71
480 3300049459 Ga0495678_018141 Ga0495678_018141_2289_2507 71
481 3300049459 Ga0495678_090654 Ga0495678_090654_785_1000 71
482 3300049460 Ga0495682_0001846 Ga0495682_0001846_1039_1254 71
483 3300049460 Ga0495682_0010148 Ga0495682_0010148_3189_3404 71
484 3300049460 Ga0495682_0064900 Ga0495682_0064900_1021_1236 71
485 3300050491 nmdc:mga00v17_976641_c1 nmdc:mga00v17_976641_c1_16_231 71
486 3300050514 nmdc:mga08x19_162920_c1 nmdc:mga08x19_162920_c1_212_427 71
487 3300053111 Ga0500572_000925 Ga0500572_000925_7851_8066 71
488 iso_pu_bacteria 2600254954 2600443358 71
489 iso_pu_bacteria 2600255389 2602009178 71
490 iso_pu_bacteria 2919501602 2919501703 71
491 iso_pu_bacteria 2926063275 2926063376 71
492 iso_pu_bacteria 3007252601 3007255935 71
493 iso_pu_bacteria 3007315729 3007319993 71
494 iso_pu_bacteria 8034962539 8034962950 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09493

DUF2389

Tryptophan-rich protein (DUF2389)

28

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c16-assembly1.cif.gz_A crystal structure of asymmetric ferredoxin/flavodoxin nadp+ oxidoreductase 2 (fnr2) h326v mutant from bacillus cereus 0.9134 26 56
5twb-assembly1.cif.gz_A oxidoreductase iruo in the reduced form 0.9006 26 56
7ytv-assembly1.cif.gz_A crystal structure of aspergillus fumigatus thioredoxin reductase in complex with auranofin 0.9 26 56
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.8976 26 56
6bwt-assembly1.cif.gz_A 2.45 angstrom resolution crystal structure thioredoxin reductase from francisella tularensis. 0.8935 26 56
ID Description Score Start End Superfamily
af_Q57681_481_577_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9108 40 56 3.40.50.800
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8976 26 56 3.50.50.60
af_Q06817_503_612_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8936 40 56 3.40.50.800
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8894 26 56 3.50.50.60
af_Q4DY51_38_295_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8829 28 56 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0F9UUE0-F1-model_v4 Uncharacterized protein 0.949 27 63
AF-A0A4Q7LTH5-F1-model_v4 TIGR02450 family Trp-rich protein 0.9367 3 67
AF-A0A1Y2CBG3-F1-model_v4 BHLH domain-containing protein 0.9339 26 56 GO:0046983
AF-A0A5S9INN4-F1-model_v4 TIGR02450 family Trp-rich protein 0.9315 4 67
AF-A0A358G2L6-F1-model_v4 deleted 0.931 26 56

Feature Viewer

pLDDT pTM Quality
83.58 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map