F454531

General Info

Members Datasets Scaffolds Average Seq Length
494 202 988 194

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100054812|Ga0070714_1000548122
Length 217
Sequence MSRRMIRTQPHSGGWLEVVCGPMFSGKSEELIRRLRRAEIAGQRALIVKPLIDDRYDVGHVVSHAGAKMRAVTASSGDEVRRLAAGYDAIGIDEVQFFDDSIVDAIGVLVADGARVVAAGLAQDFRGLPFASMPTLLCVAEFVDKLEAVCHRCGGPATMTQRLVDGHPAPFGGETIQVGALDSYEARCRACFEPGADAASGLERSRAATGVRHLQGV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 2.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.1
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 6.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100054812 3300005435 Bacteria 3407
2 Ga0070658_10200388 3300005327 Bacteria 1684
3 Ga0070683_100001807 3300005329 Bacteria 16677
4 Ga0070683_100097045 3300005329 Bacteria 2772
5 Ga0070683_100099074 3300005329 Bacteria 2743
6 Ga0070683_100129387 3300005329 Bacteria 2388
7 Ga0070683_100377448 3300005329 Bacteria 1351
8 Ga0070683_100559401 3300005329 Bacteria 1094
9 Ga0070680_100008062 3300005336 Bacteria 8043
10 Ga0070680_100115943 3300005336 Bacteria 2232
11 Ga0070680_100466775 3300005336 Bacteria 1079
12 Ga0070660_100048764 3300005339 Bacteria 3253
13 Ga0070660_100083647 3300005339 Bacteria 2507
14 Ga0070660_100445740 3300005339 Unclassified 1073
15 Ga0070661_100023810 3300005344 Bacteria 4392
16 Ga0070661_100060491 3300005344 Bacteria 2779
17 Ga0070661_100596259 3300005344 Bacteria 893
18 Ga0070671_100014845 3300005355 Bacteria 6292
19 Ga0070659_100078442 3300005366 Bacteria 2635
20 Ga0070667_100003479 3300005367 Bacteria 13421
21 Ga0070714_100060141 3300005435 Bacteria 3260
22 Ga0070714_100365255 3300005435 Bacteria 1358
23 Ga0070714_100944879 3300005435 Archaea 838
24 Ga0070713_101034425 3300005436 Bacteria 793
25 Ga0070705_100276801 3300005440 Bacteria 1191
26 Ga0070708_100003802 3300005445 Bacteria 11842
27 Ga0070681_10025296 3300005458 Bacteria 5971
28 Ga0070681_10087598 3300005458 Bacteria 3066
29 Ga0070681_10401191 3300005458 Bacteria 1282
30 Ga0070681_10424983 3300005458 Bacteria 1241
31 Ga0070707_100209773 3300005468 Bacteria 1899
32 Ga0070707_100294839 3300005468 Bacteria 1576
33 Ga0070679_100009551 3300005530 Bacteria 9176
34 Ga0070679_100012845 3300005530 Bacteria 8014
35 Ga0070679_100024215 3300005530 Bacteria 5949
36 Ga0070679_100037712 3300005530 Bacteria 4802
37 Ga0070679_100051017 3300005530 Bacteria 4120
38 Ga0070679_100111818 3300005530 Bacteria 2717
39 Ga0070679_100323999 3300005530 Bacteria 1490
40 Ga0070679_100726668 3300005530 Bacteria 936
41 Ga0070684_100028772 3300005535 Bacteria 4702
42 Ga0070684_100045768 3300005535 Bacteria 3789
43 Ga0070684_100077865 3300005535 Bacteria 2929
44 Ga0070684_100198805 3300005535 Unclassified 1825
45 Ga0070665_100098664 3300005548 Bacteria 2926
46 Ga0068855_100044678 3300005563 Bacteria 5242
47 Ga0068855_100090340 3300005563 Bacteria 3535
48 Ga0068855_100099066 3300005563 Bacteria 3357
49 Ga0068855_100135068 3300005563 Bacteria 2815
50 Ga0068855_100251059 3300005563 Bacteria 1973
51 Ga0068855_100566236 3300005563 Bacteria 1228
52 Ga0068855_100580782 3300005563 Unclassified 1210
53 Ga0068857_100042464 3300005577 Bacteria 4034
54 Ga0068857_100108493 3300005577 Bacteria 2494
55 Ga0068856_100166482 3300005614 Bacteria 2215
56 Ga0068852_100053791 3300005616 Bacteria 3467
57 Ga0068852_100065101 3300005616 Bacteria 3179
58 Ga0068852_100067018 3300005616 Bacteria 3138
59 Ga0068863_100735469 3300005841 Bacteria 982
60 Ga0081538_10175562 3300005981 Bacteria 926
61 Ga0081539_10009341 3300005985 Bacteria 8227
62 Ga0081539_10072079 3300005985 Bacteria 1848
63 Ga0070715_10333661 3300006163 Bacteria 822
64 Ga0097621_100081251 3300006237 Bacteria 2697
65 Ga0068871_100163902 3300006358 Bacteria 1902
66 Ga0075433_10618833 3300006852 Bacteria 950
67 Ga0075434_100057628 3300006871 Bacteria 3861
68 Ga0105240_10217827 3300009093 Bacteria 2226
69 Ga0105240_10449767 3300009093 Bacteria 1442
70 Ga0105240_10863513 3300009093 Bacteria 976
71 Ga0105240_11119747 3300009093 Bacteria 837
72 Ga0105240_11616417 3300009093 Bacteria 678
73 Ga0111539_10231963 3300009094 Bacteria 2149
74 Ga0105245_10322292 3300009098 Bacteria 1523
75 Ga0114129_10504091 3300009147 Bacteria 1580
76 Ga0105243_10298883 3300009148 Bacteria 1458
77 Ga0105241_10431883 3300009174 Bacteria 1161
78 Ga0105248_10206033 3300009177 Bacteria 2216
79 Ga0105237_10121494 3300009545 Bacteria 2606
80 Ga0105237_10240200 3300009545 Bacteria 1813
81 Ga0105238_10130629 3300009551 Bacteria 2490
82 Ga0105238_10172923 3300009551 Bacteria 2136
83 Ga0105238_11574225 3300009551 Bacteria 687
84 Ga0105239_10290144 3300010375 Bacteria 1842
85 Ga0157373_10106896 3300013100 Bacteria 1967
86 Ga0157373_10289164 3300013100 Bacteria 1162
87 Ga0157371_10518307 3300013102 Bacteria 882
88 Ga0157370_10041125 3300013104 Bacteria 4462
89 Ga0157370_10050718 3300013104 Bacteria 3966
90 Ga0157370_10084829 3300013104 Bacteria 2976
91 Ga0157370_10113726 3300013104 Bacteria 2529
92 Ga0157370_10132960 3300013104 Bacteria 2320
93 Ga0157369_10018017 3300013105 Bacteria 7923
94 Ga0157369_10033417 3300013105 Bacteria 5653
95 Ga0157369_10039970 3300013105 Bacteria 5124
96 Ga0157369_10089947 3300013105 Bacteria 3278
97 Ga0157369_10090269 3300013105 Bacteria 3271
98 Ga0157369_10107976 3300013105 Bacteria 2960
99 Ga0157369_10399117 3300013105 Bacteria 1427
100 Ga0157374_10296980 3300013296 Bacteria 1598
101 Ga0157372_10015441 3300013307 Bacteria 8184
102 Ga0157372_10287164 3300013307 Unclassified 1913
103 Ga0157372_10487018 3300013307 Bacteria 1438
104 Ga0157372_10538662 3300013307 Bacteria 1361
105 Ga0157375_10505274 3300013308 Bacteria 1373
106 Ga0197907_11071946 3300020069 Bacteria 1416
107 Ga0206356_10188404 3300020070 Bacteria 2366
108 Ga0206354_10510069 3300020081 Bacteria 1796
109 Ga0206354_10573593 3300020081 Bacteria 2124
110 Ga0206354_10731679 3300020081 Bacteria 2386
111 Ga0206354_11592352 3300020081 Bacteria 3208
112 Ga0206353_10279790 3300020082 Bacteria 1570
113 Ga0206353_10481377 3300020082 Bacteria 1274
114 Ga0206353_10543901 3300020082 Bacteria 811
115 Ga0206353_10701498 3300020082 Bacteria 3985
116 Ga0206353_11321477 3300020082 Bacteria 2333
117 Ga0213876_10230335 3300021384 Bacteria 985
118 Ga0207692_10203843 3300025898 Bacteria 1164
119 Ga0207705_10086265 3300025909 Bacteria 2294
120 Ga0207707_10011760 3300025912 Bacteria 7615
121 Ga0207707_10030449 3300025912 Bacteria 4721
122 Ga0207707_10188603 3300025912 Bacteria 1799
123 Ga0207707_10285189 3300025912 Bacteria 1429
124 Ga0207707_10505213 3300025912 Bacteria 1031
125 Ga0207707_10586300 3300025912 Bacteria 945
126 Ga0207695_10275202 3300025913 Bacteria 1578
127 Ga0207671_10034598 3300025914 Bacteria 3753
128 Ga0207671_10311341 3300025914 Bacteria 1245
129 Ga0207693_10187916 3300025915 Bacteria 1626
130 Ga0207660_10032289 3300025917 Bacteria 3613
131 Ga0207657_10000220 3300025919 Bacteria 59453
132 Ga0207657_10011970 3300025919 Bacteria 8582
133 Ga0207657_10021109 3300025919 Bacteria 6135
134 Ga0207657_10057429 3300025919 Bacteria 3353
135 Ga0207657_10179712 3300025919 Bacteria 1711
136 Ga0207657_10277544 3300025919 Bacteria 1331
137 Ga0207649_10019867 3300025920 Bacteria 3845
138 Ga0207649_10081545 3300025920 Bacteria 2095
139 Ga0207649_10091392 3300025920 Bacteria 1993
140 Ga0207652_10066323 3300025921 Bacteria 3128
141 Ga0207652_10198083 3300025921 Unclassified 1807
142 Ga0207652_10306400 3300025921 Bacteria 1433
143 Ga0207652_10591684 3300025921 Bacteria 995
144 Ga0207694_10296615 3300025924 Bacteria 1330
145 Ga0207664_10032094 3300025929 Bacteria 4024
146 Ga0207690_10219815 3300025932 Unclassified 1453
147 Ga0207709_10349218 3300025935 Bacteria 1116
148 Ga0207711_10119543 3300025941 Bacteria 2351
149 Ga0207661_10055259 3300025944 Bacteria 3184
150 Ga0207661_10185480 3300025944 Bacteria 1820
151 Ga0207661_10351320 3300025944 Bacteria 1330
152 Ga0207661_10458634 3300025944 Bacteria 1161
153 Ga0207667_10037648 3300025949 Bacteria 5170
154 Ga0207667_10171608 3300025949 Bacteria 2229
155 Ga0207667_10197548 3300025949 Bacteria 2063
156 Ga0207667_10338533 3300025949 Bacteria 1535
157 Ga0207667_10465023 3300025949 Bacteria 1285
158 Ga0207658_10028091 3300025986 Bacteria 3959
159 Ga0207639_10394571 3300026041 Bacteria 1245
160 Ga0207702_10960734 3300026078 Bacteria 847
161 Ga0207674_10028737 3300026116 Bacteria 5865
162 Ga0207674_10062027 3300026116 Bacteria 3776
163 Ga0207698_10066799 3300026142 Bacteria 2832
164 Ga0207698_10265760 3300026142 Bacteria 1578
165 Ga0265318_10014233 3300028577 Bacteria 3343
166 Ga0265318_10031651 3300028577 Bacteria 2051
167 Ga0265322_10007378 3300028654 Bacteria 3212
168 Ga0265338_10002978 3300028800 Bacteria 24543
169 Ga0265338_10108505 3300028800 Bacteria 2242
170 Ga0265338_10159372 3300028800 Bacteria 1744
171 Ga0265338_10237021 3300028800 Bacteria 1353
172 Ga0265338_10238651 3300028800 Bacteria 1348
173 Ga0265330_10011338 3300031235 Bacteria 4183
174 Ga0265330_10014318 3300031235 Bacteria 3682
175 Ga0265332_10113169 3300031238 Bacteria 1142
176 Ga0265328_10097392 3300031239 Bacteria 1088
177 Ga0265320_10007997 3300031240 Bacteria 6510
178 Ga0265320_10024359 3300031240 Bacteria 3202
179 Ga0265320_10060335 3300031240 Bacteria 1811
180 Ga0265325_10022339 3300031241 Bacteria 3467
181 Ga0265329_10017562 3300031242 Bacteria 2459
182 Ga0265340_10023794 3300031247 Bacteria 3119
183 Ga0265340_10041899 3300031247 Bacteria 2249
184 Ga0265340_10052439 3300031247 Bacteria 1973
185 Ga0265331_10040356 3300031250 Bacteria 2271
186 Ga0265327_10009637 3300031251 Bacteria 6933
187 Ga0265327_10039061 3300031251 Archaea 2581
188 Ga0265327_10045473 3300031251 Bacteria 2332
189 Ga0265327_10061062 3300031251 Bacteria 1924
190 Ga0265327_10074326 3300031251 Bacteria 1693
191 Ga0265316_10070877 3300031344 Bacteria 2687
192 Ga0265316_10256844 3300031344 Bacteria 1282
193 Ga0265313_10005636 3300031595 Bacteria 9149
194 Ga0265313_10216625 3300031595 Bacteria 791
195 Ga0265314_10021188 3300031711 Bacteria 5005
196 Ga0265314_10032464 3300031711 Bacteria 3840
197 Ga0265314_10210936 3300031711 Bacteria 1140
198 Ga0265342_10008406 3300031712 Bacteria 7401
199 Ga0373944_0026290 3300035089 Bacteria 1718
200 Ga0373944_0124213 3300035089 Unclassified 892
201 Ga0373923_0156131 3300035111 Bacteria 1039
202 Ga0373936_0015282 3300035113 Bacteria 2941
203 Ga0373936_0377806 3300035113 Bacteria 648
204 Ga0373945_0001908 3300035116 Bacteria 6467
205 Ga0373957_0146422 3300035120 Unclassified 968
206 Ga0373943_0000138 3300035170 Bacteria 27619
207 Ga0373943_0009830 3300035170 Bacteria 4283
208 Ga0373946_0098931 3300035171 Unclassified 1305
209 Ga0373935_0022178 3300035692 Bacteria 3892
210 Ga0373935_0038446 3300035692 Bacteria 2997
211 Ga0373927_0003815 3300035695 Bacteria 10696
212 Ga0373927_0225765 3300035695 Unclassified 1230
213 Ga0373947_0000341 3300035725 Bacteria 26341
214 Ga0373947_0004021 3300035725 Bacteria 8639
215 Ga0373947_0012643 3300035725 Bacteria 4840
216 Ga0373937_0116510 3300036401 Bacteria 2488
217 Ga0373925_0004659 3300037068 Bacteria 10346
218 Ga0373925_0008354 3300037068 Bacteria 7538
219 Ga0395899_0009604 3300037312 Bacteria 7424
220 Ga0395899_0044581 3300037312 Bacteria 3305
221 Ga0395899_0182428 3300037312 Bacteria 1473
222 Ga0395899_0491905 3300037312 Bacteria 797
223 Ga0395900_0004292 3300037418 Bacteria 15113
224 Ga0395900_0151699 3300037418 Bacteria 2367
225 Ga0395900_0207948 3300037418 Bacteria 1977
226 Ga0395900_0573929 3300037418 Bacteria 1070
227 Ga0395898_0006291 3300037466 Bacteria 12692
228 Ga0395898_0080491 3300037466 Bacteria 3141
229 Ga0395898_0106141 3300037466 Bacteria 2694
230 Ga0395898_0317898 3300037466 Bacteria 1485
231 Ga0395898_0880489 3300037466 Bacteria 834
232 Ga0395898_0969217 3300037466 Archaea 787
233 Ga0395905_0016516 3300037471 Bacteria 7017
234 Ga0395905_0232476 3300037471 Bacteria 1724
235 Ga0395905_0808718 3300037471 Bacteria 840
236 Ga0395901_0033042 3300038443 Bacteria 5339
237 Ga0395901_0045919 3300038443 Bacteria 4535
238 Ga0395901_0075546 3300038443 Bacteria 3514
239 Ga0395901_0174599 3300038443 Bacteria 2254
240 Ga0395901_0306557 3300038443 Bacteria 1645
241 Ga0395901_0363370 3300038443 Bacteria 1492
242 Ga0395901_0427393 3300038443 Bacteria 1357
243 Ga0395901_0723953 3300038443 Unclassified 990
244 Ga0395901_0900009 3300038443 Bacteria 867
245 Ga0395901_1117559 3300038443 Bacteria 758
246 Ga0395901_1200848 3300038443 Bacteria 724
247 Ga0436365_0501194 3300039437 Bacteria 3913
248 Ga0436365_1546103 3300039437 Bacteria 838
249 Ga0436365_1933951 3300039437 Bacteria 2889
250 Ga0436360_0515323 3300039438 Bacteria 1147
251 Ga0436363_0560811 3300039450 Bacteria 1106
252 Ga0466969_0186144 3300044656 Bacteria 950
253 Ga0466965_0190490 3300044683 Bacteria 1085
254 Ga0466966_0004970 3300044684 Bacteria 8740
255 Ga0466966_0046990 3300044684 Bacteria 2754
256 Ga0466966_0111020 3300044684 Bacteria 1690
257 Ga0466966_0139903 3300044684 Bacteria 1479
258 Ga0466966_0168430 3300044684 Bacteria 1332
259 Ga0466966_0283575 3300044684 Bacteria 996
260 Ga0466961_0001191 3300044693 Bacteria 16033
261 Ga0466961_0038511 3300044693 Bacteria 3067
262 Ga0466963_0003754 3300044694 Bacteria 8746
263 Ga0466963_0007957 3300044694 Bacteria 6346
264 Ga0466963_0016818 3300044694 Bacteria 4553
265 Ga0466963_0021451 3300044694 Bacteria 4076
266 Ga0466963_0021721 3300044694 Bacteria 4053
267 Ga0466963_0141401 3300044694 Bacteria 1667
268 Ga0466963_0362260 3300044694 Bacteria 1021
269 Ga0466963_0438362 3300044694 Bacteria 921
270 Ga0466963_0473786 3300044694 Unclassified 884
271 Ga0466964_0010122 3300044706 Bacteria 3554
272 Ga0466964_0029098 3300044706 Bacteria 2179
273 Ga0466964_0050174 3300044706 Bacteria 1710
274 Ga0466964_0063683 3300044706 Bacteria 1541
275 Ga0466964_0181316 3300044706 Bacteria 999
276 Ga0466971_0005761 3300044719 Bacteria 5387
277 Ga0466971_0012755 3300044719 Bacteria 3686
278 Ga0466971_0350522 3300044719 Bacteria 714
279 Ga0466968_0060107 3300044735 Bacteria 1638
280 Ga0466970_0063919 3300044765 Bacteria 1973
281 Ga0466957_0001822 3300044842 Bacteria 11234
282 Ga0466957_0187521 3300044842 Bacteria 1353
283 Ga0466957_0498728 3300044842 Unclassified 844
284 Ga0466957_0707935 3300044842 Bacteria 711
285 Ga0466960_0206545 3300044901 Bacteria 1075
286 Ga0466959_0010048 3300045049 Bacteria 6746
287 Ga0466959_0014922 3300045049 Bacteria 5660
288 Ga0466959_0043506 3300045049 Bacteria 3311
289 Ga0466959_0084687 3300045049 Bacteria 2282
290 Ga0466959_0185011 3300045049 Bacteria 1456
291 Ga0451576_0094470 3300045051 Bacteria 3110
292 Ga0466958_0003033 3300045836 Bacteria 8606
293 Ga0466958_0028003 3300045836 Bacteria 3338
294 Ga0466958_0041178 3300045836 Bacteria 2778
295 Ga0466958_0119511 3300045836 Bacteria 1649
296 Ga0466958_0126096 3300045836 Bacteria 1605
297 Ga0466967_0001203 3300045976 Bacteria 14562
298 Ga0466967_0004063 3300045976 Bacteria 9766
299 Ga0466967_0035285 3300045976 Bacteria 4255
300 Ga0466967_0042440 3300045976 Bacteria 3931
301 Ga0466967_0046136 3300045976 Bacteria 3792
302 Ga0466967_0048222 3300045976 Bacteria 3718
303 Ga0466967_0101280 3300045976 Bacteria 2633
304 Ga0466967_0101780 3300045976 Bacteria 2626
305 Ga0466967_0136250 3300045976 Bacteria 2283
306 Ga0466967_0153087 3300045976 Bacteria 2157
307 Ga0466967_0337541 3300045976 Bacteria 1456
308 Ga0466967_0358489 3300045976 Unclassified 1412
309 Ga0466967_0487322 3300045976 Bacteria 1208
310 Ga0466967_0495310 3300045976 Unclassified 1199
311 Ga0466967_0607936 3300045976 Bacteria 1079
312 Ga0466967_0767138 3300045976 Bacteria 957
313 Ga0466967_0772684 3300045976 Bacteria 953
314 Ga0466967_0819459 3300045976 Bacteria 924
315 Ga0466967_0855481 3300045976 Unclassified 904
316 Ga0495592_0061768 3300046454 Bacteria 2753
317 Ga0495592_0082695 3300046454 Bacteria 2320
318 Ga0495592_0376210 3300046454 Bacteria 905
319 Ga0495629_0017675 3300046459 Bacteria 5111
320 Ga0495629_0285261 3300046459 Bacteria 1132
321 Ga0495641_0000345 3300046461 Bacteria 38081
322 Ga0495641_0009360 3300046461 Bacteria 5826
323 Ga0495641_0015766 3300046461 Bacteria 4012
324 Ga0495651_0022226 3300046462 Bacteria 4931
325 Ga0495651_0042714 3300046462 Bacteria 3519
326 Ga0495651_0140802 3300046462 Bacteria 1749
327 Ga0495653_0038069 3300046463 Unclassified 3776
328 Ga0495582_0001048 3300046473 Bacteria 15517
329 Ga0495582_0022377 3300046473 Bacteria 3459
330 Ga0495582_0065907 3300046473 Unclassified 2001
331 Ga0495582_0229417 3300046473 Bacteria 1063
332 Ga0495639_0003743 3300046475 Bacteria 6543
333 Ga0495662_0000116 3300046476 Bacteria 30019
334 Ga0495664_0089826 3300046477 Bacteria 1847
335 Ga0495664_0417547 3300046477 Bacteria 805
336 Ga0495594_0419287 3300046499 Bacteria 761
337 Ga0495608_0051001 3300046511 Bacteria 2744
338 Ga0495618_0107207 3300046514 Unclassified 1789
339 Ga0495628_0125254 3300046516 Bacteria 1969
340 Ga0495628_0198072 3300046516 Bacteria 1514
341 Ga0495628_0221699 3300046516 Unclassified 1420
342 Ga0495628_0507514 3300046516 Bacteria 870
343 Ga0495628_0733694 3300046516 Bacteria 695
344 Ga0495630_0048680 3300046517 Bacteria 3172
345 Ga0495630_0074004 3300046517 Bacteria 2565
346 Ga0495630_0688160 3300046517 Bacteria 782
347 Ga0495666_0047266 3300046526 Bacteria 2073
348 Ga0495666_0157013 3300046526 Bacteria 1056
349 Ga0495666_0354301 3300046526 Bacteria 661
350 Ga0495652_0121189 3300046529 Bacteria 2086
351 Ga0495652_0182347 3300046529 Bacteria 1609
352 Ga0495652_0185991 3300046529 Bacteria 1589
353 Ga0495652_0258367 3300046529 Bacteria 1287
354 Ga0495652_0637820 3300046529 Bacteria 723
355 Ga0495665_0003303 3300046531 Bacteria 8738
356 Ga0495640_0017059 3300046533 Bacteria 5419
357 Ga0495640_0202810 3300046533 Bacteria 1256
358 Ga0495640_0205879 3300046533 Unclassified 1245
359 Ga0495587_0029904 3300046536 Bacteria 3305
360 Ga0495587_0095635 3300046536 Unclassified 1714
361 Ga0495645_0043901 3300046543 Bacteria 3261
362 Ga0495667_0003955 3300046559 Bacteria 9943
363 Ga0495667_0035392 3300046559 Bacteria 3337
364 Ga0495667_0096242 3300046559 Bacteria 1916
365 Ga0495667_0140320 3300046559 Bacteria 1557
366 Ga0495667_0275461 3300046559 Unclassified 1068
367 Ga0495667_0382739 3300046559 Unclassified 887
368 Ga0495634_0030112 3300046642 Bacteria 3751
369 Ga0495634_0301483 3300046642 Unclassified 968
370 Ga0495635_0039992 3300046663 Bacteria 3242
371 Ga0495635_0044977 3300046663 Bacteria 3046
372 Ga0495588_0278063 3300046674 Bacteria 882
373 Ga0495657_0074236 3300046675 Bacteria 2213
374 Ga0495599_0047949 3300046678 Bacteria 2678
375 Ga0495599_0215204 3300046678 Bacteria 1177
376 Ga0495599_0626565 3300046678 Bacteria 625
377 Ga0495623_0230290 3300046679 Bacteria 1051
378 Ga0495623_0454313 3300046679 Bacteria 682
379 Ga0495647_0009112 3300046681 Bacteria 3352
380 Ga0495647_0227968 3300046681 Bacteria 824
381 Ga0495658_0011968 3300046683 Bacteria 4379
382 Ga0495658_0021045 3300046683 Bacteria 3433
383 Ga0495658_0110976 3300046683 Bacteria 1649
384 Ga0495658_0296685 3300046683 Bacteria 1022
385 Ga0495613_0001439 3300046689 Bacteria 18178
386 Ga0495624_0009546 3300046690 Bacteria 6717
387 Ga0495624_0248864 3300046690 Bacteria 1075
388 Ga0495624_0413642 3300046690 Bacteria 809
389 Ga0495600_0007507 3300046809 Bacteria 6674
390 Ga0495600_0049731 3300046809 Bacteria 2735
391 Ga0495581_0066964 3300047315 Unclassified 2076
392 Ga0495604_0062247 3300047317 Bacteria 2852
393 Ga0495604_0147550 3300047317 Bacteria 1675
394 Ga0495604_0247647 3300047317 Bacteria 1216
395 Ga0495604_0249857 3300047317 Bacteria 1209
396 Ga0495674_0003918 3300047319 Bacteria 14455
397 Ga0495674_0022551 3300047319 Bacteria 5807
398 Ga0495674_0031586 3300047319 Bacteria 4810
399 Ga0495674_0071459 3300047319 Unclassified 2995
400 Ga0495676_0007504 3300047321 Bacteria 10004
401 Ga0495676_0036163 3300047321 Bacteria 4126
402 Ga0495676_0314665 3300047321 Bacteria 1053
403 Ga0495680_0010814 3300047322 Bacteria 8126
404 Ga0495680_0062623 3300047322 Bacteria 2859
405 Ga0495680_0122630 3300047322 Bacteria 1917
406 Ga0495675_0168548 3300047444 Bacteria 1346
407 Ga0495675_0237074 3300047444 Unclassified 1099
408 Ga0495684_0038592 3300047471 Bacteria 3661
409 Ga0495684_0229601 3300047471 Bacteria 1358
410 Ga0495593_0001727 3300047673 Bacteria 12939
411 Ga0495593_0312655 3300047673 Bacteria 785
412 Ga0495602_0184382 3300048088 Bacteria 1606
413 Ga0495602_0188541 3300048088 Bacteria 1583
414 Ga0495602_0286094 3300048088 Bacteria 1212
415 Ga0495614_0006047 3300048089 Bacteria 5442
416 Ga0495614_0176098 3300048089 Bacteria 961
417 Ga0496100_0038848 3300048903 Bacteria 3019
418 Ga0496100_0160320 3300048903 Unclassified 1612
419 Ga0496100_0493409 3300048903 Bacteria 943
420 Ga0496101_0008244 3300048904 Bacteria 6803
421 Ga0496101_0017063 3300048904 Bacteria 4916
422 Ga0496101_0026910 3300048904 Bacteria 4000
423 Ga0496101_0155718 3300048904 Bacteria 1750
424 Ga0496101_0529001 3300048904 Bacteria 932
425 Ga0496102_0050710 3300048905 Bacteria 3780
426 Ga0496104_0085039 3300048907 Bacteria 3019
427 Ga0496104_0300939 3300048907 Bacteria 1516
428 Ga0496104_0613716 3300048907 Bacteria 998
429 Ga0496105_0053792 3300048908 Bacteria 3324
430 Ga0496105_0061986 3300048908 Bacteria 3086
431 Ga0496105_0322739 3300048908 Bacteria 1237
432 Ga0496106_0006436 3300048909 Bacteria 8695
433 Ga0496106_0300455 3300048909 Bacteria 1287
434 Ga0496107_0131320 3300048910 Bacteria 1849
435 Ga0496107_0532125 3300048910 Bacteria 871
436 Ga0496108_0228958 3300048911 Bacteria 1616
437 Ga0496109_0469105 3300048912 Unclassified 1189
438 Ga0496109_1006948 3300048912 Bacteria 771
439 Ga0496110_0359391 3300048913 Bacteria 1327
440 Ga0496111_0217074 3300048914 Bacteria 1421
441 Ga0496111_0278061 3300048914 Bacteria 1242
442 Ga0496112_0016656 3300048915 Bacteria 6891
443 Ga0496112_0017720 3300048915 Bacteria 6702
444 Ga0496112_0037993 3300048915 Bacteria 4700
445 Ga0496114_0022003 3300048917 Bacteria 5191
446 Ga0496114_0064559 3300048917 Bacteria 3066
447 Ga0496114_0122723 3300048917 Bacteria 2236
448 Ga0496114_0159090 3300048917 Bacteria 1963
449 Ga0496114_0270982 3300048917 Bacteria 1496
450 Ga0496114_0368543 3300048917 Bacteria 1271
451 Ga0496114_0489794 3300048917 Bacteria 1088
452 Ga0496115_0000517 3300048918 Bacteria 30033
453 Ga0496115_0048456 3300048918 Bacteria 3399
454 Ga0496115_0064622 3300048918 Bacteria 2954
455 Ga0496115_0097121 3300048918 Bacteria 2413
456 Ga0496115_0602436 3300048918 Unclassified 873
457 Ga0501034_0049014 3300049571 Bacteria 4263
458 Ga0501046_0889899 3300049580 Bacteria 621
459 Ga0501047_0029106 3300049581 Bacteria 5327
460 Ga0501047_0031270 3300049581 Bacteria 5134
461 Ga0501047_0114650 3300049581 Bacteria 2577
462 Ga0501067_0037015 3300049583 Bacteria 2710
463 Ga0501067_0314714 3300049583 Bacteria 872
464 Ga0501067_0322840 3300049583 Bacteria 860
465 Ga0501068_0143844 3300049584 Bacteria 1496
466 Ga0501069_0032375 3300049585 Bacteria 2877
467 Ga0501069_0041224 3300049585 Bacteria 2552
468 Ga0501069_0047612 3300049585 Bacteria 2380
469 Ga0501069_0052754 3300049585 Bacteria 2265
470 Ga0501069_0064220 3300049585 Bacteria 2052
471 Ga0501070_0001687 3300049586 Bacteria 19581
472 Ga0501070_0099653 3300049586 Bacteria 2404
473 Ga0501073_0449542 3300049589 Bacteria 891
474 Ga0501073_0719217 3300049589 Unclassified 689
475 Ga0501074_0051183 3300049590 Bacteria 2981
476 Ga0501074_0235592 3300049590 Bacteria 1303
477 Ga0501079_0206651 3300049741 Bacteria 1534
478 Ga0501079_0424397 3300049741 Bacteria 1044
479 Ga0501080_0118607 3300049742 Bacteria 2453
480 Ga0501080_0222391 3300049742 Bacteria 1727
481 Ga0501035_0374534 3300049822 Bacteria 1188
482 Ga0501044_0200919 3300049823 Bacteria 1952
483 nmdc:mga05p37_117696_c1 3300050507 Bacteria 3265
484 nmdc:mga0a205_24742_c1 3300050515 Bacteria 5712
485 Ga0495601_0202511 3300053077 Bacteria 1297
486 Ga0495601_0242155 3300053077 Bacteria 1177
487 Ga0495601_0316418 3300053077 Bacteria 1016
488 Ga0495612_0089463 3300053078 Bacteria 1301
489 Ga0495655_0003808 3300053083 Bacteria 2525
490 Ga0495595_0008308 3300053084 Bacteria 4262
491 Ga0495619_0034005 3300053085 Bacteria 3312
492 Ga0495619_0761195 3300053085 Bacteria 656
493 Ga0466962_0004093 3300061719 Bacteria 6985
494 Ga0530510_0012157 3300061734 Bacteria 6042
495 Ga0070714_100054812
496 Ga0070658_10200388
497 Ga0070683_100001807
498 Ga0070683_100097045
499 Ga0070683_100099074
500 Ga0070683_100129387
501 Ga0070683_100377448
502 Ga0070683_100559401
503 Ga0070680_100008062
504 Ga0070680_100115943
505 Ga0070680_100466775
506 Ga0070660_100048764
507 Ga0070660_100083647
508 Ga0070660_100445740
509 Ga0070661_100023810
510 Ga0070661_100060491
511 Ga0070661_100596259
512 Ga0070671_100014845
513 Ga0070659_100078442
514 Ga0070667_100003479
515 Ga0070714_100060141
516 Ga0070714_100365255
517 Ga0070714_100944879
518 Ga0070713_101034425
519 Ga0070705_100276801
520 Ga0070708_100003802
521 Ga0070681_10025296
522 Ga0070681_10087598
523 Ga0070681_10401191
524 Ga0070681_10424983
525 Ga0070707_100209773
526 Ga0070707_100294839
527 Ga0070679_100009551
528 Ga0070679_100012845
529 Ga0070679_100024215
530 Ga0070679_100037712
531 Ga0070679_100051017
532 Ga0070679_100111818
533 Ga0070679_100323999
534 Ga0070679_100726668
535 Ga0070684_100028772
536 Ga0070684_100045768
537 Ga0070684_100077865
538 Ga0070684_100198805
539 Ga0070665_100098664
540 Ga0068855_100044678
541 Ga0068855_100090340
542 Ga0068855_100099066
543 Ga0068855_100135068
544 Ga0068855_100251059
545 Ga0068855_100566236
546 Ga0068855_100580782
547 Ga0068857_100042464
548 Ga0068857_100108493
549 Ga0068856_100166482
550 Ga0068852_100053791
551 Ga0068852_100065101
552 Ga0068852_100067018
553 Ga0068863_100735469
554 Ga0081538_10175562
555 Ga0081539_10009341
556 Ga0081539_10072079
557 Ga0070715_10333661
558 Ga0097621_100081251
559 Ga0068871_100163902
560 Ga0075433_10618833
561 Ga0075434_100057628
562 Ga0105240_10217827
563 Ga0105240_10449767
564 Ga0105240_10863513
565 Ga0105240_11119747
566 Ga0105240_11616417
567 Ga0111539_10231963
568 Ga0105245_10322292
569 Ga0114129_10504091
570 Ga0105243_10298883
571 Ga0105241_10431883
572 Ga0105248_10206033
573 Ga0105237_10121494
574 Ga0105237_10240200
575 Ga0105238_10130629
576 Ga0105238_10172923
577 Ga0105238_11574225
578 Ga0105239_10290144
579 Ga0157373_10106896
580 Ga0157373_10289164
581 Ga0157371_10518307
582 Ga0157370_10041125
583 Ga0157370_10050718
584 Ga0157370_10084829
585 Ga0157370_10113726
586 Ga0157370_10132960
587 Ga0157369_10018017
588 Ga0157369_10033417
589 Ga0157369_10039970
590 Ga0157369_10089947
591 Ga0157369_10090269
592 Ga0157369_10107976
593 Ga0157369_10399117
594 Ga0157374_10296980
595 Ga0157372_10015441
596 Ga0157372_10287164
597 Ga0157372_10487018
598 Ga0157372_10538662
599 Ga0157375_10505274
600 Ga0197907_11071946
601 Ga0206356_10188404
602 Ga0206354_10510069
603 Ga0206354_10573593
604 Ga0206354_10731679
605 Ga0206354_11592352
606 Ga0206353_10279790
607 Ga0206353_10481377
608 Ga0206353_10543901
609 Ga0206353_10701498
610 Ga0206353_11321477
611 Ga0213876_10230335
612 Ga0207692_10203843
613 Ga0207705_10086265
614 Ga0207707_10011760
615 Ga0207707_10030449
616 Ga0207707_10188603
617 Ga0207707_10285189
618 Ga0207707_10505213
619 Ga0207707_10586300
620 Ga0207695_10275202
621 Ga0207671_10034598
622 Ga0207671_10311341
623 Ga0207693_10187916
624 Ga0207660_10032289
625 Ga0207657_10000220
626 Ga0207657_10011970
627 Ga0207657_10021109
628 Ga0207657_10057429
629 Ga0207657_10179712
630 Ga0207657_10277544
631 Ga0207649_10019867
632 Ga0207649_10081545
633 Ga0207649_10091392
634 Ga0207652_10066323
635 Ga0207652_10198083
636 Ga0207652_10306400
637 Ga0207652_10591684
638 Ga0207694_10296615
639 Ga0207664_10032094
640 Ga0207690_10219815
641 Ga0207709_10349218
642 Ga0207711_10119543
643 Ga0207661_10055259
644 Ga0207661_10185480
645 Ga0207661_10351320
646 Ga0207661_10458634
647 Ga0207667_10037648
648 Ga0207667_10171608
649 Ga0207667_10197548
650 Ga0207667_10338533
651 Ga0207667_10465023
652 Ga0207658_10028091
653 Ga0207639_10394571
654 Ga0207702_10960734
655 Ga0207674_10028737
656 Ga0207674_10062027
657 Ga0207698_10066799
658 Ga0207698_10265760
659 Ga0265318_10014233
660 Ga0265318_10031651
661 Ga0265322_10007378
662 Ga0265338_10002978
663 Ga0265338_10108505
664 Ga0265338_10159372
665 Ga0265338_10237021
666 Ga0265338_10238651
667 Ga0265330_10011338
668 Ga0265330_10014318
669 Ga0265332_10113169
670 Ga0265328_10097392
671 Ga0265320_10007997
672 Ga0265320_10024359
673 Ga0265320_10060335
674 Ga0265325_10022339
675 Ga0265329_10017562
676 Ga0265340_10023794
677 Ga0265340_10041899
678 Ga0265340_10052439
679 Ga0265331_10040356
680 Ga0265327_10009637
681 Ga0265327_10039061
682 Ga0265327_10045473
683 Ga0265327_10061062
684 Ga0265327_10074326
685 Ga0265316_10070877
686 Ga0265316_10256844
687 Ga0265313_10005636
688 Ga0265313_10216625
689 Ga0265314_10021188
690 Ga0265314_10032464
691 Ga0265314_10210936
692 Ga0265342_10008406
693 Ga0373944_0026290
694 Ga0373944_0124213
695 Ga0373923_0156131
696 Ga0373936_0015282
697 Ga0373936_0377806
698 Ga0373945_0001908
699 Ga0373957_0146422
700 Ga0373943_0000138
701 Ga0373943_0009830
702 Ga0373946_0098931
703 Ga0373935_0022178
704 Ga0373935_0038446
705 Ga0373927_0003815
706 Ga0373927_0225765
707 Ga0373947_0000341
708 Ga0373947_0004021
709 Ga0373947_0012643
710 Ga0373937_0116510
711 Ga0373925_0004659
712 Ga0373925_0008354
713 Ga0395899_0009604
714 Ga0395899_0044581
715 Ga0395899_0182428
716 Ga0395899_0491905
717 Ga0395900_0004292
718 Ga0395900_0151699
719 Ga0395900_0207948
720 Ga0395900_0573929
721 Ga0395898_0006291
722 Ga0395898_0080491
723 Ga0395898_0106141
724 Ga0395898_0317898
725 Ga0395898_0880489
726 Ga0395898_0969217
727 Ga0395905_0016516
728 Ga0395905_0232476
729 Ga0395905_0808718
730 Ga0395901_0033042
731 Ga0395901_0045919
732 Ga0395901_0075546
733 Ga0395901_0174599
734 Ga0395901_0306557
735 Ga0395901_0363370
736 Ga0395901_0427393
737 Ga0395901_0723953
738 Ga0395901_0900009
739 Ga0395901_1117559
740 Ga0395901_1200848
741 Ga0436365_0501194
742 Ga0436365_1546103
743 Ga0436365_1933951
744 Ga0436360_0515323
745 Ga0436363_0560811
746 Ga0466969_0186144
747 Ga0466965_0190490
748 Ga0466966_0004970
749 Ga0466966_0046990
750 Ga0466966_0111020
751 Ga0466966_0139903
752 Ga0466966_0168430
753 Ga0466966_0283575
754 Ga0466961_0001191
755 Ga0466961_0038511
756 Ga0466963_0003754
757 Ga0466963_0007957
758 Ga0466963_0016818
759 Ga0466963_0021451
760 Ga0466963_0021721
761 Ga0466963_0141401
762 Ga0466963_0362260
763 Ga0466963_0438362
764 Ga0466963_0473786
765 Ga0466964_0010122
766 Ga0466964_0029098
767 Ga0466964_0050174
768 Ga0466964_0063683
769 Ga0466964_0181316
770 Ga0466971_0005761
771 Ga0466971_0012755
772 Ga0466971_0350522
773 Ga0466968_0060107
774 Ga0466970_0063919
775 Ga0466957_0001822
776 Ga0466957_0187521
777 Ga0466957_0498728
778 Ga0466957_0707935
779 Ga0466960_0206545
780 Ga0466959_0010048
781 Ga0466959_0014922
782 Ga0466959_0043506
783 Ga0466959_0084687
784 Ga0466959_0185011
785 Ga0451576_0094470
786 Ga0466958_0003033
787 Ga0466958_0028003
788 Ga0466958_0041178
789 Ga0466958_0119511
790 Ga0466958_0126096
791 Ga0466967_0001203
792 Ga0466967_0004063
793 Ga0466967_0035285
794 Ga0466967_0042440
795 Ga0466967_0046136
796 Ga0466967_0048222
797 Ga0466967_0101280
798 Ga0466967_0101780
799 Ga0466967_0136250
800 Ga0466967_0153087
801 Ga0466967_0337541
802 Ga0466967_0358489
803 Ga0466967_0487322
804 Ga0466967_0495310
805 Ga0466967_0607936
806 Ga0466967_0767138
807 Ga0466967_0772684
808 Ga0466967_0819459
809 Ga0466967_0855481
810 Ga0495592_0061768
811 Ga0495592_0082695
812 Ga0495592_0376210
813 Ga0495629_0017675
814 Ga0495629_0285261
815 Ga0495641_0000345
816 Ga0495641_0009360
817 Ga0495641_0015766
818 Ga0495651_0022226
819 Ga0495651_0042714
820 Ga0495651_0140802
821 Ga0495653_0038069
822 Ga0495582_0001048
823 Ga0495582_0022377
824 Ga0495582_0065907
825 Ga0495582_0229417
826 Ga0495639_0003743
827 Ga0495662_0000116
828 Ga0495664_0089826
829 Ga0495664_0417547
830 Ga0495594_0419287
831 Ga0495608_0051001
832 Ga0495618_0107207
833 Ga0495628_0125254
834 Ga0495628_0198072
835 Ga0495628_0221699
836 Ga0495628_0507514
837 Ga0495628_0733694
838 Ga0495630_0048680
839 Ga0495630_0074004
840 Ga0495630_0688160
841 Ga0495666_0047266
842 Ga0495666_0157013
843 Ga0495666_0354301
844 Ga0495652_0121189
845 Ga0495652_0182347
846 Ga0495652_0185991
847 Ga0495652_0258367
848 Ga0495652_0637820
849 Ga0495665_0003303
850 Ga0495640_0017059
851 Ga0495640_0202810
852 Ga0495640_0205879
853 Ga0495587_0029904
854 Ga0495587_0095635
855 Ga0495645_0043901
856 Ga0495667_0003955
857 Ga0495667_0035392
858 Ga0495667_0096242
859 Ga0495667_0140320
860 Ga0495667_0275461
861 Ga0495667_0382739
862 Ga0495634_0030112
863 Ga0495634_0301483
864 Ga0495635_0039992
865 Ga0495635_0044977
866 Ga0495588_0278063
867 Ga0495657_0074236
868 Ga0495599_0047949
869 Ga0495599_0215204
870 Ga0495599_0626565
871 Ga0495623_0230290
872 Ga0495623_0454313
873 Ga0495647_0009112
874 Ga0495647_0227968
875 Ga0495658_0011968
876 Ga0495658_0021045
877 Ga0495658_0110976
878 Ga0495658_0296685
879 Ga0495613_0001439
880 Ga0495624_0009546
881 Ga0495624_0248864
882 Ga0495624_0413642
883 Ga0495600_0007507
884 Ga0495600_0049731
885 Ga0495581_0066964
886 Ga0495604_0062247
887 Ga0495604_0147550
888 Ga0495604_0247647
889 Ga0495604_0249857
890 Ga0495674_0003918
891 Ga0495674_0022551
892 Ga0495674_0031586
893 Ga0495674_0071459
894 Ga0495676_0007504
895 Ga0495676_0036163
896 Ga0495676_0314665
897 Ga0495680_0010814
898 Ga0495680_0062623
899 Ga0495680_0122630
900 Ga0495675_0168548
901 Ga0495675_0237074
902 Ga0495684_0038592
903 Ga0495684_0229601
904 Ga0495593_0001727
905 Ga0495593_0312655
906 Ga0495602_0184382
907 Ga0495602_0188541
908 Ga0495602_0286094
909 Ga0495614_0006047
910 Ga0495614_0176098
911 Ga0496100_0038848
912 Ga0496100_0160320
913 Ga0496100_0493409
914 Ga0496101_0008244
915 Ga0496101_0017063
916 Ga0496101_0026910
917 Ga0496101_0155718
918 Ga0496101_0529001
919 Ga0496102_0050710
920 Ga0496104_0085039
921 Ga0496104_0300939
922 Ga0496104_0613716
923 Ga0496105_0053792
924 Ga0496105_0061986
925 Ga0496105_0322739
926 Ga0496106_0006436
927 Ga0496106_0300455
928 Ga0496107_0131320
929 Ga0496107_0532125
930 Ga0496108_0228958
931 Ga0496109_0469105
932 Ga0496109_1006948
933 Ga0496110_0359391
934 Ga0496111_0217074
935 Ga0496111_0278061
936 Ga0496112_0016656
937 Ga0496112_0017720
938 Ga0496112_0037993
939 Ga0496114_0022003
940 Ga0496114_0064559
941 Ga0496114_0122723
942 Ga0496114_0159090
943 Ga0496114_0270982
944 Ga0496114_0368543
945 Ga0496114_0489794
946 Ga0496115_0000517
947 Ga0496115_0048456
948 Ga0496115_0064622
949 Ga0496115_0097121
950 Ga0496115_0602436
951 Ga0501034_0049014
952 Ga0501046_0889899
953 Ga0501047_0029106
954 Ga0501047_0031270
955 Ga0501047_0114650
956 Ga0501067_0037015
957 Ga0501067_0314714
958 Ga0501067_0322840
959 Ga0501068_0143844
960 Ga0501069_0032375
961 Ga0501069_0041224
962 Ga0501069_0047612
963 Ga0501069_0052754
964 Ga0501069_0064220
965 Ga0501070_0001687
966 Ga0501070_0099653
967 Ga0501073_0449542
968 Ga0501073_0719217
969 Ga0501074_0051183
970 Ga0501074_0235592
971 Ga0501079_0206651
972 Ga0501079_0424397
973 Ga0501080_0118607
974 Ga0501080_0222391
975 Ga0501035_0374534
976 Ga0501044_0200919
977 nmdc:mga05p37_117696_c1
978 nmdc:mga0a205_24742_c1
979 Ga0495601_0202511
980 Ga0495601_0242155
981 Ga0495601_0316418
982 Ga0495612_0089463
983 Ga0495655_0003808
984 Ga0495595_0008308
985 Ga0495619_0034005
986 Ga0495619_0761195
987 Ga0466962_0004093
988 Ga0530510_0012157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00265

TK

Thymidine kinase

14

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbt-assembly2.cif.gz_H crystal structure of human thymidine kinase 1 0.945 14 192
1xbt-assembly1.cif.gz_D crystal structure of human thymidine kinase 1 0.942 14 192
2wvj-assembly1.cif.gz_D mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine 0.9412 14 192
1xx6-assembly1.cif.gz_A x-ray structure of clostridium acetobutylicum thymidine kinase with adp. northeast structural genomics target car26. 0.9408 10 195
2orv-assembly1.cif.gz_A human thymidine kinase 1 in complex with tp4a 0.9374 14 192
ID Description Score Start End Superfamily
af_Q2FWD9_1_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 7 146 3.40.50.300
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9224 14 146 3.40.50.300
2qpoC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9182 14 145 3.40.50.300
af_Q2FWD9_1_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9158 7 146 3.40.50.300
2j9rA02 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.9091 148 194 3.30.60.20
ID Description Score Start End GO Terms
AF-A0A2V7WPW5-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9651 12 149 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A7J5W999-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9644 13 195 GO:0004797
GO:0005524
GO:0005829
GO:0008270
GO:0046104
GO:0071897
AF-X1JNW3-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.961 30 143 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A7W0QJY7-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9595 23 126 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A1V2M219-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9576 14 195 GO:0004797
GO:0005524
GO:0005829
GO:0008270
GO:0046104
GO:0071897

Map