F454492

General Info

Members Datasets Scaffolds Average Seq Length
493 205 484 210

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0021254|Ga0501070_0021254_1888_2643
Length 251
Sequence MTWINTRIRQTAVMHGVPVDPRGSSSRHPASNPIAHGPKEHPMQIRSDSFQNHARLPAEFAFGKPGDRDEPCVLSANRNPHLAWSGAPADTRSFALVCIDSDVPSRGDDVNQPGRTVPADLPRVDFAHWLMVDIPPACTTIAAGACSDGVTPHGKSDPAGPAGTRQGRNDYTGWFASDPGMAGDYLGYDGPCPPWNDALLHHYRFRVYALDVARLDLPRAFGWQELQAALRGHVLDEAEIVGTYSLNPAVK

Samples

Sample ID Description Type Environment
1 2511231016 Pseudomonas sp. GM50 Isolate Nodule
2 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
3 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
6 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
7 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
8 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
200 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 3.65
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0.2
Rhizoplane 2.03
Rhizosphere 92.7
Stem 0
Stem Tuber 0.41
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000615 3300001915 Bacteria 10743
2 JGI24741J21665_1004217 3300001915 Bacteria 3234
3 JGI24741J21665_1009412 3300001915 Bacteria 1796
4 JGI24740J21852_10000222 3300001979 Bacteria 24091
5 JGI24740J21852_10006910 3300001979 Bacteria 4660
6 rootL2_10060175 3300003322 Bacteria 6746
7 Ga0070658_10082438 3300005327 Bacteria 2643
8 Ga0070658_10323857 3300005327 Bacteria 1316
9 Ga0070658_10368364 3300005327 Bacteria 1231
10 Ga0070658_11023469 3300005327 Bacteria 718
11 Ga0070683_100053356 3300005329 Bacteria 3746
12 Ga0070666_10157802 3300005335 Bacteria 1585
13 Ga0070680_100000301 3300005336 Bacteria 33020
14 Ga0070680_100008519 3300005336 Bacteria 7855
15 Ga0070680_100073429 3300005336 Bacteria 2813
16 Ga0070680_100474520 3300005336 Bacteria 1069
17 Ga0070682_100001936 3300005337 Bacteria 11552
18 Ga0070682_100075285 3300005337 Bacteria 2170
19 Ga0070682_100276918 3300005337 Bacteria 1221
20 Ga0070660_100013635 3300005339 Bacteria 5840
21 Ga0070660_100015985 3300005339 Bacteria 5435
22 Ga0070660_100016246 3300005339 Bacteria 5399
23 Ga0070660_100066523 3300005339 Bacteria 2806
24 Ga0070691_10000178 3300005341 Bacteria 20899
25 Ga0070691_10026631 3300005341 Bacteria 2696
26 Ga0070661_100029733 3300005344 Bacteria 3944
27 Ga0070661_100049910 3300005344 Bacteria 3063
28 Ga0070661_100057445 3300005344 Bacteria 2851
29 Ga0070692_10004465 3300005345 Bacteria 5850
30 Ga0070692_10010903 3300005345 Bacteria 4157
31 Ga0070692_10012765 3300005345 Bacteria 3900
32 Ga0070692_10014928 3300005345 Bacteria 3661
33 Ga0070668_100033077 3300005347 Bacteria 3935
34 Ga0070668_100203127 3300005347 Bacteria 1627
35 Ga0070671_100113579 3300005355 Bacteria 2276
36 Ga0070673_100295936 3300005364 Unclassified 1424
37 Ga0070659_100012411 3300005366 Bacteria 6318
38 Ga0070667_100000040 3300005367 Bacteria 170222
39 Ga0070667_100065297 3300005367 Bacteria 3090
40 Ga0070667_100102301 3300005367 Bacteria 2475
41 Ga0070714_100000311 3300005435 Bacteria 36885
42 Ga0070694_100069129 3300005444 Bacteria 2428
43 Ga0070694_100518293 3300005444 Bacteria 951
44 Ga0070663_100000152 3300005455 Bacteria 34096
45 Ga0070663_100007949 3300005455 Bacteria 6498
46 Ga0070663_100231100 3300005455 Bacteria 1456
47 Ga0070663_100294704 3300005455 Bacteria 1297
48 Ga0070663_100413167 3300005455 Bacteria 1105
49 Ga0070662_100900483 3300005457 Bacteria 755
50 Ga0070681_10000015 3300005458 Bacteria 130427
51 Ga0070681_10000062 3300005458 Bacteria 77779
52 Ga0070681_10000088 3300005458 Bacteria 69295
53 Ga0070681_10043510 3300005458 Bacteria 4499
54 Ga0070681_10438928 3300005458 Bacteria 1217
55 Ga0070679_100000061 3300005530 Bacteria 80570
56 Ga0070679_100000188 3300005530 Bacteria 49880
57 Ga0070679_100029155 3300005530 Bacteria 5444
58 Ga0070679_100543516 3300005530 Bacteria 1105
59 Ga0070684_100089705 3300005535 Bacteria 2732
60 Ga0070684_100195562 3300005535 Bacteria 1841
61 Ga0068853_100000897 3300005539 Bacteria 20716
62 Ga0068853_100004247 3300005539 Bacteria 11065
63 Ga0068853_100012119 3300005539 Bacteria 7013
64 Ga0068853_100016747 3300005539 Bacteria 6038
65 Ga0068853_100042220 3300005539 Bacteria 3898
66 Ga0068853_100241284 3300005539 Bacteria 1656
67 Ga0068853_100272304 3300005539 Bacteria 1559
68 Ga0070696_100000213 3300005546 Bacteria 34817
69 Ga0070696_100041487 3300005546 Bacteria 3180
70 Ga0070693_100001310 3300005547 Bacteria 11210
71 Ga0070693_100007118 3300005547 Bacteria 5454
72 Ga0070665_100015064 3300005548 Bacteria 7763
73 Ga0070665_100047560 3300005548 Bacteria 4305
74 Ga0070665_100071462 3300005548 Bacteria 3476
75 Ga0068855_100003252 3300005563 Bacteria 19872
76 Ga0068855_100003760 3300005563 Bacteria 18553
77 Ga0068855_100017314 3300005563 Bacteria 8670
78 Ga0068855_100095903 3300005563 Bacteria 3418
79 Ga0068855_100127132 3300005563 Bacteria 2913
80 Ga0068855_100338848 3300005563 Bacteria 1658
81 Ga0068855_100540530 3300005563 Bacteria 1262
82 Ga0070664_100010265 3300005564 Bacteria 7595
83 Ga0068857_100012518 3300005577 Bacteria 7387
84 Ga0068857_100028820 3300005577 Bacteria 4899
85 Ga0068857_100108119 3300005577 Bacteria 2499
86 Ga0068854_100001352 3300005578 Bacteria 14792
87 Ga0068854_100019485 3300005578 Bacteria 4573
88 Ga0068854_100063971 3300005578 Bacteria 2672
89 Ga0068854_100116105 3300005578 Bacteria 2025
90 Ga0068854_100424328 3300005578 Bacteria 1105
91 Ga0068856_100018258 3300005614 Bacteria 6800
92 Ga0068856_100107584 3300005614 Bacteria 2784
93 Ga0068856_100166290 3300005614 Bacteria 2217
94 Ga0068856_100380636 3300005614 Bacteria 1430
95 Ga0068856_100909253 3300005614 Bacteria 899
96 Ga0068852_100012685 3300005616 Bacteria 6411
97 Ga0068852_100062840 3300005616 Bacteria 3231
98 Ga0068852_100198781 3300005616 Bacteria 1896
99 Ga0068852_100223068 3300005616 Bacteria 1793
100 Ga0068859_100000979 3300005617 Bacteria 29249
101 Ga0068859_100773775 3300005617 Bacteria 1048
102 Ga0068851_10011316 3300005834 Bacteria 4182
103 Ga0068851_10147779 3300005834 Bacteria 1283
104 Ga0068851_10152801 3300005834 Bacteria 1263
105 Ga0068863_100044420 3300005841 Bacteria 4218
106 Ga0068863_100372586 3300005841 Bacteria 1393
107 Ga0068858_100297926 3300005842 Bacteria 1538
108 Ga0068858_100464023 3300005842 Bacteria 1221
109 Ga0068858_100496493 3300005842 Unclassified 1179
110 Ga0068860_100072217 3300005843 Bacteria 3279
111 Ga0068862_100000224 3300005844 Bacteria 62869
112 Ga0097621_100050721 3300006237 Bacteria 3375
113 Ga0097621_100473045 3300006237 Bacteria 1132
114 Ga0097620_100000979 3300006931 Bacteria 29249
115 Ga0097620_100773825 3300006931 Bacteria 1048
116 Ga0105240_10026029 3300009093 Bacteria 7683
117 Ga0105240_10031009 3300009093 Bacteria 6939
118 Ga0105240_10107714 3300009093 Bacteria 3378
119 Ga0105240_10124734 3300009093 Bacteria 3096
120 Ga0105240_10251999 3300009093 Bacteria 2041
121 Ga0105247_10220829 3300009101 Bacteria 1283
122 Ga0105243_10492351 3300009148 Bacteria 1160
123 Ga0105241_10042730 3300009174 Bacteria 3431
124 Ga0105241_10140516 3300009174 Bacteria 1965
125 Ga0105241_10144740 3300009174 Bacteria 1939
126 Ga0105241_10185116 3300009174 Bacteria 1730
127 Ga0105241_10266966 3300009174 Bacteria 1456
128 Ga0105248_10005513 3300009177 Bacteria 13896
129 Ga0105248_10134512 3300009177 Bacteria 2789
130 Ga0105237_10001863 3300009545 Bacteria 26949
131 Ga0105237_10074209 3300009545 Bacteria 3393
132 Ga0105237_10267037 3300009545 Bacteria 1714
133 Ga0105237_10573998 3300009545 Bacteria 1135
134 Ga0105238_10013703 3300009551 Bacteria 8189
135 Ga0105238_10022214 3300009551 Bacteria 6468
136 Ga0105249_10000193 3300009553 Bacteria 69963
137 Ga0105249_10022676 3300009553 Bacteria 5626
138 Ga0105239_10005286 3300010375 Bacteria 15176
139 Ga0105239_10039059 3300010375 Bacteria 5200
140 Ga0105239_10075807 3300010375 Bacteria 3698
141 Ga0105239_10383296 3300010375 Bacteria 1589
142 Ga0105239_10805383 3300010375 Unclassified 1076
143 Ga0157373_10036715 3300013100 Bacteria 3514
144 Ga0157373_10060193 3300013100 Bacteria 2690
145 Ga0157373_10094224 3300013100 Bacteria 2109
146 Ga0157371_10020103 3300013102 Bacteria 4915
147 Ga0157371_10020463 3300013102 Bacteria 4869
148 Ga0157371_10137229 3300013102 Bacteria 1742
149 Ga0157371_10416621 3300013102 Bacteria 984
150 Ga0157370_10012911 3300013104 Bacteria 8634
151 Ga0157370_10068309 3300013104 Bacteria 3359
152 Ga0157370_10074695 3300013104 Bacteria 3197
153 Ga0157370_10135940 3300013104 Bacteria 2291
154 Ga0157370_10800439 3300013104 Bacteria 858
155 Ga0157369_10087774 3300013105 Bacteria 3321
156 Ga0157369_10146436 3300013105 Bacteria 2497
157 Ga0157369_10228972 3300013105 Bacteria 1944
158 Ga0157369_10241982 3300013105 Bacteria 1884
159 Ga0157374_10178371 3300013296 Bacteria 2074
160 Ga0157372_10010645 3300013307 Bacteria 9784
161 Ga0157372_10052909 3300013307 Bacteria 4523
162 Ga0157372_10116984 3300013307 Bacteria 3057
163 Ga0157372_10167359 3300013307 Bacteria 2542
164 Ga0157372_10272940 3300013307 Bacteria 1965
165 Ga0157375_10083021 3300013308 Unclassified 3248
166 Ga0157379_10107009 3300014968 Bacteria 2510
167 Ga0157379_10114850 3300014968 Unclassified 2420
168 Ga0157376_10207632 3300014969 Bacteria 1806
169 Ga0157376_10365276 3300014969 Bacteria 1385
170 Ga0157376_10521714 3300014969 Bacteria 1171
171 Ga0182006_1013713 3300015261 Bacteria 3507
172 Ga0197907_10094875 3300020069 Bacteria 3683
173 Ga0206356_10143582 3300020070 Bacteria 3330
174 Ga0206356_10647139 3300020070 Bacteria 7465
175 Ga0206356_11433262 3300020070 Bacteria 3890
176 Ga0206351_10166290 3300020077 Bacteria 2089
177 Ga0206352_10430462 3300020078 Bacteria 2174
178 Ga0206352_10438213 3300020078 Bacteria 1940
179 Ga0206350_10220779 3300020080 Bacteria 2775
180 Ga0206350_10233428 3300020080 Bacteria 2453
181 Ga0206354_10039073 3300020081 Bacteria 2676
182 Ga0206354_10072506 3300020081 Bacteria 1664
183 Ga0206354_10107429 3300020081 Bacteria 7299
184 Ga0206354_10287451 3300020081 Bacteria 3560
185 Ga0206353_10251616 3300020082 Bacteria 2024
186 Ga0206353_10516896 3300020082 Bacteria 6987
187 Ga0206353_10819831 3300020082 Bacteria 3830
188 Ga0154015_1153483 3300020610 Bacteria 3409
189 Ga0154015_1494868 3300020610 Bacteria 2610
190 Ga0209026_1003406 3300025250 Bacteria 5234
191 Ga0209051_1022830 3300025303 Bacteria 2621
192 Ga0207656_10027123 3300025321 Bacteria 2341
193 Ga0207656_10039032 3300025321 Bacteria 2006
194 Ga0207656_10121485 3300025321 Bacteria 1216
195 Ga0207692_10273968 3300025898 Bacteria 1019
196 Ga0207680_10038056 3300025903 Unclassified 2782
197 Ga0207647_10000197 3300025904 Bacteria 49345
198 Ga0207647_10006761 3300025904 Bacteria 8321
199 Ga0207647_10008395 3300025904 Bacteria 7407
200 Ga0207645_10069130 3300025907 Bacteria 2259
201 Ga0207705_10000097 3300025909 Bacteria 105579
202 Ga0207705_10001380 3300025909 Bacteria 19386
203 Ga0207705_10017993 3300025909 Bacteria 5053
204 Ga0207705_10080378 3300025909 Bacteria 2375
205 Ga0207705_10129337 3300025909 Bacteria 1878
206 Ga0207654_10269960 3300025911 Bacteria 1147
207 Ga0207707_10000065 3300025912 Bacteria 106546
208 Ga0207707_10000084 3300025912 Bacteria 95228
209 Ga0207707_10000144 3300025912 Bacteria 73715
210 Ga0207707_10000161 3300025912 Bacteria 70295
211 Ga0207707_10000949 3300025912 Bacteria 27923
212 Ga0207707_10002991 3300025912 Bacteria 15036
213 Ga0207707_10017928 3300025912 Bacteria 6173
214 Ga0207695_10000820 3300025913 Bacteria 57515
215 Ga0207695_10003204 3300025913 Bacteria 23317
216 Ga0207695_10008721 3300025913 Bacteria 12643
217 Ga0207695_10011037 3300025913 Bacteria 10977
218 Ga0207695_10060774 3300025913 Bacteria 3909
219 Ga0207695_10180949 3300025913 Bacteria 2029
220 Ga0207671_10004436 3300025914 Bacteria 13422
221 Ga0207671_10129322 3300025914 Bacteria 1937
222 Ga0207671_10273158 3300025914 Bacteria 1332
223 Ga0207671_10482396 3300025914 Bacteria 988
224 Ga0207660_10000368 3300025917 Bacteria 29401
225 Ga0207660_10000561 3300025917 Bacteria 24996
226 Ga0207660_10004075 3300025917 Bacteria 9524
227 Ga0207660_10004119 3300025917 Bacteria 9466
228 Ga0207657_10001354 3300025919 Bacteria 26098
229 Ga0207657_10011996 3300025919 Bacteria 8572
230 Ga0207657_10012298 3300025919 Bacteria 8457
231 Ga0207657_10023702 3300025919 Bacteria 5708
232 Ga0207657_10024718 3300025919 Bacteria 5554
233 Ga0207649_10013832 3300025920 Bacteria 4512
234 Ga0207649_10133707 3300025920 Bacteria 1688
235 Ga0207649_10135327 3300025920 Bacteria 1679
236 Ga0207649_10530492 3300025920 Bacteria 898
237 Ga0207652_10000076 3300025921 Bacteria 107686
238 Ga0207652_10000082 3300025921 Bacteria 103057
239 Ga0207652_10000339 3300025921 Bacteria 48658
240 Ga0207652_10020202 3300025921 Bacteria 5483
241 Ga0207652_10294938 3300025921 Bacteria 1463
242 Ga0207694_10051317 3300025924 Bacteria 3197
243 Ga0207664_10000030 3300025929 Bacteria 179903
244 Ga0207690_10000122 3300025932 Bacteria 64448
245 Ga0207690_10044039 3300025932 Bacteria 2940
246 Ga0207690_10082044 3300025932 Bacteria 2254
247 Ga0207690_10155093 3300025932 Bacteria 1701
248 Ga0207706_10012323 3300025933 Bacteria 7788
249 Ga0207686_10001330 3300025934 Bacteria 14081
250 Ga0207704_10052761 3300025938 Unclassified 2466
251 Ga0207704_10060583 3300025938 Unclassified 2342
252 Ga0207691_10568751 3300025940 Bacteria 961
253 Ga0207711_10000300 3300025941 Bacteria 53102
254 Ga0207689_10019723 3300025942 Bacteria 5681
255 Ga0207661_10012498 3300025944 Bacteria 6169
256 Ga0207661_10042441 3300025944 Bacteria 3585
257 Ga0207661_10234133 3300025944 Bacteria 1627
258 Ga0207661_10530025 3300025944 Unclassified 1078
259 Ga0207679_10171390 3300025945 Bacteria 1787
260 Ga0207667_10000310 3300025949 Bacteria 67687
261 Ga0207667_10003803 3300025949 Bacteria 18572
262 Ga0207667_10009034 3300025949 Bacteria 11787
263 Ga0207667_10010439 3300025949 Bacteria 10853
264 Ga0207667_10017298 3300025949 Bacteria 8120
265 Ga0207667_10022369 3300025949 Bacteria 6987
266 Ga0207667_10025118 3300025949 Bacteria 6528
267 Ga0207667_10032730 3300025949 Bacteria 5597
268 Ga0207667_10144147 3300025949 Bacteria 2452
269 Ga0207667_10250078 3300025949 Unclassified 1813
270 Ga0207667_10599229 3300025949 Bacteria 1111
271 Ga0207712_10046925 3300025961 Bacteria 2997
272 Ga0207668_10033571 3300025972 Bacteria 3400
273 Ga0207640_10000068 3300025981 Bacteria 84422
274 Ga0207640_10037420 3300025981 Bacteria 3053
275 Ga0207640_10046257 3300025981 Bacteria 2799
276 Ga0207640_10117679 3300025981 Bacteria 1897
277 Ga0207658_10000289 3300025986 Bacteria 52614
278 Ga0207658_10748003 3300025986 Bacteria 885
279 Ga0207677_10134925 3300026023 Unclassified 1880
280 Ga0207639_10004110 3300026041 Bacteria 9812
281 Ga0207639_10004170 3300026041 Bacteria 9730
282 Ga0207639_10011650 3300026041 Bacteria 6111
283 Ga0207639_10025097 3300026041 Bacteria 4320
284 Ga0207639_10031547 3300026041 Bacteria 3895
285 Ga0207639_10040946 3300026041 Bacteria 3462
286 Ga0207678_10000886 3300026067 Bacteria 27527
287 Ga0207678_10009462 3300026067 Bacteria 8572
288 Ga0207678_10009669 3300026067 Bacteria 8481
289 Ga0207678_10014594 3300026067 Bacteria 6914
290 Ga0207678_10025483 3300026067 Bacteria 5162
291 Ga0207678_10316514 3300026067 Bacteria 1342
292 Ga0207702_10005080 3300026078 Bacteria 11561
293 Ga0207702_10150115 3300026078 Bacteria 2119
294 Ga0207702_10277804 3300026078 Bacteria 1582
295 Ga0207641_10050550 3300026088 Bacteria 3517
296 Ga0207641_10093058 3300026088 Bacteria 2641
297 Ga0207648_10029212 3300026089 Bacteria 4889
298 Ga0207674_10001405 3300026116 Bacteria 31074
299 Ga0207674_10036080 3300026116 Bacteria 5156
300 Ga0207674_10087208 3300026116 Bacteria 3115
301 Ga0207674_10090460 3300026116 Bacteria 3052
302 Ga0207674_10206511 3300026116 Bacteria 1913
303 Ga0207698_10001187 3300026142 Bacteria 15193
304 Ga0207698_10002461 3300026142 Bacteria 10979
305 Ga0207698_10144578 3300026142 Bacteria 2054
306 Ga0207698_10220011 3300026142 Bacteria 1715
307 Ga0207698_10244391 3300026142 Bacteria 1638
308 Ga0207698_10289829 3300026142 Unclassified 1518
309 Ga0207698_10403999 3300026142 Bacteria 1306
310 Ga0268266_10011433 3300028379 Bacteria 7720
311 Ga0268266_10073164 3300028379 Unclassified 2974
312 Ga0268266_10123182 3300028379 Bacteria 2309
313 Ga0268266_10237902 3300028379 Bacteria 1679
314 Ga0268265_10000054 3300028380 Bacteria 165504
315 Ga0268264_10239377 3300028381 Bacteria 1680
316 Ga0268264_10546776 3300028381 Bacteria 1135
317 Ga0395899_0023204 3300037312 Bacteria 4703
318 Ga0395900_0011530 3300037418 Bacteria 9047
319 Ga0395898_0027888 3300037466 Bacteria 5662
320 Ga0395898_0037918 3300037466 Bacteria 4778
321 Ga0395901_0037786 3300038443 Bacteria 4993
322 Ga0451791_1352661 3300041451 Bacteria 1880
323 Ga0451793_1599871 3300041452 Bacteria 5016
324 Ga0451795_1372122 3300041456 Bacteria 930
325 Ga0451802_0122820 3300041460 Bacteria 905
326 Ga0451802_0357610 3300041460 Bacteria 4967
327 Ga0451807_0385942 3300041486 Bacteria 5866
328 Ga0451833_0619325 3300041491 Unclassified 3587
329 Ga0451843_0599071 3300041509 Bacteria 1664
330 Ga0451853_1501317 3300041512 Bacteria 4709
331 Ga0451853_2978688 3300041512 Bacteria 4039
332 Ga0451853_3087106 3300041512 Bacteria 1424
333 Ga0439455_0094200 3300042012 Bacteria 823
334 Ga0451577_0047101 3300042876 Bacteria 3855
335 Ga0451577_0061413 3300042876 Bacteria 3351
336 Ga0466969_0015615 3300044656 Bacteria 3978
337 Ga0466972_0002522 3300044658 Bacteria 9056
338 Ga0466982_0000006 3300044672 Bacteria 333931
339 Ga0466965_0102393 3300044683 Bacteria 1465
340 Ga0466966_0000477 3300044684 Bacteria 25796
341 Ga0466963_0388014 3300044694 Bacteria 984
342 Ga0466971_0001620 3300044719 Bacteria 9502
343 Ga0466968_0004412 3300044735 Bacteria 5256
344 Ga0466970_0002639 3300044765 Bacteria 8646
345 Ga0466970_0022857 3300044765 Bacteria 3262
346 Ga0466957_0125277 3300044842 Bacteria 1641
347 Ga0466960_0031608 3300044901 Bacteria 2444
348 Ga0466959_0164309 3300045049 Bacteria 1559
349 Ga0451576_0000621 3300045051 Bacteria 74139
350 Ga0466958_0027954 3300045836 Bacteria 3341
351 Ga0495617_049488 3300046452 Bacteria 1398
352 Ga0495630_0032162 3300046517 Bacteria 3908
353 Ga0495666_0047048 3300046526 Bacteria 2078
354 Ga0495642_0000077 3300046528 Bacteria 57843
355 Ga0495654_0011412 3300046530 Bacteria 4809
356 Ga0495597_0000092 3300046542 Bacteria 79435
357 Ga0495670_0005461 3300046691 Bacteria 6240
358 Ga0495671_0007285 3300046692 Bacteria 6315
359 Ga0495671_0010746 3300046692 Bacteria 5060
360 Ga0495671_0018295 3300046692 Bacteria 3720
361 Ga0495649_0039369 3300046694 Bacteria 2592
362 Ga0495672_0001174 3300047320 Bacteria 26554
363 Ga0495672_0003612 3300047320 Bacteria 13117
364 Ga0495673_0000350 3300047469 Bacteria 57843
365 Ga0495673_0001784 3300047469 Bacteria 16340
366 Ga0495686_0001204 3300047472 Bacteria 29860
367 Ga0495626_0000119 3300048091 Bacteria 102920
368 Ga0496114_0014635 3300048917 Bacteria 6303
369 Ga0496114_0195130 3300048917 Bacteria 1772
370 Ga0496115_0028975 3300048918 Bacteria 4345
371 Ga0496118_0067228 3300048921 Bacteria 2611
372 Ga0496122_0000037 3300048925 Bacteria 304495
373 Ga0496122_0008995 3300048925 Bacteria 10614
374 Ga0496123_0000870 3300048926 Bacteria 48048
375 Ga0496125_0003359 3300048928 Bacteria 19489
376 Ga0496126_0062077 3300048929 Bacteria 3354
377 Ga0501031_0008999 3300049568 Bacteria 6497
378 Ga0501032_0001914 3300049569 Bacteria 16411
379 Ga0501032_0009729 3300049569 Bacteria 6958
380 Ga0501033_0000829 3300049570 Bacteria 28236
381 Ga0501033_0031029 3300049570 Bacteria 4017
382 Ga0501033_0192183 3300049570 Bacteria 1460
383 Ga0501034_0011901 3300049571 Bacteria 8999
384 Ga0501034_0015535 3300049571 Bacteria 7821
385 Ga0501034_0163331 3300049571 Bacteria 2197
386 Ga0501034_0391961 3300049571 Bacteria 1313
387 Ga0501036_0004321 3300049572 Bacteria 11472
388 Ga0501036_0007458 3300049572 Bacteria 8915
389 Ga0501037_0003610 3300049573 Bacteria 11216
390 Ga0501037_0003874 3300049573 Bacteria 10852
391 Ga0501037_0014384 3300049573 Bacteria 5825
392 Ga0501037_0015717 3300049573 Bacteria 5569
393 Ga0501038_0002541 3300049574 Bacteria 16998
394 Ga0501038_0002630 3300049574 Bacteria 16790
395 Ga0501038_0148311 3300049574 Bacteria 1914
396 Ga0501039_0010284 3300049575 Bacteria 7135
397 Ga0501039_0030151 3300049575 Bacteria 4181
398 Ga0501040_0121471 3300049576 Bacteria 1833
399 Ga0501042_0129339 3300049578 Bacteria 1819
400 Ga0501043_0007129 3300049579 Bacteria 8893
401 Ga0501043_0046759 3300049579 Bacteria 3403
402 Ga0501046_0002816 3300049580 Bacteria 16197
403 Ga0501046_0007359 3300049580 Bacteria 9683
404 Ga0501046_0057226 3300049580 Bacteria 3059
405 Ga0501047_0014016 3300049581 Bacteria 7618
406 Ga0501047_0020484 3300049581 Bacteria 6349
407 Ga0501047_0030256 3300049581 Bacteria 5220
408 Ga0501047_0359375 3300049581 Bacteria 1292
409 Ga0501047_0411093 3300049581 Bacteria 1185
410 Ga0501048_0035553 3300049582 Bacteria 3586
411 Ga0501067_0063993 3300049583 Bacteria 2037
412 Ga0501067_0124406 3300049583 Bacteria 1435
413 Ga0501068_0023707 3300049584 Bacteria 3598
414 Ga0501069_0000180 3300049585 Bacteria 28489
415 Ga0501069_0004452 3300049585 Bacteria 7236
416 Ga0501069_0025043 3300049585 Bacteria 3259
417 Ga0501069_0031113 3300049585 Bacteria 2934
418 Ga0501069_0073206 3300049585 Bacteria 1921
419 Ga0501070_0002090 3300049586 Bacteria 17529
420 Ga0501070_0008312 3300049586 Bacteria 8768
421 Ga0501070_0021254 3300049586 Bacteria 5446
422 Ga0501070_0025998 3300049586 Bacteria 4911
423 Ga0501070_0027859 3300049586 Bacteria 4739
424 Ga0501070_0031575 3300049586 Bacteria 4437
425 Ga0501070_0047209 3300049586 Bacteria 3580
426 Ga0501070_0082220 3300049586 Bacteria 2665
427 Ga0501070_0092319 3300049586 Bacteria 2505
428 Ga0501070_0162717 3300049586 Bacteria 1839
429 Ga0501070_0347605 3300049586 Bacteria 1204
430 Ga0501070_0438158 3300049586 Bacteria 1054
431 Ga0501071_0029357 3300049587 Bacteria 3880
432 Ga0501071_0061905 3300049587 Bacteria 2711
433 Ga0501071_0090174 3300049587 Bacteria 2251
434 Ga0501073_0009080 3300049589 Bacteria 7337
435 Ga0501073_0013534 3300049589 Bacteria 5932
436 Ga0501073_0032228 3300049589 Bacteria 3737
437 Ga0501073_0032764 3300049589 Bacteria 3703
438 Ga0501073_0243898 3300049589 Bacteria 1240
439 Ga0501074_0006123 3300049590 Bacteria 8688
440 Ga0501074_0010164 3300049590 Bacteria 6832
441 Ga0501074_0013105 3300049590 Bacteria 6027
442 Ga0501074_0054566 3300049590 Bacteria 2881
443 Ga0501074_0235303 3300049590 Bacteria 1303
444 Ga0501074_0435251 3300049590 Bacteria 930
445 Ga0501074_0475541 3300049590 Bacteria 886
446 Ga0501076_0219266 3300049592 Bacteria 1555
447 Ga0501077_0012062 3300049593 Bacteria 5410
448 Ga0501079_0028545 3300049741 Bacteria 4282
449 Ga0501079_0324259 3300049741 Bacteria 1206
450 Ga0501079_0524442 3300049741 Bacteria 931
451 Ga0501080_0023759 3300049742 Bacteria 5680
452 Ga0501080_0045535 3300049742 Bacteria 4084
453 Ga0501080_0064379 3300049742 Bacteria 3410
454 Ga0501080_0071929 3300049742 Bacteria 3217
455 Ga0501080_0103940 3300049742 Bacteria 2634
456 Ga0501080_0216626 3300049742 Bacteria 1753
457 Ga0501080_0234682 3300049742 Bacteria 1676
458 Ga0501083_0341975 3300049744 Bacteria 973
459 Ga0501035_0005799 3300049822 Bacteria 11641
460 Ga0501035_0012950 3300049822 Bacteria 7698
461 Ga0501035_0020050 3300049822 Bacteria 6141
462 Ga0501035_0022587 3300049822 Bacteria 5778
463 Ga0501035_0087590 3300049822 Bacteria 2744
464 Ga0501035_0102127 3300049822 Bacteria 2516
465 Ga0501035_0188965 3300049822 Bacteria 1771
466 Ga0501035_0201891 3300049822 Bacteria 1704
467 Ga0501044_0005848 3300049823 Bacteria 13622
468 Ga0501044_0018874 3300049823 Bacteria 7384
469 Ga0501044_0024076 3300049823 Bacteria 6469
470 Ga0501044_0048251 3300049823 Bacteria 4399
471 Ga0501044_0072132 3300049823 Bacteria 3511
472 Ga0501044_0087987 3300049823 Bacteria 3136
473 Ga0501044_0089728 3300049823 Bacteria 3102
474 Ga0501044_0219516 3300049823 Bacteria 1852
475 Ga0501044_0366520 3300049823 Bacteria 1358
476 Ga0500643_001211 3300053087 Bacteria 15404
477 Ga0500651_0042925 3300053093 Bacteria 2849
478 Ga0500597_000073 3300053120 Bacteria 20548
479 Ga0500628_014365 3300053129 Bacteria 1494
480 Ga0500620_002893 3300053155 Bacteria 3569
481 Ga0501084_0042898 3300054114 Bacteria 3784
482 Ga0501084_0330278 3300054114 Bacteria 1288
483 Ga0501082_0373708 3300060353 Bacteria 1243
484 Ga0466962_0002158 3300061719 Bacteria 9295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10000193 Ga0105249_1000019342 196
2 3300015261 Ga0182006_1013713 Ga0182006_10137132 203
3 3300048921 Ga0496118_0067228 Ga0496118_0067228_522_1133 203
4 iso_pu_bacteria 2623620443 2624479871 203
5 iso_pu_bacteria 2643221562 2643828576 203
6 iso_pu_bacteria 2895395659 2895397946 203
7 iso_pu_bacteria 2939611941 2939613646 203
8 3300041460 Ga0451802_0122820 Ga0451802_0122820_184_798 204
9 iso_pu_bacteria 2511231016 2511328499 205
10 iso_pu_bacteria 2537561728 2538424968 205
11 iso_pu_bacteria 2871272651 2871275175 205
12 iso_pu_bacteria 2871282230 2871285123 205
13 iso_pu_bacteria 8002392321 8002393381 205
14 3300003322 rootL2_10060175 rootL2_100601756 207
15 3300005327 Ga0070658_11023469 Ga0070658_110234691 207
16 3300005339 Ga0070660_100066523 Ga0070660_1000665231 207
17 3300005345 Ga0070692_10010903 Ga0070692_100109033 207
18 3300005345 Ga0070692_10012765 Ga0070692_100127656 207
19 3300005366 Ga0070659_100012411 Ga0070659_1000124118 207
20 3300005435 Ga0070714_100000311 Ga0070714_10000031124 207
21 3300005444 Ga0070694_100069129 Ga0070694_1000691292 207
22 3300005444 Ga0070694_100518293 Ga0070694_1005182932 207
23 3300005458 Ga0070681_10043510 Ga0070681_100435103 207
24 3300005530 Ga0070679_100029155 Ga0070679_1000291554 207
25 3300005563 Ga0068855_100003252 Ga0068855_10000325210 207
26 3300005563 Ga0068855_100127132 Ga0068855_1001271323 207
27 3300005578 Ga0068854_100063971 Ga0068854_1000639711 207
28 3300005614 Ga0068856_100166290 Ga0068856_1001662905 207
29 3300009093 Ga0105240_10107714 Ga0105240_101077143 207
30 3300009174 Ga0105241_10140516 Ga0105241_101405163 207
31 3300009545 Ga0105237_10074209 Ga0105237_100742095 207
32 3300009551 Ga0105238_10022214 Ga0105238_100222148 207
33 3300010375 Ga0105239_10075807 Ga0105239_100758071 207
34 3300013102 Ga0157371_10020463 Ga0157371_100204636 207
35 3300013104 Ga0157370_10012911 Ga0157370_100129116 207
36 3300013307 Ga0157372_10272940 Ga0157372_102729403 207
37 3300025904 Ga0207647_10006761 Ga0207647_100067614 207
38 3300025909 Ga0207705_10080378 Ga0207705_100803783 207
39 3300025911 Ga0207654_10269960 Ga0207654_102699601 207
40 3300025912 Ga0207707_10017928 Ga0207707_100179287 207
41 3300025913 Ga0207695_10000820 Ga0207695_1000082042 207
42 3300025913 Ga0207695_10060774 Ga0207695_100607743 207
43 3300025914 Ga0207671_10273158 Ga0207671_102731583 207
44 3300025919 Ga0207657_10023702 Ga0207657_1002370210 207
45 3300025921 Ga0207652_10294938 Ga0207652_102949381 207
46 3300025924 Ga0207694_10051317 Ga0207694_100513173 207
47 3300025929 Ga0207664_10000030 Ga0207664_10000030137 207
48 3300025932 Ga0207690_10155093 Ga0207690_101550934 207
49 3300025933 Ga0207706_10012323 Ga0207706_100123234 207
50 3300025949 Ga0207667_10000310 Ga0207667_1000031022 207
51 3300025949 Ga0207667_10025118 Ga0207667_100251184 207
52 3300025949 Ga0207667_10032730 Ga0207667_1003273010 207
53 3300025949 Ga0207667_10599229 Ga0207667_105992293 207
54 3300025981 Ga0207640_10000068 Ga0207640_1000006820 207
55 3300025981 Ga0207640_10046257 Ga0207640_100462574 207
56 3300026078 Ga0207702_10150115 Ga0207702_101501151 207
57 3300026116 Ga0207674_10090460 Ga0207674_100904604 207
58 3300042012 Ga0439455_0094200 Ga0439455_0094200_125_748 207
59 3300044656 Ga0466969_0015615 Ga0466969_0015615_3167_3796 207
60 3300044672 Ga0466982_0000006 Ga0466982_0000006_286143_286772 207
61 3300044684 Ga0466966_0000477 Ga0466966_0000477_3969_4598 207
62 3300044694 Ga0466963_0388014 Ga0466963_0388014_236_865 207
63 3300044719 Ga0466971_0001620 Ga0466971_0001620_1985_2614 207
64 3300044735 Ga0466968_0004412 Ga0466968_0004412_1287_1916 207
65 3300044765 Ga0466970_0022857 Ga0466970_0022857_1480_2109 207
66 3300044842 Ga0466957_0125277 Ga0466957_0125277_725_1354 207
67 3300044901 Ga0466960_0031608 Ga0466960_0031608_725_1354 207
68 3300045049 Ga0466959_0164309 Ga0466959_0164309_673_1302 207
69 3300045836 Ga0466958_0027954 Ga0466958_0027954_761_1390 207
70 3300046528 Ga0495642_0000077 Ga0495642_0000077_51366_51989 207
71 3300046692 Ga0495671_0010746 Ga0495671_0010746_940_1563 207
72 3300046692 Ga0495671_0018295 Ga0495671_0018295_2585_3208 207
73 3300047320 Ga0495672_0001174 Ga0495672_0001174_20077_20700 207
74 3300047320 Ga0495672_0003612 Ga0495672_0003612_545_1168 207
75 3300047469 Ga0495673_0000350 Ga0495673_0000350_51366_51989 207
76 3300049586 Ga0501070_0031575 Ga0501070_0031575_1608_2237 207
77 3300049742 Ga0501080_0216626 Ga0501080_0216626_142_771 207
78 3300061719 Ga0466962_0002158 Ga0466962_0002158_2751_3380 207
79 3300005336 Ga0070680_100474520 Ga0070680_1004745202 208
80 3300005458 Ga0070681_10000015 Ga0070681_1000001568 208
81 3300013100 Ga0157373_10094224 Ga0157373_100942242 208
82 3300025912 Ga0207707_10000161 Ga0207707_1000016135 208
83 3300042876 Ga0451577_0047101 Ga0451577_0047101_2817_3443 208
84 3300042876 Ga0451577_0061413 Ga0451577_0061413_1749_2375 208
85 3300044683 Ga0466965_0102393 Ga0466965_0102393_483_1109 208
86 3300045051 Ga0451576_0000621 Ga0451576_0000621_46306_46932 208
87 3300049587 Ga0501071_0090174 Ga0501071_0090174_480_1106 208
88 3300001915 JGI24741J21665_1004217 JGI24741J21665_10042171 209
89 3300001979 JGI24740J21852_10006910 JGI24740J21852_100069103 209
90 3300005327 Ga0070658_10323857 Ga0070658_103238572 209
91 3300005327 Ga0070658_10368364 Ga0070658_103683643 209
92 3300005329 Ga0070683_100053356 Ga0070683_1000533563 209
93 3300005336 Ga0070680_100073429 Ga0070680_1000734291 209
94 3300005337 Ga0070682_100075285 Ga0070682_1000752852 209
95 3300005337 Ga0070682_100276918 Ga0070682_1002769182 209
96 3300005339 Ga0070660_100013635 Ga0070660_1000136354 209
97 3300005339 Ga0070660_100015985 Ga0070660_1000159855 209
98 3300005341 Ga0070691_10026631 Ga0070691_100266313 209
99 3300005344 Ga0070661_100049910 Ga0070661_1000499102 209
100 3300005344 Ga0070661_100057445 Ga0070661_1000574452 209
101 3300005345 Ga0070692_10014928 Ga0070692_100149282 209
102 3300005455 Ga0070663_100294704 Ga0070663_1002947042 209
103 3300005455 Ga0070663_100413167 Ga0070663_1004131672 209
104 3300005458 Ga0070681_10438928 Ga0070681_104389282 209
105 3300005530 Ga0070679_100543516 Ga0070679_1005435162 209
106 3300005535 Ga0070684_100089705 Ga0070684_1000897051 209
107 3300005535 Ga0070684_100195562 Ga0070684_1001955622 209
108 3300005539 Ga0068853_100012119 Ga0068853_1000121192 209
109 3300005546 Ga0070696_100041487 Ga0070696_1000414872 209
110 3300005563 Ga0068855_100540530 Ga0068855_1005405302 209
111 3300005577 Ga0068857_100012518 Ga0068857_1000125184 209
112 3300005614 Ga0068856_100107584 Ga0068856_1001075845 209
113 3300005616 Ga0068852_100223068 Ga0068852_1002230683 209
114 3300005834 Ga0068851_10152801 Ga0068851_101528012 209
115 3300009093 Ga0105240_10026029 Ga0105240_100260293 209
116 3300009148 Ga0105243_10492351 Ga0105243_104923512 209
117 3300009174 Ga0105241_10185116 Ga0105241_101851162 209
118 3300013100 Ga0157373_10060193 Ga0157373_100601932 209
119 3300013102 Ga0157371_10020103 Ga0157371_100201033 209
120 3300013104 Ga0157370_10135940 Ga0157370_101359403 209
121 3300013105 Ga0157369_10146436 Ga0157369_101464362 209
122 3300013105 Ga0157369_10228972 Ga0157369_102289722 209
123 3300013307 Ga0157372_10052909 Ga0157372_100529093 209
124 3300014969 Ga0157376_10365276 Ga0157376_103652762 209
125 3300020069 Ga0197907_10094875 Ga0197907_100948752 209
126 3300020070 Ga0206356_10647139 Ga0206356_106471397 209
127 3300020077 Ga0206351_10166290 Ga0206351_101662902 209
128 3300020078 Ga0206352_10438213 Ga0206352_104382132 209
129 3300020080 Ga0206350_10233428 Ga0206350_102334282 209
130 3300020081 Ga0206354_10072506 Ga0206354_100725062 209
131 3300020081 Ga0206354_10287451 Ga0206354_102874515 209
132 3300020082 Ga0206353_10516896 Ga0206353_105168963 209
133 3300020082 Ga0206353_10819831 Ga0206353_108198313 209
134 3300020610 Ga0154015_1153483 Ga0154015_11534833 209
135 3300025250 Ga0209026_1003406 Ga0209026_10034063 209
136 3300025321 Ga0207656_10039032 Ga0207656_100390322 209
137 3300025904 Ga0207647_10008395 Ga0207647_100083953 209
138 3300025909 Ga0207705_10001380 Ga0207705_1000138012 209
139 3300025909 Ga0207705_10017993 Ga0207705_100179936 209
140 3300025912 Ga0207707_10000065 Ga0207707_1000006539 209
141 3300025912 Ga0207707_10002991 Ga0207707_1000299110 209
142 3300025913 Ga0207695_10008721 Ga0207695_100087215 209
143 3300025913 Ga0207695_10180949 Ga0207695_101809492 209
144 3300025917 Ga0207660_10004075 Ga0207660_100040756 209
145 3300025917 Ga0207660_10004119 Ga0207660_100041194 209
146 3300025919 Ga0207657_10011996 Ga0207657_100119967 209
147 3300025919 Ga0207657_10012298 Ga0207657_100122985 209
148 3300025920 Ga0207649_10133707 Ga0207649_101337071 209
149 3300025920 Ga0207649_10135327 Ga0207649_101353273 209
150 3300025921 Ga0207652_10020202 Ga0207652_100202025 209
151 3300025932 Ga0207690_10082044 Ga0207690_100820441 209
152 3300025934 Ga0207686_10001330 Ga0207686_1000133011 209
153 3300025944 Ga0207661_10042441 Ga0207661_100424415 209
154 3300025944 Ga0207661_10234133 Ga0207661_102341333 209
155 3300025945 Ga0207679_10171390 Ga0207679_101713902 209
156 3300025949 Ga0207667_10009034 Ga0207667_100090345 209
157 3300025949 Ga0207667_10017298 Ga0207667_100172986 209
158 3300025981 Ga0207640_10037420 Ga0207640_100374205 209
159 3300025981 Ga0207640_10117679 Ga0207640_101176791 209
160 3300026041 Ga0207639_10031547 Ga0207639_100315473 209
161 3300026067 Ga0207678_10009462 Ga0207678_100094627 209
162 3300026067 Ga0207678_10009669 Ga0207678_100096696 209
163 3300026067 Ga0207678_10316514 Ga0207678_103165142 209
164 3300026078 Ga0207702_10005080 Ga0207702_100050809 209
165 3300026116 Ga0207674_10036080 Ga0207674_100360806 209
166 3300026116 Ga0207674_10087208 Ga0207674_100872082 209
167 3300026142 Ga0207698_10002461 Ga0207698_100024619 209
168 3300046452 Ga0495617_049488 Ga0495617_049488_255_908 209
169 3300046517 Ga0495630_0032162 Ga0495630_0032162_1717_2370 209
170 3300046526 Ga0495666_0047048 Ga0495666_0047048_809_1462 209
171 3300046530 Ga0495654_0011412 Ga0495654_0011412_584_1237 209
172 3300046542 Ga0495597_0000092 Ga0495597_0000092_72678_73364 209
173 3300046691 Ga0495670_0005461 Ga0495670_0005461_2233_2886 209
174 3300046692 Ga0495671_0007285 Ga0495671_0007285_5594_6247 209
175 3300047469 Ga0495673_0001784 Ga0495673_0001784_3575_4228 209
176 3300048091 Ga0495626_0000119 Ga0495626_0000119_76974_77627 209
177 3300048917 Ga0496114_0014635 Ga0496114_0014635_1804_2451 209
178 3300048925 Ga0496122_0008995 Ga0496122_0008995_4247_4894 209
179 3300048928 Ga0496125_0003359 Ga0496125_0003359_14032_14679 209
180 3300049570 Ga0501033_0192183 Ga0501033_0192183_188_817 209
181 3300049571 Ga0501034_0391961 Ga0501034_0391961_127_756 209
182 3300049573 Ga0501037_0014384 Ga0501037_0014384_3596_4225 209
183 3300049574 Ga0501038_0148311 Ga0501038_0148311_83_712 209
184 3300049581 Ga0501047_0359375 Ga0501047_0359375_354_983 209
185 3300049585 Ga0501069_0000180 Ga0501069_0000180_18157_18786 209
186 3300049585 Ga0501069_0004452 Ga0501069_0004452_5335_5964 209
187 3300049585 Ga0501069_0025043 Ga0501069_0025043_587_1216 209
188 3300049586 Ga0501070_0008312 Ga0501070_0008312_649_1278 209
189 3300049586 Ga0501070_0021254 Ga0501070_0021254_1888_2643 209
190 3300049586 Ga0501070_0025998 Ga0501070_0025998_4073_4702 209
191 3300049586 Ga0501070_0082220 Ga0501070_0082220_1433_2062 209
192 3300049586 Ga0501070_0092319 Ga0501070_0092319_280_909 209
193 3300049589 Ga0501073_0013534 Ga0501073_0013534_1931_2560 209
194 3300049590 Ga0501074_0010164 Ga0501074_0010164_5781_6410 209
195 3300049590 Ga0501074_0013105 Ga0501074_0013105_5263_5892 209
196 3300049590 Ga0501074_0054566 Ga0501074_0054566_1902_2531 209
197 3300049741 Ga0501079_0324259 Ga0501079_0324259_486_1115 209
198 3300049742 Ga0501080_0023759 Ga0501080_0023759_165_794 209
199 3300049822 Ga0501035_0005799 Ga0501035_0005799_5013_5642 209
200 3300049822 Ga0501035_0012950 Ga0501035_0012950_3476_4105 209
201 3300049822 Ga0501035_0201891 Ga0501035_0201891_168_797 209
202 3300049823 Ga0501044_0018874 Ga0501044_0018874_1535_2164 209
203 3300049823 Ga0501044_0072132 Ga0501044_0072132_2133_2762 209
204 3300049823 Ga0501044_0089728 Ga0501044_0089728_1599_2228 209
205 3300001915 JGI24741J21665_1000615 JGI24741J21665_10006158 210
206 3300001915 JGI24741J21665_1009412 JGI24741J21665_10094123 210
207 3300001979 JGI24740J21852_10000222 JGI24740J21852_100002223 210
208 3300005327 Ga0070658_10082438 Ga0070658_100824382 210
209 3300005335 Ga0070666_10157802 Ga0070666_101578022 210
210 3300005336 Ga0070680_100000301 Ga0070680_10000030129 210
211 3300005336 Ga0070680_100008519 Ga0070680_1000085197 210
212 3300005337 Ga0070682_100001936 Ga0070682_1000019363 210
213 3300005339 Ga0070660_100016246 Ga0070660_1000162463 210
214 3300005341 Ga0070691_10000178 Ga0070691_1000017811 210
215 3300005344 Ga0070661_100029733 Ga0070661_1000297332 210
216 3300005345 Ga0070692_10004465 Ga0070692_100044656 210
217 3300005347 Ga0070668_100033077 Ga0070668_1000330773 210
218 3300005347 Ga0070668_100203127 Ga0070668_1002031272 210
219 3300005355 Ga0070671_100113579 Ga0070671_1001135792 210
220 3300005364 Ga0070673_100295936 Ga0070673_1002959362 210
221 3300005367 Ga0070667_100000040 Ga0070667_10000004042 210
222 3300005367 Ga0070667_100065297 Ga0070667_1000652972 210
223 3300005367 Ga0070667_100102301 Ga0070667_1001023012 210
224 3300005455 Ga0070663_100000152 Ga0070663_10000015230 210
225 3300005455 Ga0070663_100007949 Ga0070663_1000079491 210
226 3300005455 Ga0070663_100231100 Ga0070663_1002311002 210
227 3300005457 Ga0070662_100900483 Ga0070662_1009004831 210
228 3300005458 Ga0070681_10000062 Ga0070681_1000006224 210
229 3300005458 Ga0070681_10000088 Ga0070681_100000884 210
230 3300005530 Ga0070679_100000061 Ga0070679_10000006116 210
231 3300005530 Ga0070679_100000188 Ga0070679_10000018824 210
232 3300005539 Ga0068853_100000897 Ga0068853_10000089716 210
233 3300005539 Ga0068853_100004247 Ga0068853_1000042477 210
234 3300005539 Ga0068853_100016747 Ga0068853_1000167473 210
235 3300005539 Ga0068853_100042220 Ga0068853_1000422203 210
236 3300005539 Ga0068853_100241284 Ga0068853_1002412841 210
237 3300005539 Ga0068853_100272304 Ga0068853_1002723043 210
238 3300005546 Ga0070696_100000213 Ga0070696_10000021310 210
239 3300005547 Ga0070693_100001310 Ga0070693_1000013105 210
240 3300005547 Ga0070693_100007118 Ga0070693_1000071183 210
241 3300005548 Ga0070665_100015064 Ga0070665_1000150644 210
242 3300005548 Ga0070665_100047560 Ga0070665_1000475603 210
243 3300005548 Ga0070665_100071462 Ga0070665_1000714623 210
244 3300005563 Ga0068855_100003760 Ga0068855_10000376018 210
245 3300005563 Ga0068855_100017314 Ga0068855_1000173143 210
246 3300005563 Ga0068855_100095903 Ga0068855_1000959032 210
247 3300005563 Ga0068855_100338848 Ga0068855_1003388482 210
248 3300005564 Ga0070664_100010265 Ga0070664_1000102659 210
249 3300005577 Ga0068857_100028820 Ga0068857_1000288202 210
250 3300005577 Ga0068857_100108119 Ga0068857_1001081192 210
251 3300005578 Ga0068854_100001352 Ga0068854_1000013527 210
252 3300005578 Ga0068854_100019485 Ga0068854_1000194852 210
253 3300005578 Ga0068854_100116105 Ga0068854_1001161052 210
254 3300005578 Ga0068854_100424328 Ga0068854_1004243282 210
255 3300005614 Ga0068856_100018258 Ga0068856_1000182582 210
256 3300005614 Ga0068856_100380636 Ga0068856_1003806362 210
257 3300005614 Ga0068856_100909253 Ga0068856_1009092531 210
258 3300005616 Ga0068852_100012685 Ga0068852_1000126855 210
259 3300005616 Ga0068852_100062840 Ga0068852_1000628403 210
260 3300005616 Ga0068852_100198781 Ga0068852_1001987812 210
261 3300005617 Ga0068859_100000979 Ga0068859_10000097920 210
262 3300005617 Ga0068859_100773775 Ga0068859_1007737752 210
263 3300005834 Ga0068851_10011316 Ga0068851_100113163 210
264 3300005834 Ga0068851_10147779 Ga0068851_101477791 210
265 3300005841 Ga0068863_100044420 Ga0068863_1000444203 210
266 3300005841 Ga0068863_100372586 Ga0068863_1003725862 210
267 3300005842 Ga0068858_100297926 Ga0068858_1002979262 210
268 3300005842 Ga0068858_100464023 Ga0068858_1004640232 210
269 3300005842 Ga0068858_100496493 Ga0068858_1004964932 210
270 3300005843 Ga0068860_100072217 Ga0068860_1000722172 210
271 3300005844 Ga0068862_100000224 Ga0068862_10000022410 210
272 3300006237 Ga0097621_100050721 Ga0097621_1000507213 210
273 3300006237 Ga0097621_100473045 Ga0097621_1004730452 210
274 3300006931 Ga0097620_100000979 Ga0097620_1000009793 210
275 3300006931 Ga0097620_100773825 Ga0097620_1007738252 210
276 3300009093 Ga0105240_10031009 Ga0105240_100310094 210
277 3300009093 Ga0105240_10124734 Ga0105240_101247342 210
278 3300009093 Ga0105240_10251999 Ga0105240_102519993 210
279 3300009101 Ga0105247_10220829 Ga0105247_102208292 210
280 3300009174 Ga0105241_10042730 Ga0105241_100427302 210
281 3300009174 Ga0105241_10144740 Ga0105241_101447402 210
282 3300009174 Ga0105241_10266966 Ga0105241_102669662 210
283 3300009177 Ga0105248_10005513 Ga0105248_100055133 210
284 3300009177 Ga0105248_10134512 Ga0105248_101345122 210
285 3300009545 Ga0105237_10001863 Ga0105237_1000186322 210
286 3300009545 Ga0105237_10267037 Ga0105237_102670372 210
287 3300009545 Ga0105237_10573998 Ga0105237_105739982 210
288 3300009551 Ga0105238_10013703 Ga0105238_100137033 210
289 3300009553 Ga0105249_10022676 Ga0105249_100226763 210
290 3300010375 Ga0105239_10005286 Ga0105239_1000528614 210
291 3300010375 Ga0105239_10039059 Ga0105239_100390593 210
292 3300010375 Ga0105239_10383296 Ga0105239_103832962 210
293 3300010375 Ga0105239_10805383 Ga0105239_108053832 210
294 3300013100 Ga0157373_10036715 Ga0157373_100367152 210
295 3300013102 Ga0157371_10137229 Ga0157371_101372292 210
296 3300013102 Ga0157371_10416621 Ga0157371_104166211 210
297 3300013104 Ga0157370_10068309 Ga0157370_100683095 210
298 3300013104 Ga0157370_10074695 Ga0157370_100746953 210
299 3300013104 Ga0157370_10800439 Ga0157370_108004391 210
300 3300013105 Ga0157369_10087774 Ga0157369_100877743 210
301 3300013105 Ga0157369_10241982 Ga0157369_102419822 210
302 3300013296 Ga0157374_10178371 Ga0157374_101783712 210
303 3300013307 Ga0157372_10010645 Ga0157372_100106457 210
304 3300013307 Ga0157372_10116984 Ga0157372_101169843 210
305 3300013307 Ga0157372_10167359 Ga0157372_101673594 210
306 3300013308 Ga0157375_10083021 Ga0157375_100830214 210
307 3300014968 Ga0157379_10107009 Ga0157379_101070093 210
308 3300014968 Ga0157379_10114850 Ga0157379_101148502 210
309 3300014969 Ga0157376_10207632 Ga0157376_102076322 210
310 3300014969 Ga0157376_10521714 Ga0157376_105217141 210
311 3300020070 Ga0206356_10143582 Ga0206356_101435822 210
312 3300020070 Ga0206356_11433262 Ga0206356_114332624 210
313 3300020078 Ga0206352_10430462 Ga0206352_104304622 210
314 3300020080 Ga0206350_10220779 Ga0206350_102207792 210
315 3300020081 Ga0206354_10039073 Ga0206354_100390731 210
316 3300020081 Ga0206354_10107429 Ga0206354_101074296 210
317 3300020082 Ga0206353_10251616 Ga0206353_102516162 210
318 3300020610 Ga0154015_1494868 Ga0154015_14948683 210
319 3300025303 Ga0209051_1022830 Ga0209051_10228302 210
320 3300025321 Ga0207656_10027123 Ga0207656_100271232 210
321 3300025321 Ga0207656_10121485 Ga0207656_101214851 210
322 3300025898 Ga0207692_10273968 Ga0207692_102739682 210
323 3300025903 Ga0207680_10038056 Ga0207680_100380562 210
324 3300025904 Ga0207647_10000197 Ga0207647_1000019712 210
325 3300025907 Ga0207645_10069130 Ga0207645_100691302 210
326 3300025909 Ga0207705_10000097 Ga0207705_1000009729 210
327 3300025909 Ga0207705_10129337 Ga0207705_101293372 210
328 3300025912 Ga0207707_10000084 Ga0207707_1000008424 210
329 3300025912 Ga0207707_10000144 Ga0207707_1000014430 210
330 3300025912 Ga0207707_10000949 Ga0207707_1000094921 210
331 3300025913 Ga0207695_10003204 Ga0207695_1000320417 210
332 3300025913 Ga0207695_10011037 Ga0207695_100110376 210
333 3300025914 Ga0207671_10004436 Ga0207671_100044365 210
334 3300025914 Ga0207671_10129322 Ga0207671_101293222 210
335 3300025914 Ga0207671_10482396 Ga0207671_104823962 210
336 3300025917 Ga0207660_10000368 Ga0207660_1000036821 210
337 3300025917 Ga0207660_10000561 Ga0207660_1000056125 210
338 3300025919 Ga0207657_10001354 Ga0207657_1000135424 210
339 3300025919 Ga0207657_10024718 Ga0207657_100247186 210
340 3300025920 Ga0207649_10013832 Ga0207649_100138326 210
341 3300025920 Ga0207649_10530492 Ga0207649_105304921 210
342 3300025921 Ga0207652_10000076 Ga0207652_1000007625 210
343 3300025921 Ga0207652_10000082 Ga0207652_1000008231 210
344 3300025921 Ga0207652_10000339 Ga0207652_1000033939 210
345 3300025932 Ga0207690_10000122 Ga0207690_100001223 210
346 3300025932 Ga0207690_10044039 Ga0207690_100440392 210
347 3300025938 Ga0207704_10052761 Ga0207704_100527613 210
348 3300025938 Ga0207704_10060583 Ga0207704_100605832 210
349 3300025940 Ga0207691_10568751 Ga0207691_105687512 210
350 3300025941 Ga0207711_10000300 Ga0207711_1000030017 210
351 3300025942 Ga0207689_10019723 Ga0207689_100197232 210
352 3300025944 Ga0207661_10012498 Ga0207661_100124986 210
353 3300025944 Ga0207661_10530025 Ga0207661_105300251 210
354 3300025949 Ga0207667_10003803 Ga0207667_100038031 210
355 3300025949 Ga0207667_10010439 Ga0207667_100104397 210
356 3300025949 Ga0207667_10022369 Ga0207667_100223692 210
357 3300025949 Ga0207667_10144147 Ga0207667_101441474 210
358 3300025949 Ga0207667_10250078 Ga0207667_102500782 210
359 3300025961 Ga0207712_10046925 Ga0207712_100469253 210
360 3300025972 Ga0207668_10033571 Ga0207668_100335712 210
361 3300025986 Ga0207658_10000289 Ga0207658_100002899 210
362 3300025986 Ga0207658_10748003 Ga0207658_107480032 210
363 3300026023 Ga0207677_10134925 Ga0207677_101349252 210
364 3300026041 Ga0207639_10004110 Ga0207639_100041107 210
365 3300026041 Ga0207639_10004170 Ga0207639_100041703 210
366 3300026041 Ga0207639_10011650 Ga0207639_100116509 210
367 3300026041 Ga0207639_10025097 Ga0207639_100250973 210
368 3300026041 Ga0207639_10040946 Ga0207639_100409462 210
369 3300026067 Ga0207678_10000886 Ga0207678_1000088624 210
370 3300026067 Ga0207678_10014594 Ga0207678_100145943 210
371 3300026067 Ga0207678_10025483 Ga0207678_100254832 210
372 3300026078 Ga0207702_10277804 Ga0207702_102778042 210
373 3300026088 Ga0207641_10050550 Ga0207641_100505503 210
374 3300026088 Ga0207641_10093058 Ga0207641_100930583 210
375 3300026089 Ga0207648_10029212 Ga0207648_100292121 210
376 3300026116 Ga0207674_10001405 Ga0207674_1000140510 210
377 3300026116 Ga0207674_10206511 Ga0207674_102065112 210
378 3300026142 Ga0207698_10001187 Ga0207698_1000118712 210
379 3300026142 Ga0207698_10144578 Ga0207698_101445783 210
380 3300026142 Ga0207698_10220011 Ga0207698_102200112 210
381 3300026142 Ga0207698_10244391 Ga0207698_102443912 210
382 3300026142 Ga0207698_10289829 Ga0207698_102898292 210
383 3300026142 Ga0207698_10403999 Ga0207698_104039992 210
384 3300028379 Ga0268266_10011433 Ga0268266_100114334 210
385 3300028379 Ga0268266_10073164 Ga0268266_100731642 210
386 3300028379 Ga0268266_10123182 Ga0268266_101231821 210
387 3300028379 Ga0268266_10237902 Ga0268266_102379022 210
388 3300028380 Ga0268265_10000054 Ga0268265_1000005467 210
389 3300028381 Ga0268264_10239377 Ga0268264_102393772 210
390 3300028381 Ga0268264_10546776 Ga0268264_105467762 210
391 3300037312 Ga0395899_0023204 Ga0395899_0023204_3142_3807 210
392 3300037418 Ga0395900_0011530 Ga0395900_0011530_2435_3100 210
393 3300037466 Ga0395898_0027888 Ga0395898_0027888_3393_4058 210
394 3300037466 Ga0395898_0037918 Ga0395898_0037918_633_1265 210
395 3300038443 Ga0395901_0037786 Ga0395901_0037786_718_1350 210
396 3300041451 Ga0451791_1352661 Ga0451791_1352661_1000_1632 210
397 3300041452 Ga0451793_1599871 Ga0451793_1599871_3336_3968 210
398 3300041456 Ga0451795_1372122 Ga0451795_1372122_32_664 210
399 3300041460 Ga0451802_0357610 Ga0451802_0357610_2647_3279 210
400 3300041486 Ga0451807_0385942 Ga0451807_0385942_1684_2316 210
401 3300041491 Ga0451833_0619325 Ga0451833_0619325_1930_2562 210
402 3300041509 Ga0451843_0599071 Ga0451843_0599071_627_1259 210
403 3300041512 Ga0451853_1501317 Ga0451853_1501317_1113_1745 210
404 3300041512 Ga0451853_2978688 Ga0451853_2978688_2393_3025 210
405 3300041512 Ga0451853_3087106 Ga0451853_3087106_718_1350 210
406 3300044658 Ga0466972_0002522 Ga0466972_0002522_439_1071 210
407 3300044765 Ga0466970_0002639 Ga0466970_0002639_479_1111 210
408 3300046694 Ga0495649_0039369 Ga0495649_0039369_1758_2390 210
409 3300047472 Ga0495686_0001204 Ga0495686_0001204_17095_17727 210
410 3300048917 Ga0496114_0195130 Ga0496114_0195130_817_1449 210
411 3300048918 Ga0496115_0028975 Ga0496115_0028975_1435_2073 210
412 3300048925 Ga0496122_0000037 Ga0496122_0000037_271300_271932 210
413 3300048926 Ga0496123_0000870 Ga0496123_0000870_3317_3949 210
414 3300048929 Ga0496126_0062077 Ga0496126_0062077_214_846 210
415 3300049568 Ga0501031_0008999 Ga0501031_0008999_2540_3172 210
416 3300049569 Ga0501032_0001914 Ga0501032_0001914_10455_11087 210
417 3300049569 Ga0501032_0009729 Ga0501032_0009729_3376_4008 210
418 3300049570 Ga0501033_0000829 Ga0501033_0000829_1855_2487 210
419 3300049570 Ga0501033_0031029 Ga0501033_0031029_2923_3555 210
420 3300049571 Ga0501034_0011901 Ga0501034_0011901_1855_2487 210
421 3300049571 Ga0501034_0015535 Ga0501034_0015535_3998_4630 210
422 3300049571 Ga0501034_0163331 Ga0501034_0163331_1220_1855 210
423 3300049572 Ga0501036_0004321 Ga0501036_0004321_3688_4320 210
424 3300049572 Ga0501036_0007458 Ga0501036_0007458_6275_6907 210
425 3300049573 Ga0501037_0003610 Ga0501037_0003610_5539_6171 210
426 3300049573 Ga0501037_0003874 Ga0501037_0003874_1029_1661 210
427 3300049573 Ga0501037_0015717 Ga0501037_0015717_1003_1638 210
428 3300049574 Ga0501038_0002541 Ga0501038_0002541_6010_6642 210
429 3300049574 Ga0501038_0002630 Ga0501038_0002630_6986_7618 210
430 3300049575 Ga0501039_0010284 Ga0501039_0010284_1921_2553 210
431 3300049575 Ga0501039_0030151 Ga0501039_0030151_3226_3858 210
432 3300049576 Ga0501040_0121471 Ga0501040_0121471_783_1415 210
433 3300049578 Ga0501042_0129339 Ga0501042_0129339_929_1561 210
434 3300049579 Ga0501043_0007129 Ga0501043_0007129_2814_3446 210
435 3300049579 Ga0501043_0046759 Ga0501043_0046759_1407_2039 210
436 3300049580 Ga0501046_0002816 Ga0501046_0002816_2358_2990 210
437 3300049580 Ga0501046_0007359 Ga0501046_0007359_46_678 210
438 3300049580 Ga0501046_0057226 Ga0501046_0057226_398_1030 210
439 3300049581 Ga0501047_0014016 Ga0501047_0014016_4319_4954 210
440 3300049581 Ga0501047_0020484 Ga0501047_0020484_1651_2283 210
441 3300049581 Ga0501047_0030256 Ga0501047_0030256_2734_3366 210
442 3300049581 Ga0501047_0411093 Ga0501047_0411093_158_790 210
443 3300049582 Ga0501048_0035553 Ga0501048_0035553_1330_1962 210
444 3300049583 Ga0501067_0063993 Ga0501067_0063993_779_1411 210
445 3300049583 Ga0501067_0124406 Ga0501067_0124406_500_1132 210
446 3300049584 Ga0501068_0023707 Ga0501068_0023707_2007_2639 210
447 3300049585 Ga0501069_0031113 Ga0501069_0031113_464_1099 210
448 3300049585 Ga0501069_0073206 Ga0501069_0073206_523_1155 210
449 3300049586 Ga0501070_0002090 Ga0501070_0002090_11837_12469 210
450 3300049586 Ga0501070_0027859 Ga0501070_0027859_495_1169 210
451 3300049586 Ga0501070_0047209 Ga0501070_0047209_765_1397 210
452 3300049586 Ga0501070_0162717 Ga0501070_0162717_740_1375 210
453 3300049586 Ga0501070_0347605 Ga0501070_0347605_501_1133 210
454 3300049586 Ga0501070_0438158 Ga0501070_0438158_315_947 210
455 3300049587 Ga0501071_0029357 Ga0501071_0029357_1369_2004 210
456 3300049587 Ga0501071_0061905 Ga0501071_0061905_472_1104 210
457 3300049589 Ga0501073_0009080 Ga0501073_0009080_1220_1855 210
458 3300049589 Ga0501073_0032228 Ga0501073_0032228_311_943 210
459 3300049589 Ga0501073_0032764 Ga0501073_0032764_325_957 210
460 3300049589 Ga0501073_0243898 Ga0501073_0243898_116_748 210
461 3300049590 Ga0501074_0006123 Ga0501074_0006123_3489_4121 210
462 3300049590 Ga0501074_0235303 Ga0501074_0235303_573_1208 210
463 3300049590 Ga0501074_0435251 Ga0501074_0435251_83_715 210
464 3300049590 Ga0501074_0475541 Ga0501074_0475541_98_730 210
465 3300049592 Ga0501076_0219266 Ga0501076_0219266_294_929 210
466 3300049593 Ga0501077_0012062 Ga0501077_0012062_1081_1755 210
467 3300049741 Ga0501079_0028545 Ga0501079_0028545_192_824 210
468 3300049741 Ga0501079_0524442 Ga0501079_0524442_187_822 210
469 3300049742 Ga0501080_0045535 Ga0501080_0045535_3295_3927 210
470 3300049742 Ga0501080_0064379 Ga0501080_0064379_455_1087 210
471 3300049742 Ga0501080_0071929 Ga0501080_0071929_1461_2096 210
472 3300049742 Ga0501080_0103940 Ga0501080_0103940_1692_2324 210
473 3300049742 Ga0501080_0234682 Ga0501080_0234682_537_1175 210
474 3300049744 Ga0501083_0341975 Ga0501083_0341975_96_731 210
475 3300049822 Ga0501035_0020050 Ga0501035_0020050_1445_2077 210
476 3300049822 Ga0501035_0022587 Ga0501035_0022587_4459_5091 210
477 3300049822 Ga0501035_0087590 Ga0501035_0087590_1896_2528 210
478 3300049822 Ga0501035_0102127 Ga0501035_0102127_185_817 210
479 3300049822 Ga0501035_0188965 Ga0501035_0188965_63_698 210
480 3300049823 Ga0501044_0005848 Ga0501044_0005848_11962_12594 210
481 3300049823 Ga0501044_0024076 Ga0501044_0024076_4408_5043 210
482 3300049823 Ga0501044_0048251 Ga0501044_0048251_3575_4207 210
483 3300049823 Ga0501044_0087987 Ga0501044_0087987_268_900 210
484 3300049823 Ga0501044_0219516 Ga0501044_0219516_120_752 210
485 3300049823 Ga0501044_0366520 Ga0501044_0366520_504_1136 210
486 3300053087 Ga0500643_001211 Ga0500643_001211_3610_4242 210
487 3300053093 Ga0500651_0042925 Ga0500651_0042925_204_836 210
488 3300053120 Ga0500597_000073 Ga0500597_000073_16575_17207 210
489 3300053129 Ga0500628_014365 Ga0500628_014365_157_789 210
490 3300053155 Ga0500620_002893 Ga0500620_002893_2661_3293 210
491 3300054114 Ga0501084_0042898 Ga0501084_0042898_183_815 210
492 3300054114 Ga0501084_0330278 Ga0501084_0330278_630_1262 210
493 3300060353 Ga0501082_0373708 Ga0501082_0373708_331_963 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

55

244

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8989 2 203
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8983 2 203
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8914 2 203
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8827 2 203
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8801 2 203
ID Description Score Start End Superfamily
af_Q9M042_1_161_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9032 2 200 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8882 2 203 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8878 1 200 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.882 2 203 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8712 1 200 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A370WZA2-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9906 1 206
AF-A0A410UK98-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9888 1 206
AF-A0A354Z851-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9884 71 207
AF-A0A7X7SQ68-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9874 1 208
AF-A0A2S7D3Q3-F1-model_v4 Phosphatidylethanolamine-binding protein 0.9874 1 208

Feature Viewer

pLDDT pTM Quality
96.62 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map