F454435

General Info

Members Datasets Scaffolds Average Seq Length
493 332 464 260

Family's Representative Sequence

Representative Sequence 3300025256|Ga0209759_1001140|Ga0209759_10011405
Length 287
Sequence MALPNLPELFAMPDFDALLPIALHGLALIALLGLGTWVASLVRHDASLVDRMWSLMIAGPALVYAAQTSWTTPRAIAVQVLVLTWGLRLAAYITWRNWGHGEDRRYQQIRARNEPHFALKSLLIVFALQMVLAWIVTAPALAALVGRRGLGALDVAGITVALAGFLFEAIGDAQMAAFKREPANRGRVMDRGLWRFTRHPNYFGEACFWWGVWLIALAAGGLGAAWTVVSPLLMTVLLLKVSGVALLEKDIGERRPAYRDYIARTNAFIPGRPRGLASPAPAPGSRR

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2738541277 Variovorax sp. GV051 Isolate Unclassified
6 2738541307 Variovorax sp. GV008 Isolate Unclassified
7 2738543019 Variovorax sp. GV040 Isolate Unclassified
8 2818991446 Variovorax sp. 1180 Isolate Unclassified
9 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
10 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
11 2842677519 Variovorax sp. R-72495 Isolate Unclassified
12 2842733646 Variovorax sp. R-72446 Isolate Unclassified
13 2842747753 Variovorax sp. R-72060 Isolate Unclassified
14 2885198086 Variovorax sp. 679 Isolate Unclassified
15 2885211737 Variovorax sp. 553 Isolate Unclassified
16 2899924645 Variovorax sp. 369 Isolate Unclassified
17 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
18 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
19 2928037797 Variovorax sp. 1126 Isolate Unclassified
20 2928044640 Variovorax sp. 1128 Isolate Unclassified
21 2928051484 Variovorax sp. 1133 Isolate Unclassified
22 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
23 2928070936 Variovorax gossypii 1167 Isolate Unclassified
24 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
25 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
26 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
27 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
28 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
29 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
203 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
204 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
205 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
206 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
211 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
312 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
325 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.71
Metatranscriptomes 0.41
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.17
Nodule 0.41
Rhizoplane 2.23
Rhizosphere 58.01
Stem 0
Stem Tuber 0
Unclassified 13.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011266 3300001979 Bacteria 3409
2 JGI24739J22299_10028999 3300001989 Bacteria 1928
3 JGI25156J39149_1000250 3300002705 Bacteria 37027
4 JGI25154J39366_1000822 3300002738 Bacteria 13468
5 JGI25157J39369_1000027 3300002741 Bacteria 147448
6 JGI25152J39213_1001782 3300002773 Bacteria 8760
7 JGI25152J39213_1003930 3300002773 Bacteria 4870
8 JGI25150J39212_1000489 3300002774 Bacteria 16689
9 JGI25159J45721_1000405 3300002987 Bacteria 20050
10 JGI25159J45721_1005983 3300002987 Bacteria 3722
11 JGI25151J46595_10001020 3300003187 Bacteria 21030
12 JGI25151J46595_10017389 3300003187 Bacteria 3119
13 JGI25406J46586_10024516 3300003203 Bacteria 2361
14 JGI25153J46596_10000667 3300003215 Bacteria 21030
15 JGI25153J46596_10004269 3300003215 Bacteria 7733
16 JGI25153J46596_10013036 3300003215 Bacteria 3542
17 rootH1_10084040 3300003316 Bacteria 3430
18 rootH2_10001994 3300003320 Bacteria 2434
19 rootH2_10001995 3300003320 Bacteria 4135
20 rootH2_10038664 3300003320 Bacteria 8477
21 rootH1_10028275 3300003323 Bacteria 6357
22 rootH1_10038052 3300003323 Bacteria 7931
23 JGI25160J50197_1000610 3300003354 Bacteria 20050
24 JGI25160J50197_1004983 3300003354 Bacteria 5633
25 JGI25161J50226_1000462 3300003374 Bacteria 18715
26 JGI25161J50226_1001148 3300003374 Bacteria 8829
27 Ga0006562J51391_1187520 3300003578 Bacteria 3185
28 Ga0006562J51391_1187522 3300003578 Bacteria 1470
29 Ga0055539_1000213 3300003752 Bacteria 42508
30 Ga0055533_1000073 3300003756 Bacteria 142476
31 Ga0055535_1000338 3300003761 Bacteria 46755
32 Ga0055542_1000103 3300003762 Bacteria 114989
33 Ga0055526_1001065 3300003771 Bacteria 20050
34 Ga0055526_1003242 3300003771 Bacteria 10479
35 Ga0055526_1021208 3300003771 Bacteria 2270
36 Ga0055537_1000558 3300003773 Bacteria 21027
37 Ga0055537_1001751 3300003773 Bacteria 7982
38 Ga0055524_1000454 3300003775 Bacteria 33792
39 Ga0055524_1000847 3300003775 Bacteria 20050
40 Ga0055524_1001073 3300003775 Bacteria 16793
41 Ga0055536_1002194 3300003781 Bacteria 11122
42 Ga0055536_1033357 3300003781 Bacteria 1317
43 Ga0055534_1000524 3300003784 Bacteria 20674
44 Ga0055528_1000834 3300003790 Bacteria 21027
45 Ga0055528_1007360 3300003790 Bacteria 4872
46 Ga0055530_10000342 3300003791 Bacteria 42139
47 Ga0055540_1001923 3300003792 Bacteria 11609
48 Ga0055540_1013330 3300003792 Bacteria 2519
49 Ga0055531_10002005 3300003794 Bacteria 14137
50 Ga0055531_10002643 3300003794 Bacteria 11837
51 Ga0055531_10025658 3300003794 Bacteria 2132
52 Ga0055543_1000420 3300004625 Bacteria 26756
53 Ga0055543_1000674 3300004625 Bacteria 17821
54 Ga0065165_1000727 3300005262 Bacteria 46035
55 Ga0065165_1001375 3300005262 Bacteria 26747
56 Ga0065165_1003647 3300005262 Bacteria 10519
57 Ga0070658_10009746 3300005327 Bacteria 7714
58 Ga0070658_10019306 3300005327 Bacteria 5459
59 Ga0070658_10122956 3300005327 Bacteria 2158
60 Ga0070658_10407827 3300005327 Bacteria 1168
61 Ga0070676_10002168 3300005328 Bacteria 10013
62 Ga0070683_100197544 3300005329 Bacteria 1910
63 Ga0070690_100165934 3300005330 Bacteria 1517
64 Ga0070670_100101334 3300005331 Bacteria 2479
65 Ga0070670_100293365 3300005331 Bacteria 1421
66 Ga0070677_10002636 3300005333 Bacteria 5738
67 Ga0068869_100039148 3300005334 Bacteria 3383
68 Ga0070660_100034574 3300005339 Bacteria 3819
69 Ga0070660_100196629 3300005339 Bacteria 1635
70 Ga0070669_100062853 3300005353 Bacteria 2731
71 Ga0070669_100327288 3300005353 Bacteria 1239
72 Ga0070675_100048834 3300005354 Bacteria 3471
73 Ga0070675_100107370 3300005354 Bacteria 2357
74 Ga0070671_100039946 3300005355 Bacteria 3895
75 Ga0070671_100190626 3300005355 Bacteria 1737
76 Ga0070674_100021368 3300005356 Bacteria 4153
77 Ga0070674_100031753 3300005356 Bacteria 3502
78 Ga0070674_100445044 3300005356 Bacteria 1068
79 Ga0070673_100014147 3300005364 Bacteria 5545
80 Ga0070673_100057112 3300005364 Bacteria 3083
81 Ga0070673_100058750 3300005364 Bacteria 3042
82 Ga0070673_100063496 3300005364 Bacteria 2939
83 Ga0070673_100436403 3300005364 Bacteria 1176
84 Ga0070688_100209736 3300005365 Bacteria 1367
85 Ga0070688_100216897 3300005365 Unclassified 1346
86 Ga0070667_100030174 3300005367 Bacteria 4521
87 Ga0070667_100063789 3300005367 Bacteria 3124
88 Ga0070701_10125537 3300005438 Bacteria 1452
89 Ga0070663_100010056 3300005455 Bacteria 5883
90 Ga0070678_100059442 3300005456 Bacteria 2809
91 Ga0070678_100125427 3300005456 Bacteria 2032
92 Ga0070678_100339855 3300005456 Bacteria 1287
93 Ga0070662_100063142 3300005457 Bacteria 2708
94 Ga0070662_100136498 3300005457 Bacteria 1897
95 Ga0068867_100282914 3300005459 Bacteria 1360
96 Ga0070685_10143304 3300005466 Unclassified 1507
97 Ga0068853_100011269 3300005539 Bacteria 7256
98 Ga0070672_100006556 3300005543 Bacteria 7831
99 Ga0070672_100056419 3300005543 Bacteria 3080
100 Ga0070672_100066157 3300005543 Bacteria 2861
101 Ga0070665_100048395 3300005548 Bacteria 4269
102 Ga0068855_100012007 3300005563 Bacteria 10473
103 Ga0068855_100062920 3300005563 Bacteria 4331
104 Ga0068855_100162338 3300005563 Bacteria 2535
105 Ga0070664_100047846 3300005564 Bacteria 3614
106 Ga0070664_100098539 3300005564 Bacteria 2539
107 Ga0068857_100000496 3300005577 Bacteria 28278
108 Ga0068854_100001904 3300005578 Bacteria 12709
109 Ga0068856_100013896 3300005614 Bacteria 7787
110 Ga0070702_100143369 3300005615 Unclassified 1524
111 Ga0068852_100095558 3300005616 Bacteria 2669
112 Ga0068852_100254537 3300005616 Bacteria 1683
113 Ga0068864_100316068 3300005618 Bacteria 1465
114 Ga0068861_100084371 3300005719 Bacteria 2494
115 Ga0068870_10183822 3300005840 Bacteria 1257
116 Ga0068863_100283419 3300005841 Bacteria 1606
117 Ga0068858_100024019 3300005842 Bacteria 5680
118 Ga0068860_100017865 3300005843 Bacteria 6907
119 Ga0068862_100008022 3300005844 Bacteria 8738
120 Ga0081539_10003186 3300005985 Bacteria 20762
121 Ga0075364_10008608 3300006051 Bacteria 6102
122 Ga0075366_10008924 3300006195 Bacteria 5588
123 Ga0097621_100145011 3300006237 Bacteria 2032
124 Ga0075370_10001046 3300006353 Bacteria 11505
125 Ga0075370_10091311 3300006353 Bacteria 1757
126 Ga0068871_100183307 3300006358 Bacteria 1800
127 Ga0075430_100021253 3300006846 Bacteria 5518
128 Ga0075429_100048946 3300006880 Bacteria 3675
129 Ga0105244_10085212 3300009036 Bacteria 1559
130 Ga0105240_10080524 3300009093 Bacteria 4005
131 Ga0105240_10147254 3300009093 Bacteria 2808
132 Ga0105240_10302339 3300009093 Bacteria 1830
133 Ga0111539_10442492 3300009094 Bacteria 1513
134 Ga0111539_10847105 3300009094 Bacteria 1064
135 Ga0105245_10133495 3300009098 Bacteria 2330
136 Ga0105241_10155862 3300009174 Bacteria 1873
137 Ga0105242_10007627 3300009176 Bacteria 8327
138 Ga0105248_10174487 3300009177 Bacteria 2423
139 Ga0105237_10051539 3300009545 Bacteria 4134
140 Ga0105238_10058996 3300009551 Bacteria 3845
141 Ga0105238_10725233 3300009551 Bacteria 1007
142 Ga0105239_10148120 3300010375 Bacteria 2619
143 Ga0105246_10117303 3300011119 Bacteria 1966
144 Ga0157319_1000006 3300012497 Bacteria 361506
145 Ga0157370_10004322 3300013104 Bacteria 16333
146 Ga0157369_10058014 3300013105 Bacteria 4176
147 Ga0157378_10624954 3300013297 Bacteria 1090
148 Ga0163162_10028639 3300013306 Bacteria 5513
149 Ga0163162_10174960 3300013306 Bacteria 2272
150 Ga0163162_10529534 3300013306 Bacteria 1307
151 Ga0157375_10050672 3300013308 Bacteria 4073
152 Ga0157375_10056482 3300013308 Bacteria 3875
153 Ga0157375_10668361 3300013308 Bacteria 1194
154 Ga0163163_10276978 3300014325 Bacteria 1729
155 Ga0182008_10000400 3300014497 Bacteria 33653
156 Ga0182008_10005123 3300014497 Bacteria 7523
157 Ga0157377_10011592 3300014745 Bacteria 4407
158 Ga0157379_10110992 3300014968 Bacteria 2463
159 Ga0182006_1083814 3300015261 Bacteria 1159
160 Ga0182007_10002167 3300015262 Bacteria 9970
161 Ga0163161_10008137 3300017792 Bacteria 7252
162 Ga0163161_10088345 3300017792 Bacteria 2291
163 Ga0163161_10211315 3300017792 Bacteria 1499
164 Ga0213876_10018611 3300021384 Bacteria 3668
165 Ga0209436_101114 3300025208 Bacteria 9960
166 Ga0209436_102111 3300025208 Bacteria 6233
167 Ga0209674_100039 3300025226 Bacteria 402292
168 Ga0209672_101942 3300025228 Bacteria 5849
169 Ga0209147_100483 3300025229 Bacteria 23927
170 Ga0209563_100110 3300025230 Bacteria 142518
171 Ga0207427_100388 3300025231 Bacteria 26461
172 Ga0209258_100133 3300025242 Bacteria 174846
173 Ga0209258_100567 3300025242 Bacteria 31694
174 Ga0207425_1000260 3300025245 Bacteria 39085
175 Ga0207425_1000282 3300025245 Bacteria 37515
176 Ga0207425_1001985 3300025245 Bacteria 7650
177 Ga0209646_1000231 3300025246 Bacteria 59119
178 Ga0209026_1000011 3300025250 Bacteria 507291
179 Ga0209677_100123 3300025253 Bacteria 80295
180 Ga0209677_100287 3300025253 Bacteria 33491
181 Ga0209677_104139 3300025253 Bacteria 4335
182 Ga0209148_1000188 3300025254 Bacteria 117310
183 Ga0209759_1000107 3300025256 Bacteria 147025
184 Ga0209759_1001140 3300025256 Bacteria 16991
185 Ga0209129_1000012 3300025258 Bacteria 541516
186 Ga0209129_1000425 3300025258 Bacteria 32039
187 Ga0209129_1000436 3300025258 Bacteria 31077
188 Ga0209565_1000165 3300025263 Bacteria 86871
189 Ga0209565_1000820 3300025263 Bacteria 17662
190 Ga0209673_1000454 3300025273 Bacteria 69331
191 Ga0209673_1001101 3300025273 Bacteria 30262
192 Ga0209673_1011107 3300025273 Bacteria 3738
193 Ga0209673_1011231 3300025273 Bacteria 3706
194 Ga0209130_1000427 3300025284 Bacteria 45224
195 Ga0209130_1000924 3300025284 Bacteria 23585
196 Ga0209675_1000321 3300025291 Bacteria 43024
197 Ga0209675_1001260 3300025291 Bacteria 15176
198 Ga0209675_1002144 3300025291 Bacteria 10409
199 Ga0209676_1000111 3300025292 Bacteria 213411
200 Ga0209676_1001670 3300025292 Bacteria 19271
201 Ga0209676_1030213 3300025292 Bacteria 1660
202 Ga0209025_1000686 3300025294 Bacteria 58086
203 Ga0209025_1001318 3300025294 Bacteria 33769
204 Ga0209025_1010672 3300025294 Bacteria 6187
205 Ga0209025_1026829 3300025294 Bacteria 2876
206 Ga0209564_1000022 3300025295 Bacteria 555109
207 Ga0209564_1000070 3300025295 Bacteria 303126
208 Ga0209564_1000352 3300025295 Bacteria 85941
209 Ga0209758_1000198 3300025297 Bacteria 133584
210 Ga0209758_1000297 3300025297 Bacteria 97664
211 Ga0209758_1003512 3300025297 Bacteria 14157
212 Ga0209050_1000111 3300025298 Bacteria 213411
213 Ga0209256_1000047 3300025299 Bacteria 314709
214 Ga0209256_1000238 3300025299 Bacteria 97664
215 Ga0209256_1001030 3300025299 Bacteria 32745
216 Ga0207426_1000194 3300025302 Bacteria 150009
217 Ga0207426_1000294 3300025302 Bacteria 98700
218 Ga0209051_1000340 3300025303 Bacteria 70080
219 Ga0209051_1012012 3300025303 Bacteria 4226
220 Ga0209257_1000690 3300025304 Bacteria 52373
221 Ga0209257_1001321 3300025304 Bacteria 30158
222 Ga0209257_1001472 3300025304 Bacteria 27715
223 Ga0207697_10011631 3300025315 Bacteria 3716
224 Ga0207656_10007230 3300025321 Bacteria 4032
225 Ga0207682_10005031 3300025893 Bacteria 5419
226 Ga0207682_10024121 3300025893 Bacteria 2407
227 Ga0207688_10012812 3300025901 Bacteria 4559
228 Ga0207645_10001804 3300025907 Bacteria 17289
229 Ga0207705_10090331 3300025909 Bacteria 2242
230 Ga0207705_10217374 3300025909 Bacteria 1451
231 Ga0207654_10105101 3300025911 Bacteria 1746
232 Ga0207695_10021906 3300025913 Bacteria 7274
233 Ga0207695_10105599 3300025913 Bacteria 2803
234 Ga0207695_10233343 3300025913 Bacteria 1743
235 Ga0207671_10278100 3300025914 Bacteria 1320
236 Ga0207657_10011824 3300025919 Bacteria 8641
237 Ga0207657_10209456 3300025919 Bacteria 1565
238 Ga0207681_10077086 3300025923 Bacteria 2342
239 Ga0207681_10218224 3300025923 Bacteria 1474
240 Ga0207694_10038070 3300025924 Bacteria 3697
241 Ga0207650_10005595 3300025925 Bacteria 8585
242 Ga0207650_10157511 3300025925 Bacteria 1797
243 Ga0207659_10078880 3300025926 Bacteria 2427
244 Ga0207659_10126095 3300025926 Bacteria 1969
245 Ga0207644_10123995 3300025931 Bacteria 1970
246 Ga0207644_10401475 3300025931 Bacteria 1120
247 Ga0207706_10067774 3300025933 Bacteria 3141
248 Ga0207706_10080743 3300025933 Bacteria 2859
249 Ga0207706_10111615 3300025933 Bacteria 2405
250 Ga0207706_10176295 3300025933 Bacteria 1878
251 Ga0207686_10001268 3300025934 Bacteria 14522
252 Ga0207686_10206254 3300025934 Bacteria 1410
253 Ga0207670_10338474 3300025936 Bacteria 1188
254 Ga0207669_10069638 3300025937 Bacteria 2202
255 Ga0207669_10254891 3300025937 Bacteria 1309
256 Ga0207691_10007218 3300025940 Bacteria 10717
257 Ga0207691_10010611 3300025940 Bacteria 8838
258 Ga0207691_10107584 3300025940 Bacteria 2482
259 Ga0207689_10014750 3300025942 Bacteria 6635
260 Ga0207661_10145681 3300025944 Bacteria 2043
261 Ga0207679_10115166 3300025945 Bacteria 2129
262 Ga0207679_10200584 3300025945 Bacteria 1666
263 Ga0207667_10014499 3300025949 Bacteria 8983
264 Ga0207651_10060165 3300025960 Bacteria 2635
265 Ga0207640_10010683 3300025981 Bacteria 5179
266 Ga0207658_10244132 3300025986 Bacteria 1523
267 Ga0207658_10426312 3300025986 Bacteria 1171
268 Ga0207677_10115355 3300026023 Bacteria 2009
269 Ga0207703_10035895 3300026035 Bacteria 3942
270 Ga0207639_10008330 3300026041 Bacteria 7105
271 Ga0207639_10206998 3300026041 Bacteria 1686
272 Ga0207678_10006442 3300026067 Bacteria 10413
273 Ga0207678_10334383 3300026067 Bacteria 1304
274 Ga0207702_10000270 3300026078 Bacteria 59607
275 Ga0207648_10007828 3300026089 Bacteria 10431
276 Ga0207648_10070575 3300026089 Bacteria 3045
277 Ga0207648_10203906 3300026089 Bacteria 1755
278 Ga0207676_10100829 3300026095 Bacteria 2393
279 Ga0207674_10003612 3300026116 Bacteria 18862
280 Ga0207675_100013307 3300026118 Bacteria 7680
281 Ga0207675_100045092 3300026118 Bacteria 4120
282 Ga0207675_100133237 3300026118 Unclassified 2357
283 Ga0207683_10011446 3300026121 Bacteria 7571
284 Ga0207683_10017558 3300026121 Bacteria 6100
285 Ga0207683_10040285 3300026121 Bacteria 4075
286 Ga0207683_10067781 3300026121 Bacteria 3149
287 Ga0207698_10419850 3300026142 Bacteria 1283
288 Ga0209282_1217279 3300027666 Bacteria 868
289 Ga0265334_10042817 3300028573 Bacteria 1764
290 Ga0265336_10000022 3300028666 Bacteria 192716
291 Ga0307515_10021161 3300028794 Bacteria 11549
292 Ga0265324_10005667 3300029957 Bacteria 5336
293 Ga0316177_1131487 3300030731 Bacteria 2440
294 Ga0316178_1107021 3300030735 Bacteria 10593
295 Ga0316183_1091282 3300030742 Bacteria 20839
296 Ga0316181_1090846 3300030744 Bacteria 5072
297 Ga0265330_10019835 3300031235 Bacteria 3074
298 Ga0265327_10000327 3300031251 Bacteria 90721
299 Ga0307509_10205357 3300031507 Bacteria 1801
300 Ga0316575_10123220 3300031665 Bacteria 1061
301 Ga0316579_10068157 3300031691 Bacteria 1682
302 Ga0316578_10125863 3300031728 Unclassified 1541
303 Ga0307516_10025219 3300031730 Bacteria 6056
304 Ga0307405_10691042 3300031731 Bacteria 844
305 Ga0307412_10003587 3300031911 Bacteria 8620
306 Ga0307416_100011500 3300032002 Bacteria 5908
307 Ga0307411_10366764 3300032005 Bacteria 1180
308 Ga0373931_0010782 3300035691 Bacteria 4400
309 Ga0373937_0067294 3300036401 Bacteria 3300
310 Ga0373937_0179714 3300036401 Unclassified 1987
311 Ga0373925_0247764 3300037068 Bacteria 1428
312 Ga0395898_0069276 3300037466 Bacteria 3413
313 Ga0395905_0096937 3300037471 Bacteria 2769
314 Ga0395905_0665512 3300037471 Bacteria 943
315 Ga0436365_1480692 3300039437 Bacteria 10773
316 Ga0451853_2804152 3300041512 Bacteria 1294
317 Ga0439445_0002631 3300042004 Bacteria 3997
318 Ga0439455_0005516 3300042012 Bacteria 2575
319 Ga0450911_000185 3300042115 Bacteria 24854
320 Ga0451577_0095219 3300042876 Bacteria 2658
321 Ga0466963_0035097 3300044694 Bacteria 3266
322 Ga0466963_0179685 3300044694 Bacteria 1477
323 Ga0453684_0101220 3300044712 Bacteria 3525
324 Ga0453684_0593910 3300044712 Bacteria 1214
325 Ga0466957_0020924 3300044842 Bacteria 3850
326 Ga0451576_0104504 3300045051 Bacteria 2946
327 Ga0466967_0021387 3300045976 Bacteria 5253
328 Ga0495629_0113153 3300046459 Bacteria 1892
329 Ga0495651_0134467 3300046462 Bacteria 1801
330 Ga0495651_0235537 3300046462 Bacteria 1258
331 Ga0495650_0001042 3300046471 Bacteria 30968
332 Ga0495650_0004944 3300046471 Bacteria 8892
333 Ga0495639_0011236 3300046475 Bacteria 3858
334 Ga0495583_0000164 3300046506 Bacteria 112062
335 Ga0495606_0001489 3300046507 Bacteria 31133
336 Ga0495608_0156646 3300046511 Bacteria 1450
337 Ga0495610_0048904 3300046512 Bacteria 2073
338 Ga0495610_0085071 3300046512 Bacteria 1444
339 Ga0495616_0000350 3300046513 Bacteria 36334
340 Ga0495620_0010958 3300046515 Bacteria 4755
341 Ga0495620_0123504 3300046515 Bacteria 1019
342 Ga0495628_0251874 3300046516 Bacteria 1318
343 Ga0495630_0000714 3300046517 Bacteria 23478
344 Ga0495631_0000182 3300046518 Bacteria 42891
345 Ga0495637_0005214 3300046520 Bacteria 6658
346 Ga0495637_0049029 3300046520 Bacteria 1776
347 Ga0495652_0048602 3300046529 Bacteria 3634
348 Ga0495621_0015140 3300046539 Bacteria 2455
349 Ga0495656_0005544 3300046615 Bacteria 4360
350 Ga0495625_0026207 3300046660 Bacteria 4408
351 Ga0495625_0033000 3300046660 Bacteria 3833
352 Ga0495625_0037321 3300046660 Bacteria 3566
353 Ga0495635_0067847 3300046663 Bacteria 2446
354 Ga0495661_0097486 3300046665 Bacteria 1661
355 Ga0495588_0003415 3300046674 Bacteria 6905
356 Ga0495657_0030285 3300046675 Bacteria 3792
357 Ga0495670_0305038 3300046691 Bacteria 853
358 Ga0495671_0011682 3300046692 Bacteria 4817
359 Ga0495649_0001452 3300046694 Bacteria 17830
360 Ga0495589_0024524 3300046794 Bacteria 3066
361 Ga0495600_0049428 3300046809 Bacteria 2744
362 Ga0495581_0297656 3300047315 Bacteria 943
363 Ga0495604_0030421 3300047317 Bacteria 4288
364 Ga0495676_0347900 3300047321 Bacteria 991
365 Ga0495686_0023741 3300047472 Bacteria 4038
366 Ga0495614_0031447 3300048089 Bacteria 2284
367 Ga0496103_0306873 3300048906 Bacteria 1021
368 Ga0496108_0025314 3300048911 Bacteria 4890
369 Ga0496109_0160511 3300048912 Bacteria 2106
370 Ga0496110_0100793 3300048913 Bacteria 2588
371 Ga0496110_0328938 3300048913 Bacteria 1392
372 Ga0496113_0013520 3300048916 Bacteria 5535
373 Ga0496114_0018095 3300048917 Bacteria 5694
374 Ga0496114_0065814 3300048917 Bacteria 3037
375 Ga0496117_0015763 3300048920 Bacteria 6417
376 Ga0496117_0253971 3300048920 Bacteria 957
377 Ga0496118_0044115 3300048921 Bacteria 3495
378 Ga0496119_0032738 3300048922 Bacteria 3460
379 Ga0496121_0002770 3300048924 Bacteria 26007
380 Ga0496121_0003970 3300048924 Bacteria 20411
381 Ga0496121_0006784 3300048924 Bacteria 14029
382 Ga0496121_0103534 3300048924 Bacteria 2189
383 Ga0496121_0157683 3300048924 Bacteria 1663
384 Ga0496122_0000034 3300048925 Bacteria 320661
385 Ga0496122_0056202 3300048925 Bacteria 2936
386 Ga0496122_0176058 3300048925 Bacteria 1282
387 Ga0496122_0248869 3300048925 Bacteria 996
388 Ga0496123_0000069 3300048926 Bacteria 201579
389 Ga0496123_0012813 3300048926 Bacteria 7108
390 Ga0496123_0066207 3300048926 Bacteria 2290
391 Ga0496124_0002098 3300048927 Bacteria 26914
392 Ga0496124_0039338 3300048927 Bacteria 4100
393 Ga0496124_0109204 3300048927 Bacteria 2230
394 Ga0496124_0172180 3300048927 Bacteria 1675
395 Ga0496125_0005512 3300048928 Bacteria 14021
396 Ga0496125_0024648 3300048928 Bacteria 5526
397 Ga0496125_0028303 3300048928 Bacteria 5065
398 Ga0496125_0080178 3300048928 Bacteria 2499
399 Ga0496125_0131428 3300048928 Bacteria 1761
400 Ga0496125_0305786 3300048928 Bacteria 971
401 Ga0496126_0055580 3300048929 Bacteria 3581
402 Ga0501032_0178871 3300049569 Bacteria 1389
403 Ga0501033_0089603 3300049570 Bacteria 2250
404 Ga0501034_0000224 3300049571 Bacteria 107481
405 Ga0501039_0087218 3300049575 Bacteria 2431
406 Ga0501041_0029940 3300049577 Bacteria 3285
407 Ga0501042_0041450 3300049578 Bacteria 3274
408 Ga0501046_0186616 3300049580 Bacteria 1548
409 Ga0501047_0007163 3300049581 Bacteria 10480
410 Ga0501048_0011300 3300049582 Bacteria 6657
411 Ga0501067_0110412 3300049583 Bacteria 1529
412 Ga0501068_0004405 3300049584 Bacteria 7658
413 Ga0501068_0126029 3300049584 Bacteria 1599
414 Ga0501070_0420078 3300049586 Bacteria 1080
415 Ga0501072_0002629 3300049588 Bacteria 13467
416 Ga0501072_0069187 3300049588 Bacteria 2787
417 Ga0501073_0004182 3300049589 Bacteria 10828
418 Ga0501074_0017231 3300049590 Bacteria 5242
419 Ga0501074_0083986 3300049590 Bacteria 2283
420 Ga0501075_0247688 3300049591 Bacteria 1358
421 Ga0501077_0119224 3300049593 Bacteria 1672
422 Ga0501249_001690 3300049679 Bacteria 4501
423 Ga0501225_0001600 3300049705 Bacteria 7080
424 Ga0501080_0003598 3300049742 Bacteria 13645
425 Ga0501080_0107340 3300049742 Bacteria 2588
426 Ga0501083_0021092 3300049744 Bacteria 4528
427 Ga0501262_000243 3300049759 Bacteria 6726
428 Ga0501035_0351930 3300049822 Bacteria 1232
429 Ga0501044_0101201 3300049823 Bacteria 2899
430 Ga0501045_0022744 3300049824 Bacteria 4490
431 nmdc:mga00v17_6785_c2 3300050491 Bacteria 2840
432 nmdc:mga0k408_3538_c1 3300050493 Bacteria 8251
433 nmdc:mga07m45_10440_c1 3300050496 Bacteria 4851
434 nmdc:mga07m45_1090_c1 3300050496 Bacteria 12102
435 nmdc:mga0qj67_123767_c1 3300050509 Bacteria 2092
436 Ga0495601_0006750 3300053077 Bacteria 6721
437 Ga0500610_0000424 3300053079 Bacteria 13016
438 Ga0500610_0000721 3300053079 Bacteria 10319
439 Ga0500635_0000237 3300053080 Bacteria 24396
440 Ga0500635_0006347 3300053080 Bacteria 3154
441 Ga0495619_0004392 3300053085 Bacteria 8994
442 Ga0495619_0016762 3300053085 Bacteria 4639
443 Ga0500643_009531 3300053087 Bacteria 3701
444 Ga0500643_062510 3300053087 Bacteria 1043
445 Ga0500644_0019949 3300053088 Bacteria 1986
446 Ga0500593_002973 3300053117 Bacteria 6311
447 Ga0500594_0000469 3300053118 Bacteria 8865
448 Ga0500607_114868 3300053121 Bacteria 1313
449 Ga0500655_000096 3300053133 Bacteria 23067
450 Ga0500658_0001231 3300053134 Bacteria 10410
451 Ga0500559_0004378 3300053136 Bacteria 6723
452 Ga0500559_0060760 3300053136 Bacteria 1684
453 Ga0500564_065359 3300053138 Bacteria 1646
454 Ga0500568_0000111 3300053139 Bacteria 75413
455 Ga0500573_0014690 3300053140 Bacteria 4433
456 Ga0500590_010171 3300053148 Bacteria 4745
457 Ga0500616_0069065 3300053153 Bacteria 1807
458 Ga0500622_0004724 3300053156 Bacteria 8418
459 Ga0500627_0001793 3300053158 Bacteria 6105
460 Ga0500634_0028374 3300053161 Bacteria 3049
461 Ga0500634_0030027 3300053161 Bacteria 2962
462 Ga0500638_033270 3300053162 Bacteria 2492
463 Ga0501084_0303825 3300054114 Bacteria 1348
464 Ga0501082_0074400 3300060353 Bacteria 2926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10206254 Ga0207686_102062541 215
2 3300006358 Ga0068871_100183307 Ga0068871_1001833072 219
3 3300009098 Ga0105245_10133495 Ga0105245_101334953 219
4 3300005364 Ga0070673_100436403 Ga0070673_1004364032 221
5 3300005328 Ga0070676_10002168 Ga0070676_100021682 222
6 3300005330 Ga0070690_100165934 Ga0070690_1001659342 222
7 3300005331 Ga0070670_100101334 Ga0070670_1001013342 222
8 3300005333 Ga0070677_10002636 Ga0070677_100026363 222
9 3300005334 Ga0068869_100039148 Ga0068869_1000391483 222
10 3300005353 Ga0070669_100062853 Ga0070669_1000628534 222
11 3300005354 Ga0070675_100107370 Ga0070675_1001073702 222
12 3300005355 Ga0070671_100190626 Ga0070671_1001906262 222
13 3300005356 Ga0070674_100021368 Ga0070674_1000213684 222
14 3300005364 Ga0070673_100057112 Ga0070673_1000571123 222
15 3300005365 Ga0070688_100216897 Ga0070688_1002168972 222
16 3300005367 Ga0070667_100063789 Ga0070667_1000637892 222
17 3300005438 Ga0070701_10125537 Ga0070701_101255372 222
18 3300005456 Ga0070678_100125427 Ga0070678_1001254272 222
19 3300005457 Ga0070662_100136498 Ga0070662_1001364982 222
20 3300005466 Ga0070685_10143304 Ga0070685_101433042 222
21 3300005543 Ga0070672_100006556 Ga0070672_1000065569 222
22 3300005615 Ga0070702_100143369 Ga0070702_1001433692 222
23 3300005719 Ga0068861_100084371 Ga0068861_1000843713 222
24 3300005842 Ga0068858_100024019 Ga0068858_1000240194 222
25 3300005844 Ga0068862_100008022 Ga0068862_1000080227 222
26 3300009094 Ga0111539_10442492 Ga0111539_104424922 222
27 3300009177 Ga0105248_10174487 Ga0105248_101744873 222
28 3300013306 Ga0163162_10028639 Ga0163162_100286395 222
29 3300013308 Ga0157375_10056482 Ga0157375_100564824 222
30 3300014325 Ga0163163_10276978 Ga0163163_102769782 222
31 3300017792 Ga0163161_10088345 Ga0163161_100883453 222
32 3300025315 Ga0207697_10011631 Ga0207697_100116314 222
33 3300025893 Ga0207682_10005031 Ga0207682_100050312 222
34 3300025901 Ga0207688_10012812 Ga0207688_100128123 222
35 3300025907 Ga0207645_10001804 Ga0207645_1000180412 222
36 3300025923 Ga0207681_10077086 Ga0207681_100770863 222
37 3300025931 Ga0207644_10123995 Ga0207644_101239952 222
38 3300025933 Ga0207706_10176295 Ga0207706_101762952 222
39 3300025940 Ga0207691_10007218 Ga0207691_100072189 222
40 3300025942 Ga0207689_10014750 Ga0207689_100147506 222
41 3300025986 Ga0207658_10244132 Ga0207658_102441322 222
42 3300026023 Ga0207677_10115355 Ga0207677_101153553 222
43 3300026035 Ga0207703_10035895 Ga0207703_100358953 222
44 3300026089 Ga0207648_10007828 Ga0207648_1000782810 222
45 3300026095 Ga0207676_10100829 Ga0207676_101008293 222
46 3300026118 Ga0207675_100013307 Ga0207675_1000133076 222
47 3300026121 Ga0207683_10017558 Ga0207683_100175585 222
48 3300025925 Ga0207650_10157511 Ga0207650_101575113 223
49 3300025926 Ga0207659_10078880 Ga0207659_100788803 223
50 3300037471 Ga0395905_0665512 Ga0395905_0665512_21_725 225
51 3300031665 Ga0316575_10123220 Ga0316575_101232201 226
52 3300005354 Ga0070675_100048834 Ga0070675_1000488343 229
53 3300005456 Ga0070678_100339855 Ga0070678_1003398552 229
54 3300005543 Ga0070672_100056419 Ga0070672_1000564192 229
55 3300025893 Ga0207682_10024121 Ga0207682_100241212 229
56 3300025933 Ga0207706_10080743 Ga0207706_100807433 229
57 3300048925 Ga0496122_0248869 Ga0496122_0248869_18_791 229
58 3300049584 Ga0501068_0126029 Ga0501068_0126029_218_958 231
59 3300031728 Ga0316578_10125863 Ga0316578_101258632 232
60 3300049759 Ga0501262_000243 Ga0501262_000243_4585_5391 233
61 3300048920 Ga0496117_0253971 Ga0496117_0253971_13_735 235
62 3300013306 Ga0163162_10529534 Ga0163162_105295342 236
63 3300031691 Ga0316579_10068157 Ga0316579_100681572 236
64 3300046539 Ga0495621_0015140 Ga0495621_0015140_766_1518 236
65 3300046615 Ga0495656_0005544 Ga0495656_0005544_742_1494 236
66 3300003775 Ga0055524_1000454 Ga0055524_100045416 237
67 3300003794 Ga0055531_10025658 Ga0055531_100256582 237
68 3300006051 Ga0075364_10008608 Ga0075364_100086082 237
69 3300012497 Ga0157319_1000006 Ga0157319_100000672 237
70 3300025299 Ga0209256_1001030 Ga0209256_100103018 237
71 3300025304 Ga0209257_1001321 Ga0209257_100132115 237
72 3300050491 nmdc:mga00v17_6785_c2 nmdc:mga00v17_6785_c2_1406_2200 237
73 3300050496 nmdc:mga07m45_10440_c1 nmdc:mga07m45_10440_c1_2794_3609 237
74 3300025937 Ga0207669_10254891 Ga0207669_102548912 239
75 3300048927 Ga0496124_0172180 Ga0496124_0172180_802_1596 239
76 3300049570 Ga0501033_0089603 Ga0501033_0089603_637_1410 239
77 3300049575 Ga0501039_0087218 Ga0501039_0087218_274_1047 239
78 3300049577 Ga0501041_0029940 Ga0501041_0029940_1761_2534 239
79 3300049578 Ga0501042_0041450 Ga0501042_0041450_217_990 239
80 3300049580 Ga0501046_0186616 Ga0501046_0186616_631_1404 239
81 3300049582 Ga0501048_0011300 Ga0501048_0011300_3487_4260 239
82 3300049588 Ga0501072_0069187 Ga0501072_0069187_956_1729 239
83 3300049824 Ga0501045_0022744 Ga0501045_0022744_2295_3068 239
84 3300053161 Ga0500634_0030027 Ga0500634_0030027_1651_2451 239
85 3300005339 Ga0070660_100196629 Ga0070660_1001966292 240
86 3300005355 Ga0070671_100039946 Ga0070671_1000399463 240
87 3300005356 Ga0070674_100031753 Ga0070674_1000317532 240
88 3300005364 Ga0070673_100058750 Ga0070673_1000587503 240
89 3300005455 Ga0070663_100010056 Ga0070663_1000100562 240
90 3300005456 Ga0070678_100059442 Ga0070678_1000594423 240
91 3300005457 Ga0070662_100063142 Ga0070662_1000631422 240
92 3300005459 Ga0068867_100282914 Ga0068867_1002829141 240
93 3300005543 Ga0070672_100066157 Ga0070672_1000661573 240
94 3300005564 Ga0070664_100098539 Ga0070664_1000985392 240
95 3300005616 Ga0068852_100254537 Ga0068852_1002545372 240
96 3300005618 Ga0068864_100316068 Ga0068864_1003160682 240
97 3300005841 Ga0068863_100283419 Ga0068863_1002834191 240
98 3300006237 Ga0097621_100145011 Ga0097621_1001450112 240
99 3300013297 Ga0157378_10624954 Ga0157378_106249542 240
100 3300014745 Ga0157377_10011592 Ga0157377_100115922 240
101 3300014968 Ga0157379_10110992 Ga0157379_101109922 240
102 3300025321 Ga0207656_10007230 Ga0207656_100072304 240
103 3300025919 Ga0207657_10209456 Ga0207657_102094562 240
104 3300025931 Ga0207644_10401475 Ga0207644_104014752 240
105 3300025933 Ga0207706_10067774 Ga0207706_100677743 240
106 3300025940 Ga0207691_10010611 Ga0207691_100106113 240
107 3300026041 Ga0207639_10206998 Ga0207639_102069982 240
108 3300026067 Ga0207678_10006442 Ga0207678_100064425 240
109 3300026089 Ga0207648_10203906 Ga0207648_102039062 240
110 3300026121 Ga0207683_10040285 Ga0207683_100402854 240
111 3300026142 Ga0207698_10419850 Ga0207698_104198502 240
112 3300046515 Ga0495620_0123504 Ga0495620_0123504_144_935 240
113 3300002773 JGI25152J39213_1003930 JGI25152J39213_10039304 241
114 3300003215 JGI25153J46596_10004269 JGI25153J46596_100042697 241
115 3300003323 rootH1_10028275 rootH1_100282756 241
116 3300003771 Ga0055526_1021208 Ga0055526_10212082 241
117 3300006846 Ga0075430_100021253 Ga0075430_1000212534 241
118 3300006880 Ga0075429_100048946 Ga0075429_1000489462 241
119 3300025245 Ga0207425_1000260 Ga0207425_100026018 241
120 3300025258 Ga0209129_1000012 Ga0209129_100001247 241
121 3300025273 Ga0209673_1011231 Ga0209673_10112312 241
122 3300025295 Ga0209564_1000022 Ga0209564_1000022467 241
123 3300025297 Ga0209758_1000198 Ga0209758_100019860 241
124 3300027666 Ga0209282_1217279 Ga0209282_12172791 241
125 3300042876 Ga0451577_0095219 Ga0451577_0095219_439_1209 241
126 3300044712 Ga0453684_0101220 Ga0453684_0101220_1625_2395 241
127 3300044712 Ga0453684_0593910 Ga0453684_0593910_214_984 241
128 3300045051 Ga0451576_0104504 Ga0451576_0104504_1166_1936 241
129 3300048927 Ga0496124_0002098 Ga0496124_0002098_8817_9587 241
130 3300048928 Ga0496125_0028303 Ga0496125_0028303_1196_1966 241
131 3300050509 nmdc:mga0qj67_123767_c1 nmdc:mga0qj67_123767_c1_1163_1927 241
132 3300013308 Ga0157375_10050672 Ga0157375_100506724 242
133 3300030731 Ga0316177_1131487 Ga0316177_11314873 242
134 3300030744 Ga0316181_1090846 Ga0316181_10908467 242
135 3300032005 Ga0307411_10366764 Ga0307411_103667642 242
136 3300049679 Ga0501249_001690 Ga0501249_001690_3006_3812 242
137 3300049705 Ga0501225_0001600 Ga0501225_0001600_4950_5756 242
138 3300005356 Ga0070674_100445044 Ga0070674_1004450442 243
139 3300005843 Ga0068860_100017865 Ga0068860_1000178655 243
140 3300025936 Ga0207670_10338474 Ga0207670_103384742 243
141 3300025986 Ga0207658_10426312 Ga0207658_104263121 243
142 3300026089 Ga0207648_10070575 Ga0207648_100705753 243
143 3300026118 Ga0207675_100045092 Ga0207675_1000450922 243
144 3300031235 Ga0265330_10019835 Ga0265330_100198353 243
145 3300048924 Ga0496121_0006784 Ga0496121_0006784_1897_2676 243
146 iso_pu_bacteria 2928115317 2928118634 243
147 3300025926 Ga0207659_10126095 Ga0207659_101260952 244
148 3300025940 Ga0207691_10107584 Ga0207691_101075842 244
149 3300026067 Ga0207678_10334383 Ga0207678_103343832 244
150 3300048925 Ga0496122_0000034 Ga0496122_0000034_8384_9157 244
151 3300048926 Ga0496123_0000069 Ga0496123_0000069_166317_167090 244
152 3300005331 Ga0070670_100293365 Ga0070670_1002933652 245
153 3300005364 Ga0070673_100063496 Ga0070673_1000634963 245
154 3300005365 Ga0070688_100209736 Ga0070688_1002097362 245
155 3300005564 Ga0070664_100047846 Ga0070664_1000478463 245
156 3300005840 Ga0068870_10183822 Ga0068870_101838222 245
157 3300025925 Ga0207650_10005595 Ga0207650_100055952 245
158 3300025945 Ga0207679_10115166 Ga0207679_101151662 245
159 3300025945 Ga0207679_10200584 Ga0207679_102005842 245
160 3300026121 Ga0207683_10067781 Ga0207683_100677813 245
161 3300044694 Ga0466963_0179685 Ga0466963_0179685_689_1465 245
162 3300049569 Ga0501032_0178871 Ga0501032_0178871_557_1339 245
163 3300049571 Ga0501034_0000224 Ga0501034_0000224_24770_25552 245
164 3300049583 Ga0501067_0110412 Ga0501067_0110412_495_1277 245
165 3300049584 Ga0501068_0004405 Ga0501068_0004405_4077_4859 245
166 3300049586 Ga0501070_0420078 Ga0501070_0420078_243_1025 245
167 3300049588 Ga0501072_0002629 Ga0501072_0002629_7896_8678 245
168 3300049589 Ga0501073_0004182 Ga0501073_0004182_6816_7598 245
169 3300049590 Ga0501074_0017231 Ga0501074_0017231_1420_2202 245
170 3300049593 Ga0501077_0119224 Ga0501077_0119224_463_1245 245
171 3300049742 Ga0501080_0003598 Ga0501080_0003598_9809_10591 245
172 3300049744 Ga0501083_0021092 Ga0501083_0021092_1412_2194 245
173 3300060353 Ga0501082_0074400 Ga0501082_0074400_111_893 245
174 iso_pu_bacteria 2974320154 2974321052 245
175 3300005367 Ga0070667_100030174 Ga0070667_1000301745 246
176 3300013308 Ga0157375_10668361 Ga0157375_106683611 246
177 3300021384 Ga0213876_10018611 Ga0213876_100186113 246
178 3300030735 Ga0316178_1107021 Ga0316178_11070213 246
179 3300030742 Ga0316183_1091282 Ga0316183_10912827 246
180 3300037068 Ga0373925_0247764 Ga0373925_0247764_429_1214 246
181 3300039437 Ga0436365_1480692 Ga0436365_1480692_2906_3691 246
182 3300046459 Ga0495629_0113153 Ga0495629_0113153_604_1389 246
183 3300046511 Ga0495608_0156646 Ga0495608_0156646_454_1239 246
184 3300046516 Ga0495628_0251874 Ga0495628_0251874_203_988 246
185 3300046517 Ga0495630_0000714 Ga0495630_0000714_19741_20526 246
186 3300046663 Ga0495635_0067847 Ga0495635_0067847_225_1010 246
187 3300046675 Ga0495657_0030285 Ga0495657_0030285_218_1003 246
188 3300046809 Ga0495600_0049428 Ga0495600_0049428_1391_2176 246
189 3300047315 Ga0495581_0297656 Ga0495581_0297656_84_869 246
190 3300047321 Ga0495676_0347900 Ga0495676_0347900_81_866 246
191 3300048911 Ga0496108_0025314 Ga0496108_0025314_603_1415 246
192 3300048912 Ga0496109_0160511 Ga0496109_0160511_975_1787 246
193 3300048913 Ga0496110_0100793 Ga0496110_0100793_217_1029 246
194 3300048916 Ga0496113_0013520 Ga0496113_0013520_612_1397 246
195 3300048924 Ga0496121_0002770 Ga0496121_0002770_9105_9890 246
196 3300049581 Ga0501047_0007163 Ga0501047_0007163_2316_3101 246
197 3300049590 Ga0501074_0083986 Ga0501074_0083986_1398_2183 246
198 3300049742 Ga0501080_0107340 Ga0501080_0107340_584_1369 246
199 3300049822 Ga0501035_0351930 Ga0501035_0351930_296_1081 246
200 3300049823 Ga0501044_0101201 Ga0501044_0101201_2083_2868 246
201 3300053077 Ga0495601_0006750 Ga0495601_0006750_2775_3560 246
202 3300053085 Ga0495619_0004392 Ga0495619_0004392_7416_8201 246
203 iso_pu_bacteria 2738541307 2738882949 246
204 3300005262 Ga0065165_1000727 Ga0065165_100072713 247
205 3300006195 Ga0075366_10008924 Ga0075366_100089244 247
206 3300006353 Ga0075370_10001046 Ga0075370_1000104611 247
207 3300009094 Ga0111539_10847105 Ga0111539_108471051 247
208 3300025273 Ga0209673_1011107 Ga0209673_10111072 247
209 3300050493 nmdc:mga0k408_3538_c1 nmdc:mga0k408_3538_c1_2415_3203 247
210 3300050496 nmdc:mga07m45_1090_c1 nmdc:mga07m45_1090_c1_1886_2674 247
211 3300053156 Ga0500622_0004724 Ga0500622_0004724_1729_2544 247
212 3300053161 Ga0500634_0028374 Ga0500634_0028374_1845_2654 247
213 iso_pu_bacteria 2842747753 2842751115 247
214 3300003203 JGI25406J46586_10024516 JGI25406J46586_100245162 248
215 3300005327 Ga0070658_10019306 Ga0070658_100193062 248
216 3300005327 Ga0070658_10122956 Ga0070658_101229562 248
217 3300005339 Ga0070660_100034574 Ga0070660_1000345743 248
218 3300005563 Ga0068855_100162338 Ga0068855_1001623382 248
219 3300005985 Ga0081539_10003186 Ga0081539_1000318622 248
220 3300009176 Ga0105242_10007627 Ga0105242_100076278 248
221 3300011119 Ga0105246_10117303 Ga0105246_101173033 248
222 3300025253 Ga0209677_104139 Ga0209677_1041393 248
223 3300025909 Ga0207705_10217374 Ga0207705_102173742 248
224 3300025919 Ga0207657_10011824 Ga0207657_100118246 248
225 3300025934 Ga0207686_10001268 Ga0207686_100012688 248
226 3300031251 Ga0265327_10000327 Ga0265327_1000032766 248
227 3300046462 Ga0495651_0134467 Ga0495651_0134467_272_1057 248
228 3300046471 Ga0495650_0001042 Ga0495650_0001042_26807_27604 248
229 3300049591 Ga0501075_0247688 Ga0501075_0247688_166_957 248
230 3300054114 Ga0501084_0303825 Ga0501084_0303825_30_821 248
231 iso_pu_bacteria 2904541872 2904550001 248
232 iso_pu_bacteria 2929160207 2929164887 248
233 3300005548 Ga0070665_100048395 Ga0070665_1000483953 249
234 3300028666 Ga0265336_10000022 Ga0265336_1000002226 249
235 3300029957 Ga0265324_10005667 Ga0265324_100056673 249
236 3300036401 Ga0373937_0179714 Ga0373937_0179714_564_1367 249
237 3300048917 Ga0496114_0018095 Ga0496114_0018095_2114_2908 249
238 3300048928 Ga0496125_0080178 Ga0496125_0080178_347_1135 249
239 3300048929 Ga0496126_0055580 Ga0496126_0055580_1738_2526 249
240 iso_pu_bacteria 2738541277 2738723314 249
241 iso_pu_bacteria 2738543019 2739284045 249
242 iso_pu_bacteria 2885198086 2885198238 249
243 iso_pu_bacteria 2885211737 2885212382 249
244 iso_pu_bacteria 2928084124 2928088099 249
245 3300005353 Ga0070669_100327288 Ga0070669_1003272881 250
246 3300017792 Ga0163161_10211315 Ga0163161_102113151 250
247 3300025923 Ga0207681_10218224 Ga0207681_102182242 250
248 3300026118 Ga0207675_100133237 Ga0207675_1001332372 250
249 3300028573 Ga0265334_10042817 Ga0265334_100428173 250
250 3300031731 Ga0307405_10691042 Ga0307405_106910421 250
251 3300036401 Ga0373937_0067294 Ga0373937_0067294_916_1713 250
252 3300046515 Ga0495620_0010958 Ga0495620_0010958_2600_3391 250
253 3300046665 Ga0495661_0097486 Ga0495661_0097486_367_1158 250
254 3300047317 Ga0495604_0030421 Ga0495604_0030421_2784_3581 250
255 3300048925 Ga0496122_0056202 Ga0496122_0056202_316_1107 250
256 3300048926 Ga0496123_0012813 Ga0496123_0012813_3185_3976 250
257 3300048927 Ga0496124_0039338 Ga0496124_0039338_2222_3016 250
258 3300053085 Ga0495619_0016762 Ga0495619_0016762_993_1790 250
259 3300053121 Ga0500607_114868 Ga0500607_114868_276_1067 250
260 3300053148 Ga0500590_010171 Ga0500590_010171_2840_3637 250
261 iso_pu_bacteria 2818991446 2819602186 250
262 iso_pu_bacteria 2831265667 2831267469 250
263 iso_pu_bacteria 2838054893 2838060422 250
264 iso_pu_bacteria 2842677519 2842679252 250
265 iso_pu_bacteria 2842733646 2842735116 250
266 iso_pu_bacteria 2899924645 2899928748 250
267 iso_pu_bacteria 2919462493 2919466183 250
268 iso_pu_bacteria 2928037797 2928043315 250
269 iso_pu_bacteria 2928044640 2928050757 250
270 iso_pu_bacteria 2928051484 2928058751 250
271 iso_pu_bacteria 2928064002 2928066176 250
272 3300003752 Ga0055539_1000213 Ga0055539_100021324 251
273 3300003756 Ga0055533_1000073 Ga0055533_100007342 251
274 3300014497 Ga0182008_10000400 Ga0182008_1000040011 251
275 3300025226 Ga0209674_100039 Ga0209674_100039234 251
276 3300025230 Ga0209563_100110 Ga0209563_10011096 251
277 3300025253 Ga0209677_100123 Ga0209677_10012321 251
278 3300028794 Ga0307515_10021161 Ga0307515_100211616 251
279 3300031507 Ga0307509_10205357 Ga0307509_102053573 251
280 3300041512 Ga0451853_2804152 Ga0451853_2804152_435_1247 251
281 3300042004 Ga0439445_0002631 Ga0439445_0002631_2161_2961 251
282 3300042115 Ga0450911_000185 Ga0450911_000185_19014_19814 251
283 3300045976 Ga0466967_0021387 Ga0466967_0021387_1622_2425 251
284 3300046692 Ga0495671_0011682 Ga0495671_0011682_1830_2624 251
285 3300048924 Ga0496121_0157683 Ga0496121_0157683_539_1339 251
286 3300048928 Ga0496125_0024648 Ga0496125_0024648_477_1277 251
287 3300053079 Ga0500610_0000721 Ga0500610_0000721_5012_5806 251
288 3300053087 Ga0500643_062510 Ga0500643_062510_196_996 251
289 3300053117 Ga0500593_002973 Ga0500593_002973_4694_5488 251
290 3300053136 Ga0500559_0004378 Ga0500559_0004378_495_1295 251
291 3300053140 Ga0500573_0014690 Ga0500573_0014690_514_1314 251
292 3300053158 Ga0500627_0001793 Ga0500627_0001793_1876_2670 251
293 iso_pu_bacteria 2945909444 2945910504 251
294 iso_pu_bacteria 2945984333 2945987440 251
295 3300005616 Ga0068852_100095558 Ga0068852_1000955583 252
296 3300009036 Ga0105244_10085212 Ga0105244_100852122 252
297 3300013104 Ga0157370_10004322 Ga0157370_100043229 252
298 3300013306 Ga0163162_10174960 Ga0163162_101749602 252
299 3300014497 Ga0182008_10005123 Ga0182008_100051237 252
300 3300015262 Ga0182007_10002167 Ga0182007_100021675 252
301 3300025292 Ga0209676_1030213 Ga0209676_10302132 252
302 3300025294 Ga0209025_1000686 Ga0209025_100068655 252
303 3300026121 Ga0207683_10011446 Ga0207683_100114467 252
304 3300031730 Ga0307516_10025219 Ga0307516_100252197 252
305 3300032002 Ga0307416_100011500 Ga0307416_1000115004 252
306 3300044694 Ga0466963_0035097 Ga0466963_0035097_1732_2535 252
307 3300046462 Ga0495651_0235537 Ga0495651_0235537_257_1060 252
308 3300046471 Ga0495650_0004944 Ga0495650_0004944_1604_2407 252
309 3300046475 Ga0495639_0011236 Ga0495639_0011236_302_1105 252
310 3300046506 Ga0495583_0000164 Ga0495583_0000164_46446_47249 252
311 3300046507 Ga0495606_0001489 Ga0495606_0001489_25628_26431 252
312 3300046512 Ga0495610_0085071 Ga0495610_0085071_164_964 252
313 3300046520 Ga0495637_0005214 Ga0495637_0005214_2856_3656 252
314 3300046529 Ga0495652_0048602 Ga0495652_0048602_2521_3324 252
315 3300046660 Ga0495625_0033000 Ga0495625_0033000_1687_2487 252
316 3300046660 Ga0495625_0037321 Ga0495625_0037321_397_1200 252
317 3300046674 Ga0495588_0003415 Ga0495588_0003415_5027_5827 252
318 3300046691 Ga0495670_0305038 Ga0495670_0305038_14_814 252
319 3300046694 Ga0495649_0001452 Ga0495649_0001452_7874_8677 252
320 3300046794 Ga0495589_0024524 Ga0495589_0024524_681_1484 252
321 3300048089 Ga0495614_0031447 Ga0495614_0031447_1097_1897 252
322 3300048913 Ga0496110_0328938 Ga0496110_0328938_333_1130 252
323 3300048917 Ga0496114_0065814 Ga0496114_0065814_276_1088 252
324 3300048924 Ga0496121_0003970 Ga0496121_0003970_14550_15353 252
325 3300048928 Ga0496125_0005512 Ga0496125_0005512_3016_3819 252
326 3300053079 Ga0500610_0000424 Ga0500610_0000424_5776_6576 252
327 3300053080 Ga0500635_0006347 Ga0500635_0006347_1544_2347 252
328 3300053088 Ga0500644_0019949 Ga0500644_0019949_1127_1927 252
329 3300053136 Ga0500559_0060760 Ga0500559_0060760_562_1365 252
330 3300053138 Ga0500564_065359 Ga0500564_065359_420_1223 252
331 iso_pu_bacteria 2599185214 2599625296 252
332 iso_pu_bacteria 2599185226 2599673252 252
333 iso_pu_bacteria 2599185227 2599682922 252
334 iso_pu_bacteria 2599185229 2599694860 252
335 iso_pu_bacteria 2928070936 2928077793 252
336 3300002774 JGI25150J39212_1000489 JGI25150J39212_100048917 253
337 3300002987 JGI25159J45721_1000405 JGI25159J45721_100040516 253
338 3300003187 JGI25151J46595_10001020 JGI25151J46595_1000102017 253
339 3300003215 JGI25153J46596_10000667 JGI25153J46596_1000066717 253
340 3300003354 JGI25160J50197_1000610 JGI25160J50197_100061016 253
341 3300003374 JGI25161J50226_1000462 JGI25161J50226_10004627 253
342 3300003771 Ga0055526_1001065 Ga0055526_10010657 253
343 3300003773 Ga0055537_1000558 Ga0055537_100055817 253
344 3300003775 Ga0055524_1000847 Ga0055524_100084716 253
345 3300003781 Ga0055536_1033357 Ga0055536_10333572 253
346 3300003784 Ga0055534_1000524 Ga0055534_100052417 253
347 3300003790 Ga0055528_1000834 Ga0055528_100083417 253
348 3300003792 Ga0055540_1013330 Ga0055540_10133304 253
349 3300003794 Ga0055531_10002005 Ga0055531_100020057 253
350 3300004625 Ga0055543_1000420 Ga0055543_100042012 253
351 3300005262 Ga0065165_1001375 Ga0065165_100137517 253
352 3300009551 Ga0105238_10725233 Ga0105238_107252332 253
353 3300017792 Ga0163161_10008137 Ga0163161_100081371 253
354 3300025208 Ga0209436_102111 Ga0209436_1021114 253
355 3300025245 Ga0207425_1000282 Ga0207425_100028220 253
356 3300025258 Ga0209129_1000436 Ga0209129_100043618 253
357 3300025263 Ga0209565_1000165 Ga0209565_100016520 253
358 3300025273 Ga0209673_1001101 Ga0209673_100110112 253
359 3300025284 Ga0209130_1000427 Ga0209130_100042727 253
360 3300025291 Ga0209675_1000321 Ga0209675_100032120 253
361 3300025291 Ga0209675_1002144 Ga0209675_10021444 253
362 3300025292 Ga0209676_1001670 Ga0209676_100167012 253
363 3300025294 Ga0209025_1001318 Ga0209025_100131820 253
364 3300025294 Ga0209025_1026829 Ga0209025_10268292 253
365 3300025295 Ga0209564_1000352 Ga0209564_100035220 253
366 3300025297 Ga0209758_1000297 Ga0209758_100029720 253
367 3300025299 Ga0209256_1000238 Ga0209256_100023820 253
368 3300025302 Ga0207426_1000294 Ga0207426_100029420 253
369 3300025303 Ga0209051_1012012 Ga0209051_10120122 253
370 3300025304 Ga0209257_1001472 Ga0209257_100147212 253
371 3300025933 Ga0207706_10111615 Ga0207706_101116152 253
372 3300035691 Ga0373931_0010782 Ga0373931_0010782_481_1287 253
373 3300046512 Ga0495610_0048904 Ga0495610_0048904_930_1733 253
374 3300046513 Ga0495616_0000350 Ga0495616_0000350_4300_5103 253
375 3300046518 Ga0495631_0000182 Ga0495631_0000182_7261_8064 253
376 3300046520 Ga0495637_0049029 Ga0495637_0049029_552_1355 253
377 3300046660 Ga0495625_0026207 Ga0495625_0026207_3271_4074 253
378 3300047472 Ga0495686_0023741 Ga0495686_0023741_1426_2232 253
379 3300048906 Ga0496103_0306873 Ga0496103_0306873_146_952 253
380 3300048920 Ga0496117_0015763 Ga0496117_0015763_5096_5896 253
381 3300048922 Ga0496119_0032738 Ga0496119_0032738_2597_3400 253
382 3300048924 Ga0496121_0103534 Ga0496121_0103534_1210_2010 253
383 3300048925 Ga0496122_0176058 Ga0496122_0176058_110_913 253
384 3300048926 Ga0496123_0066207 Ga0496123_0066207_880_1683 253
385 3300048927 Ga0496124_0109204 Ga0496124_0109204_1185_1985 253
386 3300048928 Ga0496125_0305786 Ga0496125_0305786_130_933 253
387 3300053087 Ga0500643_009531 Ga0500643_009531_722_1525 253
388 3300053118 Ga0500594_0000469 Ga0500594_0000469_2941_3744 253
389 3300053133 Ga0500655_000096 Ga0500655_000096_2390_3193 253
390 3300053134 Ga0500658_0001231 Ga0500658_0001231_7750_8553 253
391 3300053139 Ga0500568_0000111 Ga0500568_0000111_33557_34360 253
392 3300053153 Ga0500616_0069065 Ga0500616_0069065_327_1130 253
393 3300053162 Ga0500638_033270 Ga0500638_033270_359_1162 253
394 3300001979 JGI24740J21852_10011266 JGI24740J21852_100112661 254
395 3300001989 JGI24739J22299_10028999 JGI24739J22299_100289993 254
396 3300002705 JGI25156J39149_1000250 JGI25156J39149_100025020 254
397 3300002738 JGI25154J39366_1000822 JGI25154J39366_10008226 254
398 3300002741 JGI25157J39369_1000027 JGI25157J39369_100002739 254
399 3300002773 JGI25152J39213_1001782 JGI25152J39213_10017829 254
400 3300002987 JGI25159J45721_1005983 JGI25159J45721_10059832 254
401 3300003187 JGI25151J46595_10017389 JGI25151J46595_100173891 254
402 3300003215 JGI25153J46596_10013036 JGI25153J46596_100130363 254
403 3300003316 rootH1_10084040 rootH1_100840401 254
404 3300003320 rootH2_10001994 rootH2_100019942 254
405 3300003320 rootH2_10001995 rootH2_100019953 254
406 3300003320 rootH2_10038664 rootH2_100386648 254
407 3300003323 rootH1_10038052 rootH1_100380524 254
408 3300003354 JGI25160J50197_1004983 JGI25160J50197_10049832 254
409 3300003374 JGI25161J50226_1001148 JGI25161J50226_10011483 254
410 3300003578 Ga0006562J51391_1187520 Ga0006562J51391_11875201 254
411 3300003578 Ga0006562J51391_1187522 Ga0006562J51391_11875222 254
412 3300003761 Ga0055535_1000338 Ga0055535_100033832 254
413 3300003762 Ga0055542_1000103 Ga0055542_100010332 254
414 3300003771 Ga0055526_1003242 Ga0055526_10032425 254
415 3300003773 Ga0055537_1001751 Ga0055537_10017514 254
416 3300003775 Ga0055524_1001073 Ga0055524_10010737 254
417 3300003781 Ga0055536_1002194 Ga0055536_100219413 254
418 3300003790 Ga0055528_1007360 Ga0055528_10073605 254
419 3300003791 Ga0055530_10000342 Ga0055530_1000034244 254
420 3300003792 Ga0055540_1001923 Ga0055540_100192313 254
421 3300003794 Ga0055531_10002643 Ga0055531_1000264313 254
422 3300004625 Ga0055543_1000674 Ga0055543_10006749 254
423 3300005262 Ga0065165_1003647 Ga0065165_10036473 254
424 3300005327 Ga0070658_10009746 Ga0070658_100097462 254
425 3300005327 Ga0070658_10407827 Ga0070658_104078271 254
426 3300005329 Ga0070683_100197544 Ga0070683_1001975442 254
427 3300005364 Ga0070673_100014147 Ga0070673_1000141477 254
428 3300005539 Ga0068853_100011269 Ga0068853_1000112693 254
429 3300005563 Ga0068855_100012007 Ga0068855_1000120079 254
430 3300005563 Ga0068855_100062920 Ga0068855_1000629203 254
431 3300005577 Ga0068857_100000496 Ga0068857_10000049616 254
432 3300005578 Ga0068854_100001904 Ga0068854_1000019048 254
433 3300005614 Ga0068856_100013896 Ga0068856_1000138968 254
434 3300006353 Ga0075370_10091311 Ga0075370_100913112 254
435 3300009093 Ga0105240_10080524 Ga0105240_100805244 254
436 3300009093 Ga0105240_10147254 Ga0105240_101472543 254
437 3300009093 Ga0105240_10302339 Ga0105240_103023392 254
438 3300009174 Ga0105241_10155862 Ga0105241_101558622 254
439 3300009545 Ga0105237_10051539 Ga0105237_100515394 254
440 3300009551 Ga0105238_10058996 Ga0105238_100589964 254
441 3300010375 Ga0105239_10148120 Ga0105239_101481203 254
442 3300013105 Ga0157369_10058014 Ga0157369_100580142 254
443 3300015261 Ga0182006_1083814 Ga0182006_10838141 254
444 3300025208 Ga0209436_101114 Ga0209436_1011142 254
445 3300025228 Ga0209672_101942 Ga0209672_1019425 254
446 3300025229 Ga0209147_100483 Ga0209147_1004838 254
447 3300025231 Ga0207427_100388 Ga0207427_1003888 254
448 3300025242 Ga0209258_100133 Ga0209258_100133129 254
449 3300025242 Ga0209258_100567 Ga0209258_10056721 254
450 3300025245 Ga0207425_1001985 Ga0207425_10019857 254
451 3300025246 Ga0209646_1000231 Ga0209646_100023136 254
452 3300025250 Ga0209026_1000011 Ga0209026_1000011107 254
453 3300025253 Ga0209677_100287 Ga0209677_10028717 254
454 3300025254 Ga0209148_1000188 Ga0209148_100018833 254
455 3300025256 Ga0209759_1000107 Ga0209759_1000107107 254
456 3300025256 Ga0209759_1001140 Ga0209759_10011405 254
457 3300025258 Ga0209129_1000425 Ga0209129_10004253 254
458 3300025263 Ga0209565_1000820 Ga0209565_100082012 254
459 3300025273 Ga0209673_1000454 Ga0209673_100045412 254
460 3300025284 Ga0209130_1000924 Ga0209130_100092411 254
461 3300025291 Ga0209675_1001260 Ga0209675_10012609 254
462 3300025292 Ga0209676_1000111 Ga0209676_1000111148 254
463 3300025294 Ga0209025_1010672 Ga0209025_10106724 254
464 3300025295 Ga0209564_1000070 Ga0209564_1000070172 254
465 3300025297 Ga0209758_1003512 Ga0209758_10035129 254
466 3300025298 Ga0209050_1000111 Ga0209050_100011143 254
467 3300025299 Ga0209256_1000047 Ga0209256_1000047184 254
468 3300025302 Ga0207426_1000194 Ga0207426_100019493 254
469 3300025303 Ga0209051_1000340 Ga0209051_100034027 254
470 3300025304 Ga0209257_1000690 Ga0209257_100069043 254
471 3300025909 Ga0207705_10090331 Ga0207705_100903312 254
472 3300025911 Ga0207654_10105101 Ga0207654_101051012 254
473 3300025913 Ga0207695_10021906 Ga0207695_100219064 254
474 3300025913 Ga0207695_10105599 Ga0207695_101055993 254
475 3300025913 Ga0207695_10233343 Ga0207695_102333432 254
476 3300025914 Ga0207671_10278100 Ga0207671_102781001 254
477 3300025924 Ga0207694_10038070 Ga0207694_100380703 254
478 3300025937 Ga0207669_10069638 Ga0207669_100696383 254
479 3300025944 Ga0207661_10145681 Ga0207661_101456812 254
480 3300025949 Ga0207667_10014499 Ga0207667_100144994 254
481 3300025960 Ga0207651_10060165 Ga0207651_100601651 254
482 3300025981 Ga0207640_10010683 Ga0207640_100106835 254
483 3300026041 Ga0207639_10008330 Ga0207639_100083303 254
484 3300026078 Ga0207702_10000270 Ga0207702_1000027053 254
485 3300026116 Ga0207674_10003612 Ga0207674_1000361215 254
486 3300031911 Ga0307412_10003587 Ga0307412_100035877 254
487 3300037466 Ga0395898_0069276 Ga0395898_0069276_1797_2606 254
488 3300037471 Ga0395905_0096937 Ga0395905_0096937_889_1698 254
489 3300042012 Ga0439455_0005516 Ga0439455_0005516_1334_2137 254
490 3300044842 Ga0466957_0020924 Ga0466957_0020924_2416_3225 254
491 3300048921 Ga0496118_0044115 Ga0496118_0044115_1282_2085 254
492 3300048928 Ga0496125_0131428 Ga0496125_0131428_116_919 254
493 3300053080 Ga0500635_0000237 Ga0500635_0000237_9085_9894 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

36

265

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.721 19 244
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.6037 19 244
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5101 2 244
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4912 2 244
4hyj-assembly1.cif.gz_A crystal structure of exiguobacterium sibiricum rhodopsin 0.4306 13 245
ID Description Score Start End Superfamily
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9228 44 245 1.20.120.1630
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9183 44 245 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8971 48 245 1.20.120.1630
af_C6TD75_105_305_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8928 48 244 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8851 48 245 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A1S9CYB9-F1-model_v4 Uncharacterized protein 0.9808 106 247 GO:0016020
AF-A0A7C5F542-F1-model_v4 DUF1295 domain-containing protein 0.9698 54 247 GO:0016020
AF-A0A2R7S3V4-F1-model_v4 deleted 0.9651 109 247
AF-A0A1W9ID13-F1-model_v4 Uncharacterized protein 0.9647 18 253 GO:0016020
AF-A0A1S9CYB9-F1-model_v4 Uncharacterized protein 0.9604 106 247 GO:0016020

Feature Viewer

pLDDT pTM Quality
82.67 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map