F454553

General Info

Members Datasets Scaffolds Average Seq Length
494 242 493 252

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100032389|Ga0075428_1000323895
Length 286
Sequence MIRSLQEEEPRNPCAAGKASAKHMLEIVNPVVVGGIAAACIFFGILLCLVLGRRLGQRSLARHGAVGVSNIGSLEAAVFGLLGLLIAFTFSGALSRFDVRRNQVVDEANAIGTAYLRIDLLPASTQPPLRETFRKYVDARIETYRALPDLEAAHRELVRSQDLQRQIWTQSVAAIHMPESRPGAELLVVPGLNQMFDITTVRMVATRIHPPLIVYGMLIALALASAFLAGYQSAGEKDYDWVHKIGFAGIVAFTVYVILDIEYPRLGWVRLDAIDQVLVDVRAGMN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2928963466 Dyella japonica 1073 Isolate Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.82
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10092069 2162886012 Bacteria 1221
2 Ga0065712_10170489 3300005290 Bacteria 1228
3 Ga0065715_10104305 3300005293 Unclassified 2972
4 Ga0070676_10006212 3300005328 Bacteria 6381
5 Ga0070683_100044552 3300005329 Bacteria 4091
6 Ga0070683_100387918 3300005329 Bacteria 1331
7 Ga0070683_100448123 3300005329 Bacteria 1232
8 Ga0070690_100000472 3300005330 Bacteria 20208
9 Ga0070690_100003159 3300005330 Bacteria 8973
10 Ga0070690_100003197 3300005330 Bacteria 8932
11 Ga0070690_100048488 3300005330 Bacteria 2705
12 Ga0070670_100025791 3300005331 Bacteria 5058
13 Ga0070677_10027063 3300005333 Bacteria 2156
14 Ga0068869_100000410 3300005334 Bacteria 23340
15 Ga0068869_100022840 3300005334 Bacteria 4314
16 Ga0070666_10060907 3300005335 Bacteria 2555
17 Ga0070666_10161889 3300005335 Unclassified 1564
18 Ga0070680_100003471 3300005336 Bacteria 11771
19 Ga0070680_100006482 3300005336 Bacteria 8902
20 Ga0070680_100043244 3300005336 Bacteria 3659
21 Ga0070682_100017355 3300005337 Bacteria 4194
22 Ga0068868_100000209 3300005338 Bacteria 39624
23 Ga0068868_100106856 3300005338 Bacteria 2271
24 Ga0070660_100014758 3300005339 Bacteria 5635
25 Ga0070660_100017975 3300005339 Bacteria 5159
26 Ga0070689_100000614 3300005340 Bacteria 21600
27 Ga0070689_100006112 3300005340 Bacteria 8298
28 Ga0070689_100015234 3300005340 Bacteria 5603
29 Ga0070691_10001516 3300005341 Bacteria 9987
30 Ga0070691_10051095 3300005341 Bacteria 1973
31 Ga0070687_100000190 3300005343 Bacteria 21399
32 Ga0070687_100001061 3300005343 Bacteria 9414
33 Ga0070661_100020597 3300005344 Bacteria 4705
34 Ga0070692_10001339 3300005345 Bacteria 8876
35 Ga0070692_10008470 3300005345 Bacteria 4591
36 Ga0070692_10015733 3300005345 Bacteria 3584
37 Ga0070668_100004402 3300005347 Bacteria 10455
38 Ga0070668_100010824 3300005347 Bacteria 6786
39 Ga0070668_100682198 3300005347 Unclassified 905
40 Ga0070669_100009844 3300005353 Bacteria 6808
41 Ga0070669_100016102 3300005353 Bacteria 5333
42 Ga0070669_100027587 3300005353 Bacteria 4087
43 Ga0070669_100154427 3300005353 Bacteria 1779
44 Ga0070675_100027335 3300005354 Bacteria 4583
45 Ga0070675_100206811 3300005354 Bacteria 1705
46 Ga0070675_100226096 3300005354 Bacteria 1631
47 Ga0070671_100023702 3300005355 Bacteria 5024
48 Ga0070671_100298770 3300005355 Bacteria 1371
49 Ga0070674_100002804 3300005356 Bacteria 9634
50 Ga0070673_100004817 3300005364 Bacteria 8580
51 Ga0070688_100004485 3300005365 Bacteria 7274
52 Ga0070688_100096989 3300005365 Bacteria 1937
53 Ga0070688_100145914 3300005365 Bacteria 1612
54 Ga0070659_100024242 3300005366 Bacteria 4650
55 Ga0070659_100034255 3300005366 Bacteria 3949
56 Ga0070667_100010137 3300005367 Bacteria 7795
57 Ga0070667_100372784 3300005367 Bacteria 1295
58 Ga0070703_10037428 3300005406 Bacteria 1495
59 Ga0070701_10002341 3300005438 Bacteria 7272
60 Ga0070701_10023515 3300005438 Bacteria 2969
61 Ga0070701_10075321 3300005438 Bacteria 1814
62 Ga0070711_100046639 3300005439 Bacteria 2953
63 Ga0070705_100000320 3300005440 Bacteria 28430
64 Ga0070705_100001556 3300005440 Bacteria 12024
65 Ga0070705_100044488 3300005440 Bacteria 2550
66 Ga0070700_100000571 3300005441 Bacteria 18444
67 Ga0070700_100004319 3300005441 Bacteria 7417
68 Ga0070700_100113060 3300005441 Bacteria 1808
69 Ga0070700_100117995 3300005441 Bacteria 1774
70 Ga0070700_100186821 3300005441 Unclassified 1446
71 Ga0070700_100213224 3300005441 Bacteria 1364
72 Ga0070694_100000077 3300005444 Bacteria 47645
73 Ga0070694_100018243 3300005444 Bacteria 4452
74 Ga0070694_100028542 3300005444 Bacteria 3632
75 Ga0070694_100122034 3300005444 Bacteria 1871
76 Ga0070694_100520508 3300005444 Bacteria 949
77 Ga0070708_100042497 3300005445 Bacteria 3990
78 Ga0070708_100664778 3300005445 Bacteria 981
79 Ga0070663_100001684 3300005455 Bacteria 12267
80 Ga0070663_100072084 3300005455 Bacteria 2515
81 Ga0070678_100001194 3300005456 Bacteria 13826
82 Ga0070678_100006807 3300005456 Bacteria 6737
83 Ga0070678_100006989 3300005456 Bacteria 6663
84 Ga0070681_10036728 3300005458 Bacteria 4919
85 Ga0070681_10071518 3300005458 Bacteria 3433
86 Ga0070681_10328360 3300005458 Bacteria 1439
87 Ga0068867_100000107 3300005459 Bacteria 53378
88 Ga0068867_100002779 3300005459 Bacteria 12309
89 Ga0070685_10012897 3300005466 Bacteria 4399
90 Ga0070685_10125564 3300005466 Bacteria 1598
91 Ga0070706_100034156 3300005467 Bacteria 4696
92 Ga0070679_100002529 3300005530 Bacteria 16578
93 Ga0070697_100030566 3300005536 Bacteria 4327
94 Ga0068853_100129078 3300005539 Bacteria 2261
95 Ga0068853_100133225 3300005539 Bacteria 2226
96 Ga0068853_100454520 3300005539 Bacteria 1205
97 Ga0070672_100003792 3300005543 Bacteria 9838
98 Ga0070672_100032011 3300005543 Bacteria 3965
99 Ga0070672_100066933 3300005543 Bacteria 2845
100 Ga0070672_100269620 3300005543 Bacteria 1437
101 Ga0070686_100000825 3300005544 Bacteria 17899
102 Ga0070686_100045421 3300005544 Bacteria 2767
103 Ga0070686_100491732 3300005544 Bacteria 950
104 Ga0070686_100675896 3300005544 Bacteria 821
105 Ga0070695_100000457 3300005545 Bacteria 21293
106 Ga0070695_100025176 3300005545 Unclassified 3673
107 Ga0070695_100102986 3300005545 Bacteria 1925
108 Ga0070696_100001446 3300005546 Bacteria 15542
109 Ga0070696_100003445 3300005546 Bacteria 10528
110 Ga0070693_100000040 3300005547 Bacteria 49709
111 Ga0070693_100188855 3300005547 Bacteria 1331
112 Ga0070665_100000167 3300005548 Bacteria 119817
113 Ga0070704_100003720 3300005549 Bacteria 8789
114 Ga0068855_100005158 3300005563 Bacteria 15933
115 Ga0068855_100085252 3300005563 Bacteria 3656
116 Ga0068855_100090924 3300005563 Bacteria 3521
117 Ga0070664_100023786 3300005564 Bacteria 5061
118 Ga0070664_100092755 3300005564 Bacteria 2615
119 Ga0068857_100001320 3300005577 Bacteria 19510
120 Ga0068857_100130183 3300005577 Bacteria 2269
121 Ga0068854_100000693 3300005578 Bacteria 20011
122 Ga0068854_100004898 3300005578 Bacteria 8445
123 Ga0068854_100086641 3300005578 Bacteria 2322
124 Ga0068856_100045174 3300005614 Bacteria 4336
125 Ga0068856_100410188 3300005614 Bacteria 1374
126 Ga0070702_100000050 3300005615 Bacteria 32860
127 Ga0070702_100138521 3300005615 Bacteria 1547
128 Ga0068852_100000255 3300005616 Bacteria 36037
129 Ga0068852_100341699 3300005616 Unclassified 1459
130 Ga0068859_100000332 3300005617 Bacteria 47130
131 Ga0068859_100004149 3300005617 Bacteria 14799
132 Ga0068859_100006983 3300005617 Bacteria 11464
133 Ga0068859_100177798 3300005617 Bacteria 2210
134 Ga0068864_100018377 3300005618 Bacteria 5840
135 Ga0068866_10001291 3300005718 Bacteria 10845
136 Ga0068866_10002275 3300005718 Bacteria 7956
137 Ga0068861_100000100 3300005719 Bacteria 42431
138 Ga0068861_100000549 3300005719 Bacteria 22123
139 Ga0068861_100031573 3300005719 Bacteria 3892
140 Ga0068861_100136854 3300005719 Bacteria 1994
141 Ga0068851_10013250 3300005834 Bacteria 3901
142 Ga0068870_10006180 3300005840 Bacteria 5265
143 Ga0068870_10031554 3300005840 Bacteria 2686
144 Ga0068863_100028593 3300005841 Bacteria 5322
145 Ga0068863_100035539 3300005841 Bacteria 4746
146 Ga0068863_100093107 3300005841 Bacteria 2860
147 Ga0068863_100168837 3300005841 Bacteria 2098
148 Ga0068858_100004862 3300005842 Bacteria 13176
149 Ga0068858_100104856 3300005842 Bacteria 2638
150 Ga0068858_100348118 3300005842 Bacteria 1419
151 Ga0068858_100408015 3300005842 Bacteria 1306
152 Ga0068858_100828038 3300005842 Archaea 903
153 Ga0068860_100070726 3300005843 Bacteria 3317
154 Ga0068860_100123746 3300005843 Unclassified 2478
155 Ga0068860_100150773 3300005843 Bacteria 2239
156 Ga0068860_100318878 3300005843 Bacteria 1525
157 Ga0068860_100466955 3300005843 Unclassified 1256
158 Ga0068862_100003390 3300005844 Bacteria 13741
159 Ga0068862_100011446 3300005844 Bacteria 7322
160 Ga0068862_100534191 3300005844 Bacteria 1118
161 Ga0081540_1000558 3300005983 Bacteria 36128
162 Ga0075365_10344493 3300006038 Bacteria 1050
163 Ga0097621_100000676 3300006237 Bacteria 23878
164 Ga0097621_100003787 3300006237 Bacteria 10478
165 Ga0097621_100040992 3300006237 Bacteria 3725
166 Ga0097621_100649413 3300006237 Unclassified 968
167 Ga0068871_100000238 3300006358 Bacteria 38970
168 Ga0068871_100001226 3300006358 Bacteria 17113
169 Ga0068871_100015707 3300006358 Bacteria 5679
170 Ga0068871_100052300 3300006358 Bacteria 3308
171 Ga0068871_100058965 3300006358 Bacteria 3127
172 Ga0075428_100004117 3300006844 Bacteria 16009
173 Ga0075428_100032389 3300006844 Bacteria 5773
174 Ga0075428_100384683 3300006844 Unclassified 1504
175 Ga0075428_100521801 3300006844 Unclassified 1270
176 Ga0075430_100019091 3300006846 Bacteria 5831
177 Ga0075431_100000994 3300006847 Bacteria 25257
178 Ga0075431_100010101 3300006847 Bacteria 9486
179 Ga0075431_100328343 3300006847 Bacteria 1541
180 Ga0075433_10010304 3300006852 Bacteria 7496
181 Ga0075433_10029402 3300006852 Bacteria 4681
182 Ga0075434_100044229 3300006871 Bacteria 4418
183 Ga0075434_100196615 3300006871 Bacteria 2036
184 Ga0075434_100432395 3300006871 Unclassified 1337
185 Ga0075429_100002612 3300006880 Bacteria 15188
186 Ga0075429_100029583 3300006880 Bacteria 4757
187 Ga0068865_100000571 3300006881 Bacteria 20589
188 Ga0068865_100001561 3300006881 Bacteria 13390
189 Ga0068865_100026822 3300006881 Bacteria 3801
190 Ga0068865_100480818 3300006881 Bacteria 1032
191 Ga0097620_100000332 3300006931 Bacteria 47130
192 Ga0097620_100004149 3300006931 Bacteria 14799
193 Ga0097620_100006983 3300006931 Bacteria 11464
194 Ga0097620_100177796 3300006931 Bacteria 2210
195 Ga0075435_100011247 3300007076 Bacteria 6571
196 Ga0075435_100040179 3300007076 Bacteria 3734
197 Ga0105240_10247972 3300009093 Bacteria 2061
198 Ga0111539_10097614 3300009094 Bacteria 3451
199 Ga0111539_10138276 3300009094 Bacteria 2853
200 Ga0111539_10367680 3300009094 Unclassified 1674
201 Ga0111539_10476152 3300009094 Unclassified 1454
202 Ga0105245_10000115 3300009098 Bacteria 77632
203 Ga0105245_10000482 3300009098 Bacteria 36560
204 Ga0105245_10013137 3300009098 Bacteria 7216
205 Ga0105247_10000388 3300009101 Bacteria 37351
206 Ga0114129_10189764 3300009147 Unclassified 2791
207 Ga0114129_10450055 3300009147 Bacteria 1689
208 Ga0114129_10546737 3300009147 Unclassified 1506
209 Ga0105243_10000035 3300009148 Bacteria 177598
210 Ga0105243_10004331 3300009148 Bacteria 11242
211 Ga0105243_10011190 3300009148 Bacteria 6787
212 Ga0105241_10021871 3300009174 Bacteria 4733
213 Ga0105241_10102552 3300009174 Bacteria 2277
214 Ga0105242_10000268 3300009176 Bacteria 41263
215 Ga0105242_10001933 3300009176 Bacteria 16293
216 Ga0105242_10004528 3300009176 Bacteria 10796
217 Ga0105248_10042121 3300009177 Bacteria 5121
218 Ga0105248_10069953 3300009177 Bacteria 3941
219 Ga0105248_10250327 3300009177 Bacteria 1994
220 Ga0105248_10251323 3300009177 Bacteria 1990
221 Ga0105248_10325447 3300009177 Bacteria 1731
222 Ga0105248_10447028 3300009177 Bacteria 1456
223 Ga0105237_10264859 3300009545 Unclassified 1722
224 Ga0105238_10085984 3300009551 Bacteria 3132
225 Ga0105238_10554951 3300009551 Bacteria 1153
226 Ga0105249_10002683 3300009553 Bacteria 15379
227 Ga0105249_10007315 3300009553 Bacteria 9625
228 Ga0105239_10016952 3300010375 Bacteria 8053
229 Ga0105239_10045325 3300010375 Bacteria 4820
230 Ga0105246_10001139 3300011119 Bacteria 15420
231 Ga0105246_10006498 3300011119 Bacteria 7137
232 Ga0157373_10015100 3300013100 Bacteria 5647
233 Ga0157373_10062156 3300013100 Bacteria 2645
234 Ga0157371_10030697 3300013102 Bacteria 3875
235 Ga0157371_10111640 3300013102 Bacteria 1940
236 Ga0157369_10009916 3300013105 Bacteria 10884
237 Ga0157369_10068940 3300013105 Unclassified 3800
238 Ga0157374_10008067 3300013296 Bacteria 9003
239 Ga0157374_10266212 3300013296 Bacteria 1689
240 Ga0157374_10589071 3300013296 Unclassified 1121
241 Ga0157378_10001030 3300013297 Bacteria 25495
242 Ga0157378_10024685 3300013297 Bacteria 5293
243 Ga0157378_10025219 3300013297 Bacteria 5238
244 Ga0157378_10060457 3300013297 Bacteria 3381
245 Ga0157378_10458837 3300013297 Bacteria 1266
246 Ga0163162_10198771 3300013306 Bacteria 2133
247 Ga0163162_10345723 3300013306 Unclassified 1620
248 Ga0163162_10816550 3300013306 Bacteria 1049
249 Ga0157375_10041632 3300013308 Bacteria 4438
250 Ga0157375_10057101 3300013308 Bacteria 3857
251 Ga0157375_10158367 3300013308 Bacteria 2405
252 Ga0157375_10477856 3300013308 Bacteria 1411
253 Ga0157375_11059040 3300013308 Bacteria 948
254 Ga0163163_10106936 3300014325 Unclassified 2824
255 Ga0157380_10010889 3300014326 Bacteria 6557
256 Ga0157380_10019992 3300014326 Bacteria 4998
257 Ga0157380_10034934 3300014326 Bacteria 3879
258 Ga0157380_10133671 3300014326 Bacteria 2120
259 Ga0157380_10637654 3300014326 Bacteria 1061
260 Ga0157377_10000443 3300014745 Bacteria 17886
261 Ga0157377_10109548 3300014745 Bacteria 1658
262 Ga0157379_10005394 3300014968 Bacteria 10980
263 Ga0157376_10000582 3300014969 Bacteria 23542
264 Ga0157376_10002049 3300014969 Bacteria 13520
265 Ga0157376_10004574 3300014969 Bacteria 9631
266 Ga0157376_10028852 3300014969 Bacteria 4415
267 Ga0163161_10001181 3300017792 Bacteria 19617
268 Ga0207697_10000176 3300025315 Bacteria 32694
269 Ga0207656_10002891 3300025321 Bacteria 5855
270 Ga0207682_10029884 3300025893 Bacteria 2180
271 Ga0207642_10000874 3300025899 Bacteria 9417
272 Ga0207688_10000191 3300025901 Bacteria 27075
273 Ga0207688_10010499 3300025901 Bacteria 5037
274 Ga0207680_10060790 3300025903 Bacteria 2301
275 Ga0207647_10006169 3300025904 Bacteria 8732
276 Ga0207645_10000066 3300025907 Bacteria 76090
277 Ga0207645_10000595 3300025907 Bacteria 29991
278 Ga0207643_10000020 3300025908 Bacteria 107342
279 Ga0207643_10049662 3300025908 Bacteria 2377
280 Ga0207705_10018250 3300025909 Bacteria 5017
281 Ga0207654_10021724 3300025911 Unclassified 3416
282 Ga0207707_10027959 3300025912 Bacteria 4932
283 Ga0207707_10054425 3300025912 Bacteria 3483
284 Ga0207671_10034477 3300025914 Bacteria 3760
285 Ga0207663_10141832 3300025916 Bacteria 1675
286 Ga0207663_10318508 3300025916 Bacteria 1168
287 Ga0207660_10003008 3300025917 Bacteria 11029
288 Ga0207660_10082345 3300025917 Bacteria 2367
289 Ga0207662_10000017 3300025918 Bacteria 75622
290 Ga0207662_10000333 3300025918 Bacteria 21392
291 Ga0207657_10000040 3300025919 Bacteria 119777
292 Ga0207657_10017386 3300025919 Bacteria 6899
293 Ga0207649_10007364 3300025920 Bacteria 5988
294 Ga0207652_10069170 3300025921 Bacteria 3065
295 Ga0207646_10031390 3300025922 Bacteria 4809
296 Ga0207681_10002562 3300025923 Bacteria 11539
297 Ga0207681_10031466 3300025923 Bacteria 3465
298 Ga0207681_10071832 3300025923 Bacteria 2415
299 Ga0207681_10163642 3300025923 Unclassified 1680
300 Ga0207681_10174820 3300025923 Unclassified 1631
301 Ga0207694_10060942 3300025924 Bacteria 2937
302 Ga0207650_10007703 3300025925 Bacteria 7337
303 Ga0207650_10008474 3300025925 Bacteria 7020
304 Ga0207659_10007637 3300025926 Bacteria 6671
305 Ga0207659_10011593 3300025926 Bacteria 5575
306 Ga0207687_10001542 3300025927 Bacteria 15813
307 Ga0207687_10076617 3300025927 Bacteria 2403
308 Ga0207644_10170981 3300025931 Viruses 1696
309 Ga0207690_10006627 3300025932 Bacteria 6861
310 Ga0207706_10001090 3300025933 Bacteria 27564
311 Ga0207706_10001297 3300025933 Bacteria 25186
312 Ga0207686_10002255 3300025934 Bacteria 10576
313 Ga0207686_10008783 3300025934 Bacteria 5460
314 Ga0207709_10000917 3300025935 Bacteria 22229
315 Ga0207709_10067230 3300025935 Bacteria 2261
316 Ga0207670_10000311 3300025936 Bacteria 29168
317 Ga0207670_10041144 3300025936 Bacteria 3038
318 Ga0207670_10105740 3300025936 Bacteria 2018
319 Ga0207669_10021102 3300025937 Bacteria 3430
320 Ga0207669_10024139 3300025937 Bacteria 3263
321 Ga0207669_10591210 3300025937 Unclassified 901
322 Ga0207704_10000141 3300025938 Bacteria 38563
323 Ga0207704_10018664 3300025938 Unclassified 3626
324 Ga0207704_10113086 3300025938 Bacteria 1840
325 Ga0207704_10157850 3300025938 Bacteria 1610
326 Ga0207691_10000207 3300025940 Bacteria 56952
327 Ga0207691_10000692 3300025940 Bacteria 33334
328 Ga0207691_10056703 3300025940 Bacteria 3568
329 Ga0207711_10042532 3300025941 Bacteria 3872
330 Ga0207711_10172598 3300025941 Bacteria 1963
331 Ga0207711_10394180 3300025941 Bacteria 1286
332 Ga0207689_10000549 3300025942 Bacteria 35791
333 Ga0207689_10001634 3300025942 Bacteria 21241
334 Ga0207689_10001663 3300025942 Bacteria 21091
335 Ga0207661_10149489 3300025944 Unclassified 2018
336 Ga0207679_10007305 3300025945 Bacteria 7005
337 Ga0207679_10032232 3300025945 Bacteria 3676
338 Ga0207667_10001264 3300025949 Bacteria 31701
339 Ga0207651_10155975 3300025960 Bacteria 1783
340 Ga0207712_10051247 3300025961 Bacteria 2886
341 Ga0207668_10286399 3300025972 Unclassified 1353
342 Ga0207640_10008279 3300025981 Bacteria 5771
343 Ga0207640_10008647 3300025981 Bacteria 5660
344 Ga0207640_10012732 3300025981 Bacteria 4799
345 Ga0207658_10013513 3300025986 Bacteria 5579
346 Ga0207658_10029273 3300025986 Bacteria 3888
347 Ga0207658_10311565 3300025986 Bacteria 1360
348 Ga0207658_10428051 3300025986 Bacteria 1168
349 Ga0207677_10001096 3300026023 Bacteria 14748
350 Ga0207677_10002397 3300026023 Bacteria 9825
351 Ga0207677_10111969 3300026023 Bacteria 2034
352 Ga0207703_10000296 3300026035 Bacteria 54809
353 Ga0207703_10001682 3300026035 Bacteria 19893
354 Ga0207639_10159152 3300026041 Bacteria 1901
355 Ga0207678_10000845 3300026067 Bacteria 28081
356 Ga0207678_10069701 3300026067 Bacteria 3015
357 Ga0207708_10000114 3300026075 Bacteria 61971
358 Ga0207708_10000656 3300026075 Bacteria 26483
359 Ga0207708_10031633 3300026075 Bacteria 4017
360 Ga0207708_10069786 3300026075 Bacteria 2690
361 Ga0207708_10175911 3300026075 Bacteria 1697
362 Ga0207702_10003642 3300026078 Bacteria 13960
363 Ga0207641_10014849 3300026088 Bacteria 6383
364 Ga0207641_10070847 3300026088 Bacteria 2997
365 Ga0207641_10072859 3300026088 Bacteria 2959
366 Ga0207641_10076393 3300026088 Bacteria 2896
367 Ga0207641_10158050 3300026088 Bacteria 2058
368 Ga0207641_10220887 3300026088 Bacteria 1757
369 Ga0207648_10000113 3300026089 Bacteria 78626
370 Ga0207648_10001090 3300026089 Bacteria 30426
371 Ga0207648_10081976 3300026089 Bacteria 2813
372 Ga0207676_10000402 3300026095 Bacteria 36617
373 Ga0207676_10376685 3300026095 Unclassified 1320
374 Ga0207676_10509619 3300026095 Unclassified 1144
375 Ga0207674_10001435 3300026116 Bacteria 30790
376 Ga0207674_10015980 3300026116 Bacteria 8223
377 Ga0207675_100000017 3300026118 Bacteria 124338
378 Ga0207675_100000191 3300026118 Bacteria 55750
379 Ga0207675_100008911 3300026118 Bacteria 9413
380 Ga0207683_10000072 3300026121 Bacteria 78277
381 Ga0207683_10000081 3300026121 Bacteria 75875
382 Ga0207698_10193344 3300026142 Bacteria 1815
383 Ga0209969_1000434 3300027360 Bacteria 5596
384 Ga0209996_1000059 3300027395 Bacteria 15029
385 Ga0210000_1000155 3300027462 Bacteria 9695
386 Ga0209995_1000028 3300027471 Bacteria 22611
387 Ga0209968_1000100 3300027526 Bacteria 15730
388 Ga0209999_1001000 3300027543 Bacteria 4776
389 Ga0209970_1000688 3300027614 Bacteria 5874
390 Ga0210002_1000123 3300027617 Bacteria 12088
391 Ga0209966_1000196 3300027695 Bacteria 24998
392 Ga0209998_10000132 3300027717 Bacteria 28917
393 Ga0209974_10000471 3300027876 Bacteria 13396
394 Ga0207428_10005187 3300027907 Bacteria 12192
395 Ga0207428_10094902 3300027907 Bacteria 2311
396 Ga0268266_10000082 3300028379 Bacteria 205422
397 Ga0268266_10001053 3300028379 Bacteria 34569
398 Ga0268265_10027207 3300028380 Bacteria 4078
399 Ga0268265_10617117 3300028380 Bacteria 1038
400 Ga0268264_10015314 3300028381 Bacteria 6289
401 Ga0268264_10073240 3300028381 Unclassified 2906
402 Ga0268264_10109658 3300028381 Bacteria 2415
403 Ga0268264_10174860 3300028381 Bacteria 1945
404 Ga0265338_10004036 3300028800 Bacteria 20147
405 Ga0265328_10018307 3300031239 Bacteria 2703
406 Ga0265340_10096690 3300031247 Bacteria 1376
407 Ga0265339_10002360 3300031249 Bacteria 13557
408 Ga0265327_10012901 3300031251 Bacteria 5593
409 Ga0265316_10119344 3300031344 Bacteria 1992
410 Ga0373959_0043229 3300034820 Bacteria 952
411 Ga0373934_0000748 3300035086 Bacteria 11626
412 Ga0373923_0031474 3300035111 Unclassified 2139
413 Ga0373961_0007539 3300035241 Bacteria 2635
414 Ga0373931_0047059 3300035691 Bacteria 2282
415 Ga0373931_0286835 3300035691 Unclassified 1013
416 Ga0373927_0009047 3300035695 Bacteria 6686
417 Ga0373927_0154447 3300035695 Unclassified 1503
418 Ga0373947_0304306 3300035725 Unclassified 1064
419 Ga0373937_0443800 3300036401 Unclassified 1232
420 Ga0373925_0221301 3300037068 Unclassified 1511
421 Ga0439448_0047074 3300042005 Bacteria 1406
422 Ga0439450_034777 3300042008 Bacteria 1147
423 Ga0439458_0115892 3300042157 Unclassified 703
424 Ga0451577_0002655 3300042876 Bacteria 20946
425 Ga0451577_0090511 3300042876 Bacteria 2731
426 Ga0451577_0226626 3300042876 Bacteria 1690
427 Ga0451577_0268920 3300042876 Bacteria 1544
428 Ga0453684_0027488 3300044712 Bacteria 8156
429 Ga0453684_0666893 3300044712 Bacteria 1133
430 Ga0451576_0037812 3300045051 Bacteria 5111
431 Ga0451576_0049436 3300045051 Bacteria 4412
432 Ga0451576_0054190 3300045051 Unclassified 4200
433 Ga0451576_0109645 3300045051 Bacteria 2872
434 Ga0451576_0176666 3300045051 Unclassified 2229
435 Ga0451576_0379013 3300045051 Unclassified 1483
436 Ga0495603_0070483 3300046455 Bacteria 2055
437 Ga0495651_0064806 3300046462 Unclassified 2792
438 Ga0495580_0000002 3300046472 Bacteria 121311
439 Ga0495580_0029497 3300046472 Bacteria 3981
440 Ga0495580_0054618 3300046472 Bacteria 2817
441 Ga0495580_0081133 3300046472 Bacteria 2261
442 Ga0495594_0094042 3300046499 Unclassified 1682
443 Ga0495665_0056755 3300046531 Unclassified 2067
444 Ga0495598_0019367 3300046537 Bacteria 1784
445 Ga0495635_0207425 3300046663 Unclassified 1328
446 Ga0495669_0053953 3300046684 Bacteria 1809
447 Ga0495636_0006482 3300047318 Bacteria 4598
448 Ga0495636_0097094 3300047318 Unclassified 1285
449 Ga0495684_0019858 3300047471 Bacteria 5178
450 Ga0496103_0259469 3300048906 Bacteria 1118
451 Ga0496104_0378182 3300048907 Bacteria 1329
452 Ga0496106_0017492 3300048909 Bacteria 5304
453 Ga0496106_0082114 3300048909 Bacteria 2477
454 Ga0496106_0310095 3300048909 Unclassified 1266
455 Ga0496108_0300262 3300048911 Bacteria 1399
456 Ga0496112_0036484 3300048915 Bacteria 4796
457 Ga0496112_0646939 3300048915 Unclassified 987
458 Ga0496114_0361583 3300048917 Unclassified 1284
459 Ga0496126_0095307 3300048929 Unclassified 2611
460 Ga0501036_0311555 3300049572 Bacteria 1316
461 Ga0501040_0048417 3300049576 Bacteria 2905
462 Ga0501041_0064109 3300049577 Bacteria 2250
463 Ga0501042_0059027 3300049578 Bacteria 2739
464 Ga0501048_0069888 3300049582 Bacteria 2480
465 Ga0501075_0092873 3300049591 Unclassified 2291
466 Ga0501075_0549605 3300049591 Bacteria 881
467 Ga0501076_0075506 3300049592 Bacteria 2702
468 Ga0501076_0096810 3300049592 Bacteria 2377
469 Ga0501076_0150611 3300049592 Bacteria 1893
470 Ga0501079_0039738 3300049741 Bacteria 3629
471 Ga0501079_0082156 3300049741 Bacteria 2492
472 Ga0501081_0017133 3300049743 Bacteria 4793
473 Ga0501045_0009364 3300049824 Bacteria 6849
474 nmdc:mga0yw44_352835_c1 3300050492 Bacteria 990
475 nmdc:mga05p37_155845_c1 3300050507 Unclassified 2791
476 nmdc:mga05p37_38084_c1 3300050507 Bacteria 5898
477 nmdc:mga05p37_629075_c1 3300050507 Bacteria 1206
478 nmdc:mga09592_3271_c1 3300050508 Bacteria 13119
479 nmdc:mga0qj67_43405_c1 3300050509 Unclassified 3541
480 nmdc:mga06r32_13427_c1 3300050510 Bacteria 7417
481 nmdc:mga06r32_159359_c1 3300050510 Bacteria 2239
482 nmdc:mga08y16_168962_c1 3300050511 Bacteria 2272
483 nmdc:mga0n895_100484_c1 3300050512 Bacteria 2901
484 nmdc:mga0n895_373305_c1 3300050512 Unclassified 1444
485 nmdc:mga0n895_4599_c1 3300050512 Bacteria 11370
486 nmdc:mga0rr50_5313_c1 3300050513 Bacteria 7664
487 nmdc:mga0a205_14470_c1 3300050515 Bacteria 7359
488 nmdc:mga0a205_20166_c1 3300050515 Bacteria 6288
489 Ga0500556_0093470 3300053104 Unclassified 1151
490 Ga0501084_0182644 3300054114 Bacteria 1771
491 Ga0501084_0261743 3300054114 Bacteria 1460
492 Ga0501082_0426374 3300060353 Bacteria 1158
493 Ga0530510_0102145 3300061734 Bacteria 2097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100145914 Ga0070688_1001459142 191
2 3300005617 Ga0068859_100006983 Ga0068859_1000069835 191
3 3300006931 Ga0097620_100006983 Ga0097620_1000069835 191
4 3300025923 Ga0207681_10174820 Ga0207681_101748202 192
5 3300013306 Ga0163162_10345723 Ga0163162_103457231 202
6 3300035086 Ga0373934_0000748 Ga0373934_0000748_9437_10051 202
7 3300035111 Ga0373923_0031474 Ga0373923_0031474_700_1314 202
8 3300035695 Ga0373927_0154447 Ga0373927_0154447_15_641 202
9 3300037068 Ga0373925_0221301 Ga0373925_0221301_866_1492 202
10 3300046462 Ga0495651_0064806 Ga0495651_0064806_259_873 202
11 3300046663 Ga0495635_0207425 Ga0495635_0207425_471_1085 202
12 3300047471 Ga0495684_0019858 Ga0495684_0019858_1331_1945 202
13 3300045051 Ga0451576_0037812 Ga0451576_0037812_469_1227 205
14 3300006844 Ga0075428_100004117 Ga0075428_10000411719 209
15 3300006847 Ga0075431_100000994 Ga0075431_10000099418 209
16 3300006880 Ga0075429_100002612 Ga0075429_1000026123 209
17 3300009147 Ga0114129_10189764 Ga0114129_101897643 209
18 3300042157 Ga0439458_0115892 Ga0439458_0115892_30_665 209
19 3300050507 nmdc:mga05p37_155845_c1 nmdc:mga05p37_155845_c1_1397_2170 209
20 3300050508 nmdc:mga09592_3271_c1 nmdc:mga09592_3271_c1_3671_4444 209
21 3300050509 nmdc:mga0qj67_43405_c1 nmdc:mga0qj67_43405_c1_1190_1963 209
22 3300050510 nmdc:mga06r32_13427_c1 nmdc:mga06r32_13427_c1_3512_4285 209
23 3300046684 Ga0495669_0053953 Ga0495669_0053953_450_1178 212
24 3300042005 Ga0439448_0047074 Ga0439448_0047074_169_966 216
25 3300006237 Ga0097621_100040992 Ga0097621_1000409922 219
26 3300006358 Ga0068871_100058965 Ga0068871_1000589652 219
27 3300005842 Ga0068858_100408015 Ga0068858_1004080152 220
28 3300050515 nmdc:mga0a205_20166_c1 nmdc:mga0a205_20166_c1_3819_4607 220
29 3300006844 Ga0075428_100384683 Ga0075428_1003846832 221
30 3300009094 Ga0111539_10138276 Ga0111539_101382762 221
31 3300027907 Ga0207428_10094902 Ga0207428_100949022 221
32 3300050511 nmdc:mga08y16_168962_c1 nmdc:mga08y16_168962_c1_739_1497 221
33 3300013308 Ga0157375_10041632 Ga0157375_100416326 222
34 3300005354 Ga0070675_100226096 Ga0070675_1002260962 225
35 3300005841 Ga0068863_100093107 Ga0068863_1000931073 225
36 3300006852 Ga0075433_10010304 Ga0075433_100103045 225
37 3300007076 Ga0075435_100040179 Ga0075435_1000401794 225
38 3300009177 Ga0105248_10325447 Ga0105248_103254473 225
39 3300026088 Ga0207641_10070847 Ga0207641_100708472 225
40 3300005441 Ga0070700_100186821 Ga0070700_1001868211 227
41 3300005445 Ga0070708_100664778 Ga0070708_1006647781 227
42 3300048907 Ga0496104_0378182 Ga0496104_0378182_14_733 227
43 3300014969 Ga0157376_10028852 Ga0157376_100288525 228
44 3300036401 Ga0373937_0443800 Ga0373937_0443800_459_1184 229
45 3300005330 Ga0070690_100048488 Ga0070690_1000484882 230
46 3300005353 Ga0070669_100016102 Ga0070669_1000161025 230
47 3300005365 Ga0070688_100096989 Ga0070688_1000969892 230
48 3300005466 Ga0070685_10125564 Ga0070685_101255642 230
49 3300005544 Ga0070686_100045421 Ga0070686_1000454212 230
50 3300005577 Ga0068857_100130183 Ga0068857_1001301832 230
51 3300005617 Ga0068859_100004149 Ga0068859_1000041496 230
52 3300005719 Ga0068861_100031573 Ga0068861_1000315732 230
53 3300005843 Ga0068860_100150773 Ga0068860_1001507732 230
54 3300006931 Ga0097620_100004149 Ga0097620_1000041496 230
55 3300013297 Ga0157378_10060457 Ga0157378_100604572 230
56 3300025923 Ga0207681_10071832 Ga0207681_100718324 230
57 3300025938 Ga0207704_10157850 Ga0207704_101578503 230
58 3300026075 Ga0207708_10069786 Ga0207708_100697862 230
59 3300026118 Ga0207675_100008911 Ga0207675_1000089115 230
60 3300028381 Ga0268264_10109658 Ga0268264_101096582 230
61 3300046455 Ga0495603_0070483 Ga0495603_0070483_387_1115 230
62 3300046537 Ga0495598_0019367 Ga0495598_0019367_269_997 230
63 3300005329 Ga0070683_100387918 Ga0070683_1003879182 231
64 3300005367 Ga0070667_100372784 Ga0070667_1003727841 231
65 3300009174 Ga0105241_10102552 Ga0105241_101025522 231
66 3300009177 Ga0105248_10042121 Ga0105248_100421212 231
67 3300009551 Ga0105238_10554951 Ga0105238_105549511 231
68 3300013105 Ga0157369_10068940 Ga0157369_100689404 231
69 3300025931 Ga0207644_10170981 Ga0207644_101709812 231
70 3300025941 Ga0207711_10042532 Ga0207711_100425323 231
71 3300025944 Ga0207661_10149489 Ga0207661_101494892 231
72 3300025986 Ga0207658_10428051 Ga0207658_104280511 231
73 3300026088 Ga0207641_10158050 Ga0207641_101580502 232
74 3300005456 Ga0070678_100006989 Ga0070678_1000069898 233
75 3300005543 Ga0070672_100066933 Ga0070672_1000669336 233
76 3300005841 Ga0068863_100035539 Ga0068863_1000355395 233
77 3300006237 Ga0097621_100649413 Ga0097621_1006494131 233
78 3300006881 Ga0068865_100480818 Ga0068865_1004808181 233
79 3300009177 Ga0105248_10251323 Ga0105248_102513232 233
80 3300013306 Ga0163162_10816550 Ga0163162_108165501 233
81 3300013308 Ga0157375_10158367 Ga0157375_101583674 233
82 3300025937 Ga0207669_10024139 Ga0207669_100241392 233
83 3300025940 Ga0207691_10056703 Ga0207691_100567032 233
84 3300025941 Ga0207711_10172598 Ga0207711_101725982 233
85 3300026088 Ga0207641_10072859 Ga0207641_100728592 233
86 3300026088 Ga0207641_10220887 Ga0207641_102208871 233
87 3300026095 Ga0207676_10376685 Ga0207676_103766852 233
88 3300026095 Ga0207676_10509619 Ga0207676_105096192 233
89 3300031251 Ga0265327_10012901 Ga0265327_100129014 233
90 3300035725 Ga0373947_0304306 Ga0373947_0304306_19_795 233
91 3300046472 Ga0495580_0054618 Ga0495580_0054618_1804_2580 233
92 3300046472 Ga0495580_0081133 Ga0495580_0081133_220_996 233
93 3300046499 Ga0495594_0094042 Ga0495594_0094042_378_1154 233
94 3300046531 Ga0495665_0056755 Ga0495665_0056755_815_1591 233
95 3300047318 Ga0495636_0097094 Ga0495636_0097094_372_1148 233
96 3300048915 Ga0496112_0646939 Ga0496112_0646939_22_798 233
97 iso_pu_bacteria 2928963466 2928968120 233
98 3300005328 Ga0070676_10006212 Ga0070676_100062124 234
99 3300005329 Ga0070683_100448123 Ga0070683_1004481231 234
100 3300005330 Ga0070690_100003159 Ga0070690_1000031593 234
101 3300005331 Ga0070670_100025791 Ga0070670_1000257913 234
102 3300005333 Ga0070677_10027063 Ga0070677_100270631 234
103 3300005335 Ga0070666_10060907 Ga0070666_100609072 234
104 3300005336 Ga0070680_100006482 Ga0070680_1000064823 234
105 3300005338 Ga0068868_100106856 Ga0068868_1001068562 234
106 3300005339 Ga0070660_100014758 Ga0070660_1000147582 234
107 3300005340 Ga0070689_100006112 Ga0070689_1000061122 234
108 3300005344 Ga0070661_100020597 Ga0070661_1000205972 234
109 3300005345 Ga0070692_10001339 Ga0070692_100013392 234
110 3300005347 Ga0070668_100004402 Ga0070668_1000044028 234
111 3300005353 Ga0070669_100009844 Ga0070669_1000098445 234
112 3300005354 Ga0070675_100027335 Ga0070675_1000273352 234
113 3300005355 Ga0070671_100298770 Ga0070671_1002987701 234
114 3300005356 Ga0070674_100002804 Ga0070674_1000028045 234
115 3300005364 Ga0070673_100004817 Ga0070673_10000481713 234
116 3300005366 Ga0070659_100024242 Ga0070659_1000242423 234
117 3300005367 Ga0070667_100010137 Ga0070667_1000101375 234
118 3300005438 Ga0070701_10075321 Ga0070701_100753212 234
119 3300005439 Ga0070711_100046639 Ga0070711_1000466392 234
120 3300005440 Ga0070705_100044488 Ga0070705_1000444882 234
121 3300005441 Ga0070700_100004319 Ga0070700_1000043191 234
122 3300005444 Ga0070694_100018243 Ga0070694_1000182433 234
123 3300005444 Ga0070694_100028542 Ga0070694_1000285423 234
124 3300005455 Ga0070663_100072084 Ga0070663_1000720842 234
125 3300005456 Ga0070678_100001194 Ga0070678_10000119418 234
126 3300005458 Ga0070681_10036728 Ga0070681_100367282 234
127 3300005459 Ga0068867_100002779 Ga0068867_1000027794 234
128 3300005539 Ga0068853_100129078 Ga0068853_1001290781 234
129 3300005543 Ga0070672_100032011 Ga0070672_1000320112 234
130 3300005545 Ga0070695_100102986 Ga0070695_1001029861 234
131 3300005546 Ga0070696_100003445 Ga0070696_10000344511 234
132 3300005547 Ga0070693_100188855 Ga0070693_1001888552 234
133 3300005563 Ga0068855_100085252 Ga0068855_1000852523 234
134 3300005564 Ga0070664_100023786 Ga0070664_1000237862 234
135 3300005578 Ga0068854_100086641 Ga0068854_1000866412 234
136 3300005842 Ga0068858_100348118 Ga0068858_1003481181 234
137 3300005842 Ga0068858_100828038 Ga0068858_1008280381 234
138 3300005843 Ga0068860_100123746 Ga0068860_1001237462 234
139 3300006237 Ga0097621_100003787 Ga0097621_10000378717 234
140 3300006358 Ga0068871_100001226 Ga0068871_10000122617 234
141 3300006844 Ga0075428_100521801 Ga0075428_1005218011 234
142 3300006846 Ga0075430_100019091 Ga0075430_1000190913 234
143 3300006847 Ga0075431_100010101 Ga0075431_10001010111 234
144 3300006852 Ga0075433_10029402 Ga0075433_100294023 234
145 3300006871 Ga0075434_100196615 Ga0075434_1001966152 234
146 3300006871 Ga0075434_100432395 Ga0075434_1004323952 234
147 3300006880 Ga0075429_100029583 Ga0075429_1000295832 234
148 3300006881 Ga0068865_100000571 Ga0068865_1000005719 234
149 3300007076 Ga0075435_100011247 Ga0075435_1000112472 234
150 3300009094 Ga0111539_10367680 Ga0111539_103676802 234
151 3300009098 Ga0105245_10013137 Ga0105245_100131375 234
152 3300009148 Ga0105243_10004331 Ga0105243_1000433115 234
153 3300009176 Ga0105242_10001933 Ga0105242_100019332 234
154 3300009553 Ga0105249_10007315 Ga0105249_1000731510 234
155 3300010375 Ga0105239_10045325 Ga0105239_100453252 234
156 3300011119 Ga0105246_10001139 Ga0105246_100011392 234
157 3300013100 Ga0157373_10062156 Ga0157373_100621563 234
158 3300013102 Ga0157371_10030697 Ga0157371_100306974 234
159 3300013296 Ga0157374_10266212 Ga0157374_102662121 234
160 3300013297 Ga0157378_10024685 Ga0157378_100246852 234
161 3300014326 Ga0157380_10133671 Ga0157380_101336712 234
162 3300014745 Ga0157377_10109548 Ga0157377_101095481 234
163 3300014969 Ga0157376_10004574 Ga0157376_100045743 234
164 3300025893 Ga0207682_10029884 Ga0207682_100298842 234
165 3300025901 Ga0207688_10010499 Ga0207688_100104992 234
166 3300025903 Ga0207680_10060790 Ga0207680_100607902 234
167 3300025907 Ga0207645_10000595 Ga0207645_1000059528 234
168 3300025912 Ga0207707_10027959 Ga0207707_100279592 234
169 3300025916 Ga0207663_10141832 Ga0207663_101418321 234
170 3300025917 Ga0207660_10082345 Ga0207660_100823452 234
171 3300025919 Ga0207657_10017386 Ga0207657_100173868 234
172 3300025920 Ga0207649_10007364 Ga0207649_100073644 234
173 3300025923 Ga0207681_10031466 Ga0207681_100314662 234
174 3300025925 Ga0207650_10007703 Ga0207650_100077036 234
175 3300025926 Ga0207659_10011593 Ga0207659_100115937 234
176 3300025927 Ga0207687_10076617 Ga0207687_100766172 234
177 3300025932 Ga0207690_10006627 Ga0207690_100066272 234
178 3300025933 Ga0207706_10001090 Ga0207706_1000109028 234
179 3300025934 Ga0207686_10002255 Ga0207686_100022554 234
180 3300025936 Ga0207670_10041144 Ga0207670_100411442 234
181 3300025937 Ga0207669_10021102 Ga0207669_100211022 234
182 3300025938 Ga0207704_10113086 Ga0207704_101130861 234
183 3300025940 Ga0207691_10000692 Ga0207691_1000069225 234
184 3300025942 Ga0207689_10001634 Ga0207689_1000163413 234
185 3300025960 Ga0207651_10155975 Ga0207651_101559752 234
186 3300025961 Ga0207712_10051247 Ga0207712_100512472 234
187 3300025981 Ga0207640_10008279 Ga0207640_100082792 234
188 3300025986 Ga0207658_10029273 Ga0207658_100292732 234
189 3300026023 Ga0207677_10111969 Ga0207677_101119692 234
190 3300026067 Ga0207678_10069701 Ga0207678_100697012 234
191 3300026075 Ga0207708_10000656 Ga0207708_100006568 234
192 3300026089 Ga0207648_10001090 Ga0207648_1000109015 234
193 3300026121 Ga0207683_10000072 Ga0207683_1000007228 234
194 3300027360 Ga0209969_1000434 Ga0209969_10004342 234
195 3300027395 Ga0209996_1000059 Ga0209996_100005910 234
196 3300027462 Ga0210000_1000155 Ga0210000_10001553 234
197 3300027471 Ga0209995_1000028 Ga0209995_10000288 234
198 3300027526 Ga0209968_1000100 Ga0209968_10001008 234
199 3300027543 Ga0209999_1001000 Ga0209999_10010002 234
200 3300027614 Ga0209970_1000688 Ga0209970_10006884 234
201 3300027617 Ga0210002_1000123 Ga0210002_10001238 234
202 3300027695 Ga0209966_1000196 Ga0209966_10001963 234
203 3300027717 Ga0209998_10000132 Ga0209998_1000013228 234
204 3300027876 Ga0209974_10000471 Ga0209974_1000047116 234
205 3300027907 Ga0207428_10005187 Ga0207428_1000518715 234
206 3300028381 Ga0268264_10073240 Ga0268264_100732402 234
207 3300034820 Ga0373959_0043229 Ga0373959_0043229_63_836 234
208 3300035241 Ga0373961_0007539 Ga0373961_0007539_1107_1880 234
209 3300042008 Ga0439450_034777 Ga0439450_034777_15_788 234
210 3300042876 Ga0451577_0226626 Ga0451577_0226626_70_843 234
211 3300042876 Ga0451577_0268920 Ga0451577_0268920_356_1126 234
212 3300045051 Ga0451576_0049436 Ga0451576_0049436_2430_3203 234
213 3300045051 Ga0451576_0109645 Ga0451576_0109645_665_1438 234
214 3300045051 Ga0451576_0176666 Ga0451576_0176666_326_1096 234
215 3300046472 Ga0495580_0000002 Ga0495580_0000002_102540_103310 234
216 3300048909 Ga0496106_0082114 Ga0496106_0082114_1207_1980 234
217 3300050507 nmdc:mga05p37_38084_c1 nmdc:mga05p37_38084_c1_212_985 234
218 3300050510 nmdc:mga06r32_159359_c1 nmdc:mga06r32_159359_c1_62_835 234
219 3300050512 nmdc:mga0n895_373305_c1 nmdc:mga0n895_373305_c1_21_794 234
220 3300050512 nmdc:mga0n895_4599_c1 nmdc:mga0n895_4599_c1_4729_5502 234
221 3300050513 nmdc:mga0rr50_5313_c1 nmdc:mga0rr50_5313_c1_2410_3183 234
222 3300050515 nmdc:mga0a205_14470_c1 nmdc:mga0a205_14470_c1_4354_5127 234
223 3300006847 Ga0075431_100328343 Ga0075431_1003283432 235
224 3300009147 Ga0114129_10450055 Ga0114129_104500552 235
225 3300009147 Ga0114129_10546737 Ga0114129_105467372 235
226 3300050507 nmdc:mga05p37_629075_c1 nmdc:mga05p37_629075_c1_201_974 235
227 3300005290 Ga0065712_10170489 Ga0065712_101704891 236
228 3300005544 Ga0070686_100491732 Ga0070686_1004917321 236
229 3300005548 Ga0070665_100000167 Ga0070665_10000016777 236
230 3300009094 Ga0111539_10476152 Ga0111539_104761521 236
231 3300014326 Ga0157380_10637654 Ga0157380_106376542 236
232 3300028379 Ga0268266_10000082 Ga0268266_1000008296 236
233 3300028800 Ga0265338_10004036 Ga0265338_1000403615 236
234 3300031239 Ga0265328_10018307 Ga0265328_100183073 236
235 3300031247 Ga0265340_10096690 Ga0265340_100966902 236
236 3300031249 Ga0265339_10002360 Ga0265339_1000236014 236
237 3300031344 Ga0265316_10119344 Ga0265316_101193444 236
238 3300042876 Ga0451577_0002655 Ga0451577_0002655_19752_20531 236
239 3300042876 Ga0451577_0090511 Ga0451577_0090511_277_1053 236
240 3300044712 Ga0453684_0027488 Ga0453684_0027488_4385_5164 236
241 3300044712 Ga0453684_0666893 Ga0453684_0666893_89_871 236
242 3300045051 Ga0451576_0054190 Ga0451576_0054190_2630_3412 236
243 3300048909 Ga0496106_0310095 Ga0496106_0310095_410_1198 236
244 3300048911 Ga0496108_0300262 Ga0496108_0300262_201_989 236
245 3300048917 Ga0496114_0361583 Ga0496114_0361583_211_999 236
246 3300048929 Ga0496126_0095307 Ga0496126_0095307_1488_2264 236
247 3300049576 Ga0501040_0048417 Ga0501040_0048417_1819_2610 236
248 3300049591 Ga0501075_0092873 Ga0501075_0092873_1036_1827 236
249 3300049592 Ga0501076_0150611 Ga0501076_0150611_959_1750 236
250 3300049741 Ga0501079_0039738 Ga0501079_0039738_2735_3526 236
251 3300049743 Ga0501081_0017133 Ga0501081_0017133_3371_4162 236
252 3300053104 Ga0500556_0093470 Ga0500556_0093470_297_1073 236
253 3300054114 Ga0501084_0182644 Ga0501084_0182644_623_1414 236
254 3300060353 Ga0501082_0426374 Ga0501082_0426374_125_916 236
255 3300061734 Ga0530510_0102145 Ga0530510_0102145_1175_1966 236
256 3300005330 Ga0070690_100000472 Ga0070690_10000047211 237
257 3300005334 Ga0068869_100000410 Ga0068869_1000004108 237
258 3300005336 Ga0070680_100003471 Ga0070680_1000034716 237
259 3300005336 Ga0070680_100043244 Ga0070680_1000432442 237
260 3300005337 Ga0070682_100017355 Ga0070682_1000173554 237
261 3300005338 Ga0068868_100000209 Ga0068868_10000020911 237
262 3300005340 Ga0070689_100000614 Ga0070689_10000061410 237
263 3300005341 Ga0070691_10001516 Ga0070691_100015164 237
264 3300005343 Ga0070687_100000190 Ga0070687_1000001903 237
265 3300005345 Ga0070692_10008470 Ga0070692_100084704 237
266 3300005347 Ga0070668_100682198 Ga0070668_1006821981 237
267 3300005353 Ga0070669_100154427 Ga0070669_1001544272 237
268 3300005354 Ga0070675_100206811 Ga0070675_1002068112 237
269 3300005406 Ga0070703_10037428 Ga0070703_100374281 237
270 3300005438 Ga0070701_10002341 Ga0070701_100023414 237
271 3300005440 Ga0070705_100000320 Ga0070705_10000032019 237
272 3300005441 Ga0070700_100000571 Ga0070700_10000057117 237
273 3300005441 Ga0070700_100117995 Ga0070700_1001179952 237
274 3300005441 Ga0070700_100213224 Ga0070700_1002132242 237
275 3300005444 Ga0070694_100000077 Ga0070694_1000000775 237
276 3300005444 Ga0070694_100520508 Ga0070694_1005205081 237
277 3300005445 Ga0070708_100042497 Ga0070708_1000424973 237
278 3300005458 Ga0070681_10071518 Ga0070681_100715184 237
279 3300005459 Ga0068867_100000107 Ga0068867_10000010747 237
280 3300005467 Ga0070706_100034156 Ga0070706_1000341562 237
281 3300005530 Ga0070679_100002529 Ga0070679_1000025294 237
282 3300005536 Ga0070697_100030566 Ga0070697_1000305662 237
283 3300005539 Ga0068853_100133225 Ga0068853_1001332251 237
284 3300005539 Ga0068853_100454520 Ga0068853_1004545202 237
285 3300005543 Ga0070672_100269620 Ga0070672_1002696202 237
286 3300005544 Ga0070686_100000825 Ga0070686_1000008252 237
287 3300005544 Ga0070686_100675896 Ga0070686_1006758961 237
288 3300005545 Ga0070695_100000457 Ga0070695_1000004574 237
289 3300005546 Ga0070696_100001446 Ga0070696_1000014461 237
290 3300005547 Ga0070693_100000040 Ga0070693_10000004051 237
291 3300005549 Ga0070704_100003720 Ga0070704_1000037205 237
292 3300005563 Ga0068855_100005158 Ga0068855_10000515813 237
293 3300005578 Ga0068854_100004898 Ga0068854_1000048986 237
294 3300005614 Ga0068856_100410188 Ga0068856_1004101883 237
295 3300005615 Ga0070702_100000050 Ga0070702_10000005019 237
296 3300005615 Ga0070702_100138521 Ga0070702_1001385211 237
297 3300005616 Ga0068852_100341699 Ga0068852_1003416992 237
298 3300005617 Ga0068859_100000332 Ga0068859_10000033233 237
299 3300005718 Ga0068866_10001291 Ga0068866_100012912 237
300 3300005719 Ga0068861_100000100 Ga0068861_10000010037 237
301 3300005719 Ga0068861_100136854 Ga0068861_1001368542 237
302 3300005840 Ga0068870_10031554 Ga0068870_100315541 237
303 3300005841 Ga0068863_100168837 Ga0068863_1001688372 237
304 3300005842 Ga0068858_100004862 Ga0068858_1000048622 237
305 3300005843 Ga0068860_100070726 Ga0068860_1000707262 237
306 3300005843 Ga0068860_100318878 Ga0068860_1003188782 237
307 3300005844 Ga0068862_100003390 Ga0068862_10000339014 237
308 3300005844 Ga0068862_100534191 Ga0068862_1005341912 237
309 3300005983 Ga0081540_1000558 Ga0081540_10005586 237
310 3300006038 Ga0075365_10344493 Ga0075365_103444932 237
311 3300006237 Ga0097621_100000676 Ga0097621_1000006766 237
312 3300006358 Ga0068871_100000238 Ga0068871_10000023836 237
313 3300006358 Ga0068871_100052300 Ga0068871_1000523003 237
314 3300006844 Ga0075428_100032389 Ga0075428_1000323895 237
315 3300006871 Ga0075434_100044229 Ga0075434_1000442291 237
316 3300006881 Ga0068865_100001561 Ga0068865_1000015616 237
317 3300006931 Ga0097620_100000332 Ga0097620_10000033220 237
318 3300009094 Ga0111539_10097614 Ga0111539_100976143 237
319 3300009098 Ga0105245_10000115 Ga0105245_1000011530 237
320 3300009148 Ga0105243_10000035 Ga0105243_100000353 237
321 3300009176 Ga0105242_10000268 Ga0105242_1000026835 237
322 3300009177 Ga0105248_10250327 Ga0105248_102503272 237
323 3300009177 Ga0105248_10447028 Ga0105248_104470283 237
324 3300013296 Ga0157374_10589071 Ga0157374_105890711 237
325 3300013297 Ga0157378_10001030 Ga0157378_100010307 237
326 3300013297 Ga0157378_10458837 Ga0157378_104588371 237
327 3300013306 Ga0163162_10198771 Ga0163162_101987712 237
328 3300013308 Ga0157375_10477856 Ga0157375_104778561 237
329 3300013308 Ga0157375_11059040 Ga0157375_110590401 237
330 3300014326 Ga0157380_10019992 Ga0157380_100199922 237
331 3300014326 Ga0157380_10034934 Ga0157380_100349341 237
332 3300014969 Ga0157376_10000582 Ga0157376_100005824 237
333 3300025899 Ga0207642_10000874 Ga0207642_100008748 237
334 3300025908 Ga0207643_10049662 Ga0207643_100496623 237
335 3300025912 Ga0207707_10054425 Ga0207707_100544254 237
336 3300025917 Ga0207660_10003008 Ga0207660_100030084 237
337 3300025918 Ga0207662_10000333 Ga0207662_100003333 237
338 3300025921 Ga0207652_10069170 Ga0207652_100691704 237
339 3300025922 Ga0207646_10031390 Ga0207646_100313902 237
340 3300025923 Ga0207681_10163642 Ga0207681_101636421 237
341 3300025927 Ga0207687_10001542 Ga0207687_1000154210 237
342 3300025934 Ga0207686_10008783 Ga0207686_100087833 237
343 3300025935 Ga0207709_10000917 Ga0207709_1000091721 237
344 3300025936 Ga0207670_10000311 Ga0207670_100003112 237
345 3300025936 Ga0207670_10105740 Ga0207670_101057402 237
346 3300025937 Ga0207669_10591210 Ga0207669_105912101 237
347 3300025938 Ga0207704_10000141 Ga0207704_1000014120 237
348 3300025941 Ga0207711_10394180 Ga0207711_103941803 237
349 3300025942 Ga0207689_10001663 Ga0207689_100016636 237
350 3300025949 Ga0207667_10001264 Ga0207667_1000126433 237
351 3300025981 Ga0207640_10008647 Ga0207640_100086473 237
352 3300025986 Ga0207658_10311565 Ga0207658_103115652 237
353 3300026023 Ga0207677_10002397 Ga0207677_100023979 237
354 3300026035 Ga0207703_10001682 Ga0207703_1000168215 237
355 3300026041 Ga0207639_10159152 Ga0207639_101591522 237
356 3300026075 Ga0207708_10000114 Ga0207708_1000011465 237
357 3300026075 Ga0207708_10175911 Ga0207708_101759112 237
358 3300026078 Ga0207702_10003642 Ga0207702_1000364213 237
359 3300026088 Ga0207641_10076393 Ga0207641_100763932 237
360 3300026089 Ga0207648_10000113 Ga0207648_1000011368 237
361 3300026118 Ga0207675_100000017 Ga0207675_100000017126 237
362 3300026142 Ga0207698_10193344 Ga0207698_101933442 237
363 3300028380 Ga0268265_10027207 Ga0268265_100272074 237
364 3300028380 Ga0268265_10617117 Ga0268265_106171171 237
365 3300028381 Ga0268264_10174860 Ga0268264_101748603 237
366 3300035691 Ga0373931_0047059 Ga0373931_0047059_1215_2006 237
367 3300035695 Ga0373927_0009047 Ga0373927_0009047_4171_4962 237
368 3300045051 Ga0451576_0379013 Ga0451576_0379013_399_1202 237
369 3300046472 Ga0495580_0029497 Ga0495580_0029497_2734_3525 237
370 3300047318 Ga0495636_0006482 Ga0495636_0006482_1650_2444 237
371 3300049572 Ga0501036_0311555 Ga0501036_0311555_98_883 237
372 3300049577 Ga0501041_0064109 Ga0501041_0064109_1412_2197 237
373 3300049578 Ga0501042_0059027 Ga0501042_0059027_72_857 237
374 3300049582 Ga0501048_0069888 Ga0501048_0069888_509_1294 237
375 3300049591 Ga0501075_0549605 Ga0501075_0549605_26_811 237
376 3300049592 Ga0501076_0075506 Ga0501076_0075506_98_883 237
377 3300049592 Ga0501076_0096810 Ga0501076_0096810_94_879 237
378 3300049741 Ga0501079_0082156 Ga0501079_0082156_659_1444 237
379 3300049824 Ga0501045_0009364 Ga0501045_0009364_220_1005 237
380 3300050492 nmdc:mga0yw44_352835_c1 nmdc:mga0yw44_352835_c1_172_951 237
381 3300050512 nmdc:mga0n895_100484_c1 nmdc:mga0n895_100484_c1_259_1095 237
382 3300054114 Ga0501084_0261743 Ga0501084_0261743_28_813 237
383 3300005365 Ga0070688_100004485 Ga0070688_1000044852 238
384 2162886012 MBSR1b_contig_10092069 MBSR1b_0416.00003250 239
385 3300005293 Ga0065715_10104305 Ga0065715_101043053 239
386 3300005329 Ga0070683_100044552 Ga0070683_1000445526 239
387 3300005330 Ga0070690_100003197 Ga0070690_1000031975 239
388 3300005334 Ga0068869_100022840 Ga0068869_1000228402 239
389 3300005335 Ga0070666_10161889 Ga0070666_101618892 239
390 3300005339 Ga0070660_100017975 Ga0070660_1000179752 239
391 3300005340 Ga0070689_100015234 Ga0070689_1000152346 239
392 3300005341 Ga0070691_10051095 Ga0070691_100510952 239
393 3300005343 Ga0070687_100001061 Ga0070687_1000010616 239
394 3300005345 Ga0070692_10015733 Ga0070692_100157333 239
395 3300005347 Ga0070668_100010824 Ga0070668_1000108246 239
396 3300005353 Ga0070669_100027587 Ga0070669_1000275875 239
397 3300005355 Ga0070671_100023702 Ga0070671_1000237022 239
398 3300005366 Ga0070659_100034255 Ga0070659_1000342552 239
399 3300005438 Ga0070701_10023515 Ga0070701_100235153 239
400 3300005440 Ga0070705_100001556 Ga0070705_1000015567 239
401 3300005441 Ga0070700_100113060 Ga0070700_1001130602 239
402 3300005444 Ga0070694_100122034 Ga0070694_1001220341 239
403 3300005455 Ga0070663_100001684 Ga0070663_1000016845 239
404 3300005456 Ga0070678_100006807 Ga0070678_1000068072 239
405 3300005458 Ga0070681_10328360 Ga0070681_103283602 239
406 3300005466 Ga0070685_10012897 Ga0070685_100128972 239
407 3300005543 Ga0070672_100003792 Ga0070672_1000037925 239
408 3300005545 Ga0070695_100025176 Ga0070695_1000251764 239
409 3300005563 Ga0068855_100090924 Ga0068855_1000909245 239
410 3300005564 Ga0070664_100092755 Ga0070664_1000927554 239
411 3300005577 Ga0068857_100001320 Ga0068857_10000132017 239
412 3300005578 Ga0068854_100000693 Ga0068854_10000069315 239
413 3300005614 Ga0068856_100045174 Ga0068856_1000451742 239
414 3300005616 Ga0068852_100000255 Ga0068852_10000025532 239
415 3300005617 Ga0068859_100177798 Ga0068859_1001777982 239
416 3300005618 Ga0068864_100018377 Ga0068864_1000183772 239
417 3300005718 Ga0068866_10002275 Ga0068866_100022755 239
418 3300005719 Ga0068861_100000549 Ga0068861_10000054924 239
419 3300005834 Ga0068851_10013250 Ga0068851_100132505 239
420 3300005840 Ga0068870_10006180 Ga0068870_100061806 239
421 3300005841 Ga0068863_100028593 Ga0068863_1000285932 239
422 3300005842 Ga0068858_100104856 Ga0068858_1001048562 239
423 3300005843 Ga0068860_100466955 Ga0068860_1004669552 239
424 3300005844 Ga0068862_100011446 Ga0068862_1000114466 239
425 3300006358 Ga0068871_100015707 Ga0068871_1000157074 239
426 3300006881 Ga0068865_100026822 Ga0068865_1000268222 239
427 3300006931 Ga0097620_100177796 Ga0097620_1001777963 239
428 3300009093 Ga0105240_10247972 Ga0105240_102479721 239
429 3300009098 Ga0105245_10000482 Ga0105245_1000048231 239
430 3300009101 Ga0105247_10000388 Ga0105247_1000038838 239
431 3300009148 Ga0105243_10011190 Ga0105243_100111906 239
432 3300009174 Ga0105241_10021871 Ga0105241_100218716 239
433 3300009176 Ga0105242_10004528 Ga0105242_100045282 239
434 3300009177 Ga0105248_10069953 Ga0105248_100699532 239
435 3300009545 Ga0105237_10264859 Ga0105237_102648592 239
436 3300009551 Ga0105238_10085984 Ga0105238_100859842 239
437 3300009553 Ga0105249_10002683 Ga0105249_1000268313 239
438 3300010375 Ga0105239_10016952 Ga0105239_100169526 239
439 3300011119 Ga0105246_10006498 Ga0105246_100064984 239
440 3300013100 Ga0157373_10015100 Ga0157373_100151003 239
441 3300013102 Ga0157371_10111640 Ga0157371_101116403 239
442 3300013105 Ga0157369_10009916 Ga0157369_1000991611 239
443 3300013296 Ga0157374_10008067 Ga0157374_100080671 239
444 3300013297 Ga0157378_10025219 Ga0157378_100252196 239
445 3300013308 Ga0157375_10057101 Ga0157375_100571015 239
446 3300014325 Ga0163163_10106936 Ga0163163_101069363 239
447 3300014326 Ga0157380_10010889 Ga0157380_100108892 239
448 3300014745 Ga0157377_10000443 Ga0157377_100004436 239
449 3300014968 Ga0157379_10005394 Ga0157379_100053941 239
450 3300014969 Ga0157376_10002049 Ga0157376_100020496 239
451 3300017792 Ga0163161_10001181 Ga0163161_1000118113 239
452 3300025315 Ga0207697_10000176 Ga0207697_1000017623 239
453 3300025321 Ga0207656_10002891 Ga0207656_100028916 239
454 3300025901 Ga0207688_10000191 Ga0207688_100001916 239
455 3300025904 Ga0207647_10006169 Ga0207647_100061697 239
456 3300025907 Ga0207645_10000066 Ga0207645_1000006661 239
457 3300025908 Ga0207643_10000020 Ga0207643_1000002061 239
458 3300025909 Ga0207705_10018250 Ga0207705_100182505 239
459 3300025911 Ga0207654_10021724 Ga0207654_100217241 239
460 3300025914 Ga0207671_10034477 Ga0207671_100344772 239
461 3300025916 Ga0207663_10318508 Ga0207663_103185081 239
462 3300025918 Ga0207662_10000017 Ga0207662_1000001720 239
463 3300025919 Ga0207657_10000040 Ga0207657_10000040103 239
464 3300025923 Ga0207681_10002562 Ga0207681_100025628 239
465 3300025924 Ga0207694_10060942 Ga0207694_100609424 239
466 3300025925 Ga0207650_10008474 Ga0207650_100084745 239
467 3300025926 Ga0207659_10007637 Ga0207659_100076372 239
468 3300025933 Ga0207706_10001297 Ga0207706_1000129726 239
469 3300025935 Ga0207709_10067230 Ga0207709_100672303 239
470 3300025938 Ga0207704_10018664 Ga0207704_100186643 239
471 3300025940 Ga0207691_10000207 Ga0207691_100002076 239
472 3300025942 Ga0207689_10000549 Ga0207689_1000054935 239
473 3300025945 Ga0207679_10007305 Ga0207679_100073055 239
474 3300025945 Ga0207679_10032232 Ga0207679_100322323 239
475 3300025972 Ga0207668_10286399 Ga0207668_102863992 239
476 3300025981 Ga0207640_10012732 Ga0207640_100127323 239
477 3300025986 Ga0207658_10013513 Ga0207658_100135133 239
478 3300026023 Ga0207677_10001096 Ga0207677_1000109614 239
479 3300026035 Ga0207703_10000296 Ga0207703_1000029627 239
480 3300026067 Ga0207678_10000845 Ga0207678_1000084520 239
481 3300026075 Ga0207708_10031633 Ga0207708_100316332 239
482 3300026088 Ga0207641_10014849 Ga0207641_100148494 239
483 3300026089 Ga0207648_10081976 Ga0207648_100819762 239
484 3300026095 Ga0207676_10000402 Ga0207676_1000040231 239
485 3300026116 Ga0207674_10001435 Ga0207674_1000143528 239
486 3300026116 Ga0207674_10015980 Ga0207674_100159804 239
487 3300026118 Ga0207675_100000191 Ga0207675_10000019157 239
488 3300026121 Ga0207683_10000081 Ga0207683_1000008157 239
489 3300028379 Ga0268266_10001053 Ga0268266_100010536 239
490 3300028381 Ga0268264_10015314 Ga0268264_100153146 239
491 3300035691 Ga0373931_0286835 Ga0373931_0286835_105_902 239
492 3300048906 Ga0496103_0259469 Ga0496103_0259469_82_855 239
493 3300048909 Ga0496106_0017492 Ga0496106_0017492_786_1559 239
494 3300048915 Ga0496112_0036484 Ga0496112_0036484_32_805 239

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ek2-assembly1.cif.gz_A cryo-em structure of vccn1 in lipid nanodisc 0.7573 30 238
7pl9-assembly1.cif.gz_A cryo-em structure of bestrhodopsin (rhodopsin-rhodopsin-bestrophin) complex 0.7367 4 238
6iv1-assembly1.cif.gz_E crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation i180t 0.7252 26 238
7pl9-assembly1.cif.gz_A cryo-em structure of bestrhodopsin (rhodopsin-rhodopsin-bestrophin) complex 0.7238 4 238
6ivo-assembly1.cif.gz_C crystal structure of a membrane protein p208a 0.7228 26 236
ID Description Score Start End Superfamily
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.6525 51 153 1.20.1440.60
af_Q8CD92_752_847_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.6491 80 153 1.10.287.1060
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.618 51 153 1.20.1440.60
af_Q6K8B0_32_156_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6133 40 140 1.20.140.40
af_Q561T9_7_123_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5903 57 157 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A4Y9EQA4-F1-model_v4 DUF4239 domain-containing protein 0.9466 7 238 GO:0016020
AF-A0A3B8Q4I8-F1-model_v4 DUF4239 domain-containing protein 0.9404 54 239 GO:0016020
AF-A0A7Y7SUU4-F1-model_v4 DUF4239 domain-containing protein 0.9397 33 162
AF-A0A3A8LLL0-F1-model_v4 DUF4239 domain-containing protein 0.9387 6 239 GO:0016020
AF-R8AUJ9-F1-model_v4 DUF4239 domain-containing protein 0.9359 6 238 GO:0016020

Feature Viewer

pLDDT pTM Quality
76.76 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map