F454435
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 493 | 332 | 464 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300025256|Ga0209759_1001140|Ga0209759_10011405 |
| Length | 287 |
| Sequence | MALPNLPELFAMPDFDALLPIALHGLALIALLGLGTWVASLVRHDASLVDRMWSLMIAGPALVYAAQTSWTTPRAIAVQVLVLTWGLRLAAYITWRNWGHGEDRRYQQIRARNEPHFALKSLLIVFALQMVLAWIVTAPALAALVGRRGLGALDVAGITVALAGFLFEAIGDAQMAAFKREPANRGRVMDRGLWRFTRHPNYFGEACFWWGVWLIALAAGGLGAAWTVVSPLLMTVLLLKVSGVALLEKDIGERRPAYRDYIARTNAFIPGRPRGLASPAPAPGSRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 2 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 3 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 4 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 5 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 6 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 7 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 8 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 9 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 10 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 11 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 12 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 13 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 14 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 15 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 16 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 17 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 18 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 19 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 20 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 21 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 22 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 23 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 24 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 25 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 26 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 27 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 28 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 29 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 33 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 34 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 35 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 38 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 39 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 44 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 45 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 46 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 204 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 205 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 206 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 211 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 315 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 317 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 320 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 325 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 328 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 330 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.71 |
| Metatranscriptomes | 0.41 |
| Isolates | 5.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.17 |
| Nodule | 0.41 |
| Rhizoplane | 2.23 |
| Rhizosphere | 58.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011266 | 3300001979 | Bacteria | 3409 |
| 2 | JGI24739J22299_10028999 | 3300001989 | Bacteria | 1928 |
| 3 | JGI25156J39149_1000250 | 3300002705 | Bacteria | 37027 |
| 4 | JGI25154J39366_1000822 | 3300002738 | Bacteria | 13468 |
| 5 | JGI25157J39369_1000027 | 3300002741 | Bacteria | 147448 |
| 6 | JGI25152J39213_1001782 | 3300002773 | Bacteria | 8760 |
| 7 | JGI25152J39213_1003930 | 3300002773 | Bacteria | 4870 |
| 8 | JGI25150J39212_1000489 | 3300002774 | Bacteria | 16689 |
| 9 | JGI25159J45721_1000405 | 3300002987 | Bacteria | 20050 |
| 10 | JGI25159J45721_1005983 | 3300002987 | Bacteria | 3722 |
| 11 | JGI25151J46595_10001020 | 3300003187 | Bacteria | 21030 |
| 12 | JGI25151J46595_10017389 | 3300003187 | Bacteria | 3119 |
| 13 | JGI25406J46586_10024516 | 3300003203 | Bacteria | 2361 |
| 14 | JGI25153J46596_10000667 | 3300003215 | Bacteria | 21030 |
| 15 | JGI25153J46596_10004269 | 3300003215 | Bacteria | 7733 |
| 16 | JGI25153J46596_10013036 | 3300003215 | Bacteria | 3542 |
| 17 | rootH1_10084040 | 3300003316 | Bacteria | 3430 |
| 18 | rootH2_10001994 | 3300003320 | Bacteria | 2434 |
| 19 | rootH2_10001995 | 3300003320 | Bacteria | 4135 |
| 20 | rootH2_10038664 | 3300003320 | Bacteria | 8477 |
| 21 | rootH1_10028275 | 3300003323 | Bacteria | 6357 |
| 22 | rootH1_10038052 | 3300003323 | Bacteria | 7931 |
| 23 | JGI25160J50197_1000610 | 3300003354 | Bacteria | 20050 |
| 24 | JGI25160J50197_1004983 | 3300003354 | Bacteria | 5633 |
| 25 | JGI25161J50226_1000462 | 3300003374 | Bacteria | 18715 |
| 26 | JGI25161J50226_1001148 | 3300003374 | Bacteria | 8829 |
| 27 | Ga0006562J51391_1187520 | 3300003578 | Bacteria | 3185 |
| 28 | Ga0006562J51391_1187522 | 3300003578 | Bacteria | 1470 |
| 29 | Ga0055539_1000213 | 3300003752 | Bacteria | 42508 |
| 30 | Ga0055533_1000073 | 3300003756 | Bacteria | 142476 |
| 31 | Ga0055535_1000338 | 3300003761 | Bacteria | 46755 |
| 32 | Ga0055542_1000103 | 3300003762 | Bacteria | 114989 |
| 33 | Ga0055526_1001065 | 3300003771 | Bacteria | 20050 |
| 34 | Ga0055526_1003242 | 3300003771 | Bacteria | 10479 |
| 35 | Ga0055526_1021208 | 3300003771 | Bacteria | 2270 |
| 36 | Ga0055537_1000558 | 3300003773 | Bacteria | 21027 |
| 37 | Ga0055537_1001751 | 3300003773 | Bacteria | 7982 |
| 38 | Ga0055524_1000454 | 3300003775 | Bacteria | 33792 |
| 39 | Ga0055524_1000847 | 3300003775 | Bacteria | 20050 |
| 40 | Ga0055524_1001073 | 3300003775 | Bacteria | 16793 |
| 41 | Ga0055536_1002194 | 3300003781 | Bacteria | 11122 |
| 42 | Ga0055536_1033357 | 3300003781 | Bacteria | 1317 |
| 43 | Ga0055534_1000524 | 3300003784 | Bacteria | 20674 |
| 44 | Ga0055528_1000834 | 3300003790 | Bacteria | 21027 |
| 45 | Ga0055528_1007360 | 3300003790 | Bacteria | 4872 |
| 46 | Ga0055530_10000342 | 3300003791 | Bacteria | 42139 |
| 47 | Ga0055540_1001923 | 3300003792 | Bacteria | 11609 |
| 48 | Ga0055540_1013330 | 3300003792 | Bacteria | 2519 |
| 49 | Ga0055531_10002005 | 3300003794 | Bacteria | 14137 |
| 50 | Ga0055531_10002643 | 3300003794 | Bacteria | 11837 |
| 51 | Ga0055531_10025658 | 3300003794 | Bacteria | 2132 |
| 52 | Ga0055543_1000420 | 3300004625 | Bacteria | 26756 |
| 53 | Ga0055543_1000674 | 3300004625 | Bacteria | 17821 |
| 54 | Ga0065165_1000727 | 3300005262 | Bacteria | 46035 |
| 55 | Ga0065165_1001375 | 3300005262 | Bacteria | 26747 |
| 56 | Ga0065165_1003647 | 3300005262 | Bacteria | 10519 |
| 57 | Ga0070658_10009746 | 3300005327 | Bacteria | 7714 |
| 58 | Ga0070658_10019306 | 3300005327 | Bacteria | 5459 |
| 59 | Ga0070658_10122956 | 3300005327 | Bacteria | 2158 |
| 60 | Ga0070658_10407827 | 3300005327 | Bacteria | 1168 |
| 61 | Ga0070676_10002168 | 3300005328 | Bacteria | 10013 |
| 62 | Ga0070683_100197544 | 3300005329 | Bacteria | 1910 |
| 63 | Ga0070690_100165934 | 3300005330 | Bacteria | 1517 |
| 64 | Ga0070670_100101334 | 3300005331 | Bacteria | 2479 |
| 65 | Ga0070670_100293365 | 3300005331 | Bacteria | 1421 |
| 66 | Ga0070677_10002636 | 3300005333 | Bacteria | 5738 |
| 67 | Ga0068869_100039148 | 3300005334 | Bacteria | 3383 |
| 68 | Ga0070660_100034574 | 3300005339 | Bacteria | 3819 |
| 69 | Ga0070660_100196629 | 3300005339 | Bacteria | 1635 |
| 70 | Ga0070669_100062853 | 3300005353 | Bacteria | 2731 |
| 71 | Ga0070669_100327288 | 3300005353 | Bacteria | 1239 |
| 72 | Ga0070675_100048834 | 3300005354 | Bacteria | 3471 |
| 73 | Ga0070675_100107370 | 3300005354 | Bacteria | 2357 |
| 74 | Ga0070671_100039946 | 3300005355 | Bacteria | 3895 |
| 75 | Ga0070671_100190626 | 3300005355 | Bacteria | 1737 |
| 76 | Ga0070674_100021368 | 3300005356 | Bacteria | 4153 |
| 77 | Ga0070674_100031753 | 3300005356 | Bacteria | 3502 |
| 78 | Ga0070674_100445044 | 3300005356 | Bacteria | 1068 |
| 79 | Ga0070673_100014147 | 3300005364 | Bacteria | 5545 |
| 80 | Ga0070673_100057112 | 3300005364 | Bacteria | 3083 |
| 81 | Ga0070673_100058750 | 3300005364 | Bacteria | 3042 |
| 82 | Ga0070673_100063496 | 3300005364 | Bacteria | 2939 |
| 83 | Ga0070673_100436403 | 3300005364 | Bacteria | 1176 |
| 84 | Ga0070688_100209736 | 3300005365 | Bacteria | 1367 |
| 85 | Ga0070688_100216897 | 3300005365 | Unclassified | 1346 |
| 86 | Ga0070667_100030174 | 3300005367 | Bacteria | 4521 |
| 87 | Ga0070667_100063789 | 3300005367 | Bacteria | 3124 |
| 88 | Ga0070701_10125537 | 3300005438 | Bacteria | 1452 |
| 89 | Ga0070663_100010056 | 3300005455 | Bacteria | 5883 |
| 90 | Ga0070678_100059442 | 3300005456 | Bacteria | 2809 |
| 91 | Ga0070678_100125427 | 3300005456 | Bacteria | 2032 |
| 92 | Ga0070678_100339855 | 3300005456 | Bacteria | 1287 |
| 93 | Ga0070662_100063142 | 3300005457 | Bacteria | 2708 |
| 94 | Ga0070662_100136498 | 3300005457 | Bacteria | 1897 |
| 95 | Ga0068867_100282914 | 3300005459 | Bacteria | 1360 |
| 96 | Ga0070685_10143304 | 3300005466 | Unclassified | 1507 |
| 97 | Ga0068853_100011269 | 3300005539 | Bacteria | 7256 |
| 98 | Ga0070672_100006556 | 3300005543 | Bacteria | 7831 |
| 99 | Ga0070672_100056419 | 3300005543 | Bacteria | 3080 |
| 100 | Ga0070672_100066157 | 3300005543 | Bacteria | 2861 |
| 101 | Ga0070665_100048395 | 3300005548 | Bacteria | 4269 |
| 102 | Ga0068855_100012007 | 3300005563 | Bacteria | 10473 |
| 103 | Ga0068855_100062920 | 3300005563 | Bacteria | 4331 |
| 104 | Ga0068855_100162338 | 3300005563 | Bacteria | 2535 |
| 105 | Ga0070664_100047846 | 3300005564 | Bacteria | 3614 |
| 106 | Ga0070664_100098539 | 3300005564 | Bacteria | 2539 |
| 107 | Ga0068857_100000496 | 3300005577 | Bacteria | 28278 |
| 108 | Ga0068854_100001904 | 3300005578 | Bacteria | 12709 |
| 109 | Ga0068856_100013896 | 3300005614 | Bacteria | 7787 |
| 110 | Ga0070702_100143369 | 3300005615 | Unclassified | 1524 |
| 111 | Ga0068852_100095558 | 3300005616 | Bacteria | 2669 |
| 112 | Ga0068852_100254537 | 3300005616 | Bacteria | 1683 |
| 113 | Ga0068864_100316068 | 3300005618 | Bacteria | 1465 |
| 114 | Ga0068861_100084371 | 3300005719 | Bacteria | 2494 |
| 115 | Ga0068870_10183822 | 3300005840 | Bacteria | 1257 |
| 116 | Ga0068863_100283419 | 3300005841 | Bacteria | 1606 |
| 117 | Ga0068858_100024019 | 3300005842 | Bacteria | 5680 |
| 118 | Ga0068860_100017865 | 3300005843 | Bacteria | 6907 |
| 119 | Ga0068862_100008022 | 3300005844 | Bacteria | 8738 |
| 120 | Ga0081539_10003186 | 3300005985 | Bacteria | 20762 |
| 121 | Ga0075364_10008608 | 3300006051 | Bacteria | 6102 |
| 122 | Ga0075366_10008924 | 3300006195 | Bacteria | 5588 |
| 123 | Ga0097621_100145011 | 3300006237 | Bacteria | 2032 |
| 124 | Ga0075370_10001046 | 3300006353 | Bacteria | 11505 |
| 125 | Ga0075370_10091311 | 3300006353 | Bacteria | 1757 |
| 126 | Ga0068871_100183307 | 3300006358 | Bacteria | 1800 |
| 127 | Ga0075430_100021253 | 3300006846 | Bacteria | 5518 |
| 128 | Ga0075429_100048946 | 3300006880 | Bacteria | 3675 |
| 129 | Ga0105244_10085212 | 3300009036 | Bacteria | 1559 |
| 130 | Ga0105240_10080524 | 3300009093 | Bacteria | 4005 |
| 131 | Ga0105240_10147254 | 3300009093 | Bacteria | 2808 |
| 132 | Ga0105240_10302339 | 3300009093 | Bacteria | 1830 |
| 133 | Ga0111539_10442492 | 3300009094 | Bacteria | 1513 |
| 134 | Ga0111539_10847105 | 3300009094 | Bacteria | 1064 |
| 135 | Ga0105245_10133495 | 3300009098 | Bacteria | 2330 |
| 136 | Ga0105241_10155862 | 3300009174 | Bacteria | 1873 |
| 137 | Ga0105242_10007627 | 3300009176 | Bacteria | 8327 |
| 138 | Ga0105248_10174487 | 3300009177 | Bacteria | 2423 |
| 139 | Ga0105237_10051539 | 3300009545 | Bacteria | 4134 |
| 140 | Ga0105238_10058996 | 3300009551 | Bacteria | 3845 |
| 141 | Ga0105238_10725233 | 3300009551 | Bacteria | 1007 |
| 142 | Ga0105239_10148120 | 3300010375 | Bacteria | 2619 |
| 143 | Ga0105246_10117303 | 3300011119 | Bacteria | 1966 |
| 144 | Ga0157319_1000006 | 3300012497 | Bacteria | 361506 |
| 145 | Ga0157370_10004322 | 3300013104 | Bacteria | 16333 |
| 146 | Ga0157369_10058014 | 3300013105 | Bacteria | 4176 |
| 147 | Ga0157378_10624954 | 3300013297 | Bacteria | 1090 |
| 148 | Ga0163162_10028639 | 3300013306 | Bacteria | 5513 |
| 149 | Ga0163162_10174960 | 3300013306 | Bacteria | 2272 |
| 150 | Ga0163162_10529534 | 3300013306 | Bacteria | 1307 |
| 151 | Ga0157375_10050672 | 3300013308 | Bacteria | 4073 |
| 152 | Ga0157375_10056482 | 3300013308 | Bacteria | 3875 |
| 153 | Ga0157375_10668361 | 3300013308 | Bacteria | 1194 |
| 154 | Ga0163163_10276978 | 3300014325 | Bacteria | 1729 |
| 155 | Ga0182008_10000400 | 3300014497 | Bacteria | 33653 |
| 156 | Ga0182008_10005123 | 3300014497 | Bacteria | 7523 |
| 157 | Ga0157377_10011592 | 3300014745 | Bacteria | 4407 |
| 158 | Ga0157379_10110992 | 3300014968 | Bacteria | 2463 |
| 159 | Ga0182006_1083814 | 3300015261 | Bacteria | 1159 |
| 160 | Ga0182007_10002167 | 3300015262 | Bacteria | 9970 |
| 161 | Ga0163161_10008137 | 3300017792 | Bacteria | 7252 |
| 162 | Ga0163161_10088345 | 3300017792 | Bacteria | 2291 |
| 163 | Ga0163161_10211315 | 3300017792 | Bacteria | 1499 |
| 164 | Ga0213876_10018611 | 3300021384 | Bacteria | 3668 |
| 165 | Ga0209436_101114 | 3300025208 | Bacteria | 9960 |
| 166 | Ga0209436_102111 | 3300025208 | Bacteria | 6233 |
| 167 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 168 | Ga0209672_101942 | 3300025228 | Bacteria | 5849 |
| 169 | Ga0209147_100483 | 3300025229 | Bacteria | 23927 |
| 170 | Ga0209563_100110 | 3300025230 | Bacteria | 142518 |
| 171 | Ga0207427_100388 | 3300025231 | Bacteria | 26461 |
| 172 | Ga0209258_100133 | 3300025242 | Bacteria | 174846 |
| 173 | Ga0209258_100567 | 3300025242 | Bacteria | 31694 |
| 174 | Ga0207425_1000260 | 3300025245 | Bacteria | 39085 |
| 175 | Ga0207425_1000282 | 3300025245 | Bacteria | 37515 |
| 176 | Ga0207425_1001985 | 3300025245 | Bacteria | 7650 |
| 177 | Ga0209646_1000231 | 3300025246 | Bacteria | 59119 |
| 178 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 179 | Ga0209677_100123 | 3300025253 | Bacteria | 80295 |
| 180 | Ga0209677_100287 | 3300025253 | Bacteria | 33491 |
| 181 | Ga0209677_104139 | 3300025253 | Bacteria | 4335 |
| 182 | Ga0209148_1000188 | 3300025254 | Bacteria | 117310 |
| 183 | Ga0209759_1000107 | 3300025256 | Bacteria | 147025 |
| 184 | Ga0209759_1001140 | 3300025256 | Bacteria | 16991 |
| 185 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 186 | Ga0209129_1000425 | 3300025258 | Bacteria | 32039 |
| 187 | Ga0209129_1000436 | 3300025258 | Bacteria | 31077 |
| 188 | Ga0209565_1000165 | 3300025263 | Bacteria | 86871 |
| 189 | Ga0209565_1000820 | 3300025263 | Bacteria | 17662 |
| 190 | Ga0209673_1000454 | 3300025273 | Bacteria | 69331 |
| 191 | Ga0209673_1001101 | 3300025273 | Bacteria | 30262 |
| 192 | Ga0209673_1011107 | 3300025273 | Bacteria | 3738 |
| 193 | Ga0209673_1011231 | 3300025273 | Bacteria | 3706 |
| 194 | Ga0209130_1000427 | 3300025284 | Bacteria | 45224 |
| 195 | Ga0209130_1000924 | 3300025284 | Bacteria | 23585 |
| 196 | Ga0209675_1000321 | 3300025291 | Bacteria | 43024 |
| 197 | Ga0209675_1001260 | 3300025291 | Bacteria | 15176 |
| 198 | Ga0209675_1002144 | 3300025291 | Bacteria | 10409 |
| 199 | Ga0209676_1000111 | 3300025292 | Bacteria | 213411 |
| 200 | Ga0209676_1001670 | 3300025292 | Bacteria | 19271 |
| 201 | Ga0209676_1030213 | 3300025292 | Bacteria | 1660 |
| 202 | Ga0209025_1000686 | 3300025294 | Bacteria | 58086 |
| 203 | Ga0209025_1001318 | 3300025294 | Bacteria | 33769 |
| 204 | Ga0209025_1010672 | 3300025294 | Bacteria | 6187 |
| 205 | Ga0209025_1026829 | 3300025294 | Bacteria | 2876 |
| 206 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 207 | Ga0209564_1000070 | 3300025295 | Bacteria | 303126 |
| 208 | Ga0209564_1000352 | 3300025295 | Bacteria | 85941 |
| 209 | Ga0209758_1000198 | 3300025297 | Bacteria | 133584 |
| 210 | Ga0209758_1000297 | 3300025297 | Bacteria | 97664 |
| 211 | Ga0209758_1003512 | 3300025297 | Bacteria | 14157 |
| 212 | Ga0209050_1000111 | 3300025298 | Bacteria | 213411 |
| 213 | Ga0209256_1000047 | 3300025299 | Bacteria | 314709 |
| 214 | Ga0209256_1000238 | 3300025299 | Bacteria | 97664 |
| 215 | Ga0209256_1001030 | 3300025299 | Bacteria | 32745 |
| 216 | Ga0207426_1000194 | 3300025302 | Bacteria | 150009 |
| 217 | Ga0207426_1000294 | 3300025302 | Bacteria | 98700 |
| 218 | Ga0209051_1000340 | 3300025303 | Bacteria | 70080 |
| 219 | Ga0209051_1012012 | 3300025303 | Bacteria | 4226 |
| 220 | Ga0209257_1000690 | 3300025304 | Bacteria | 52373 |
| 221 | Ga0209257_1001321 | 3300025304 | Bacteria | 30158 |
| 222 | Ga0209257_1001472 | 3300025304 | Bacteria | 27715 |
| 223 | Ga0207697_10011631 | 3300025315 | Bacteria | 3716 |
| 224 | Ga0207656_10007230 | 3300025321 | Bacteria | 4032 |
| 225 | Ga0207682_10005031 | 3300025893 | Bacteria | 5419 |
| 226 | Ga0207682_10024121 | 3300025893 | Bacteria | 2407 |
| 227 | Ga0207688_10012812 | 3300025901 | Bacteria | 4559 |
| 228 | Ga0207645_10001804 | 3300025907 | Bacteria | 17289 |
| 229 | Ga0207705_10090331 | 3300025909 | Bacteria | 2242 |
| 230 | Ga0207705_10217374 | 3300025909 | Bacteria | 1451 |
| 231 | Ga0207654_10105101 | 3300025911 | Bacteria | 1746 |
| 232 | Ga0207695_10021906 | 3300025913 | Bacteria | 7274 |
| 233 | Ga0207695_10105599 | 3300025913 | Bacteria | 2803 |
| 234 | Ga0207695_10233343 | 3300025913 | Bacteria | 1743 |
| 235 | Ga0207671_10278100 | 3300025914 | Bacteria | 1320 |
| 236 | Ga0207657_10011824 | 3300025919 | Bacteria | 8641 |
| 237 | Ga0207657_10209456 | 3300025919 | Bacteria | 1565 |
| 238 | Ga0207681_10077086 | 3300025923 | Bacteria | 2342 |
| 239 | Ga0207681_10218224 | 3300025923 | Bacteria | 1474 |
| 240 | Ga0207694_10038070 | 3300025924 | Bacteria | 3697 |
| 241 | Ga0207650_10005595 | 3300025925 | Bacteria | 8585 |
| 242 | Ga0207650_10157511 | 3300025925 | Bacteria | 1797 |
| 243 | Ga0207659_10078880 | 3300025926 | Bacteria | 2427 |
| 244 | Ga0207659_10126095 | 3300025926 | Bacteria | 1969 |
| 245 | Ga0207644_10123995 | 3300025931 | Bacteria | 1970 |
| 246 | Ga0207644_10401475 | 3300025931 | Bacteria | 1120 |
| 247 | Ga0207706_10067774 | 3300025933 | Bacteria | 3141 |
| 248 | Ga0207706_10080743 | 3300025933 | Bacteria | 2859 |
| 249 | Ga0207706_10111615 | 3300025933 | Bacteria | 2405 |
| 250 | Ga0207706_10176295 | 3300025933 | Bacteria | 1878 |
| 251 | Ga0207686_10001268 | 3300025934 | Bacteria | 14522 |
| 252 | Ga0207686_10206254 | 3300025934 | Bacteria | 1410 |
| 253 | Ga0207670_10338474 | 3300025936 | Bacteria | 1188 |
| 254 | Ga0207669_10069638 | 3300025937 | Bacteria | 2202 |
| 255 | Ga0207669_10254891 | 3300025937 | Bacteria | 1309 |
| 256 | Ga0207691_10007218 | 3300025940 | Bacteria | 10717 |
| 257 | Ga0207691_10010611 | 3300025940 | Bacteria | 8838 |
| 258 | Ga0207691_10107584 | 3300025940 | Bacteria | 2482 |
| 259 | Ga0207689_10014750 | 3300025942 | Bacteria | 6635 |
| 260 | Ga0207661_10145681 | 3300025944 | Bacteria | 2043 |
| 261 | Ga0207679_10115166 | 3300025945 | Bacteria | 2129 |
| 262 | Ga0207679_10200584 | 3300025945 | Bacteria | 1666 |
| 263 | Ga0207667_10014499 | 3300025949 | Bacteria | 8983 |
| 264 | Ga0207651_10060165 | 3300025960 | Bacteria | 2635 |
| 265 | Ga0207640_10010683 | 3300025981 | Bacteria | 5179 |
| 266 | Ga0207658_10244132 | 3300025986 | Bacteria | 1523 |
| 267 | Ga0207658_10426312 | 3300025986 | Bacteria | 1171 |
| 268 | Ga0207677_10115355 | 3300026023 | Bacteria | 2009 |
| 269 | Ga0207703_10035895 | 3300026035 | Bacteria | 3942 |
| 270 | Ga0207639_10008330 | 3300026041 | Bacteria | 7105 |
| 271 | Ga0207639_10206998 | 3300026041 | Bacteria | 1686 |
| 272 | Ga0207678_10006442 | 3300026067 | Bacteria | 10413 |
| 273 | Ga0207678_10334383 | 3300026067 | Bacteria | 1304 |
| 274 | Ga0207702_10000270 | 3300026078 | Bacteria | 59607 |
| 275 | Ga0207648_10007828 | 3300026089 | Bacteria | 10431 |
| 276 | Ga0207648_10070575 | 3300026089 | Bacteria | 3045 |
| 277 | Ga0207648_10203906 | 3300026089 | Bacteria | 1755 |
| 278 | Ga0207676_10100829 | 3300026095 | Bacteria | 2393 |
| 279 | Ga0207674_10003612 | 3300026116 | Bacteria | 18862 |
| 280 | Ga0207675_100013307 | 3300026118 | Bacteria | 7680 |
| 281 | Ga0207675_100045092 | 3300026118 | Bacteria | 4120 |
| 282 | Ga0207675_100133237 | 3300026118 | Unclassified | 2357 |
| 283 | Ga0207683_10011446 | 3300026121 | Bacteria | 7571 |
| 284 | Ga0207683_10017558 | 3300026121 | Bacteria | 6100 |
| 285 | Ga0207683_10040285 | 3300026121 | Bacteria | 4075 |
| 286 | Ga0207683_10067781 | 3300026121 | Bacteria | 3149 |
| 287 | Ga0207698_10419850 | 3300026142 | Bacteria | 1283 |
| 288 | Ga0209282_1217279 | 3300027666 | Bacteria | 868 |
| 289 | Ga0265334_10042817 | 3300028573 | Bacteria | 1764 |
| 290 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 291 | Ga0307515_10021161 | 3300028794 | Bacteria | 11549 |
| 292 | Ga0265324_10005667 | 3300029957 | Bacteria | 5336 |
| 293 | Ga0316177_1131487 | 3300030731 | Bacteria | 2440 |
| 294 | Ga0316178_1107021 | 3300030735 | Bacteria | 10593 |
| 295 | Ga0316183_1091282 | 3300030742 | Bacteria | 20839 |
| 296 | Ga0316181_1090846 | 3300030744 | Bacteria | 5072 |
| 297 | Ga0265330_10019835 | 3300031235 | Bacteria | 3074 |
| 298 | Ga0265327_10000327 | 3300031251 | Bacteria | 90721 |
| 299 | Ga0307509_10205357 | 3300031507 | Bacteria | 1801 |
| 300 | Ga0316575_10123220 | 3300031665 | Bacteria | 1061 |
| 301 | Ga0316579_10068157 | 3300031691 | Bacteria | 1682 |
| 302 | Ga0316578_10125863 | 3300031728 | Unclassified | 1541 |
| 303 | Ga0307516_10025219 | 3300031730 | Bacteria | 6056 |
| 304 | Ga0307405_10691042 | 3300031731 | Bacteria | 844 |
| 305 | Ga0307412_10003587 | 3300031911 | Bacteria | 8620 |
| 306 | Ga0307416_100011500 | 3300032002 | Bacteria | 5908 |
| 307 | Ga0307411_10366764 | 3300032005 | Bacteria | 1180 |
| 308 | Ga0373931_0010782 | 3300035691 | Bacteria | 4400 |
| 309 | Ga0373937_0067294 | 3300036401 | Bacteria | 3300 |
| 310 | Ga0373937_0179714 | 3300036401 | Unclassified | 1987 |
| 311 | Ga0373925_0247764 | 3300037068 | Bacteria | 1428 |
| 312 | Ga0395898_0069276 | 3300037466 | Bacteria | 3413 |
| 313 | Ga0395905_0096937 | 3300037471 | Bacteria | 2769 |
| 314 | Ga0395905_0665512 | 3300037471 | Bacteria | 943 |
| 315 | Ga0436365_1480692 | 3300039437 | Bacteria | 10773 |
| 316 | Ga0451853_2804152 | 3300041512 | Bacteria | 1294 |
| 317 | Ga0439445_0002631 | 3300042004 | Bacteria | 3997 |
| 318 | Ga0439455_0005516 | 3300042012 | Bacteria | 2575 |
| 319 | Ga0450911_000185 | 3300042115 | Bacteria | 24854 |
| 320 | Ga0451577_0095219 | 3300042876 | Bacteria | 2658 |
| 321 | Ga0466963_0035097 | 3300044694 | Bacteria | 3266 |
| 322 | Ga0466963_0179685 | 3300044694 | Bacteria | 1477 |
| 323 | Ga0453684_0101220 | 3300044712 | Bacteria | 3525 |
| 324 | Ga0453684_0593910 | 3300044712 | Bacteria | 1214 |
| 325 | Ga0466957_0020924 | 3300044842 | Bacteria | 3850 |
| 326 | Ga0451576_0104504 | 3300045051 | Bacteria | 2946 |
| 327 | Ga0466967_0021387 | 3300045976 | Bacteria | 5253 |
| 328 | Ga0495629_0113153 | 3300046459 | Bacteria | 1892 |
| 329 | Ga0495651_0134467 | 3300046462 | Bacteria | 1801 |
| 330 | Ga0495651_0235537 | 3300046462 | Bacteria | 1258 |
| 331 | Ga0495650_0001042 | 3300046471 | Bacteria | 30968 |
| 332 | Ga0495650_0004944 | 3300046471 | Bacteria | 8892 |
| 333 | Ga0495639_0011236 | 3300046475 | Bacteria | 3858 |
| 334 | Ga0495583_0000164 | 3300046506 | Bacteria | 112062 |
| 335 | Ga0495606_0001489 | 3300046507 | Bacteria | 31133 |
| 336 | Ga0495608_0156646 | 3300046511 | Bacteria | 1450 |
| 337 | Ga0495610_0048904 | 3300046512 | Bacteria | 2073 |
| 338 | Ga0495610_0085071 | 3300046512 | Bacteria | 1444 |
| 339 | Ga0495616_0000350 | 3300046513 | Bacteria | 36334 |
| 340 | Ga0495620_0010958 | 3300046515 | Bacteria | 4755 |
| 341 | Ga0495620_0123504 | 3300046515 | Bacteria | 1019 |
| 342 | Ga0495628_0251874 | 3300046516 | Bacteria | 1318 |
| 343 | Ga0495630_0000714 | 3300046517 | Bacteria | 23478 |
| 344 | Ga0495631_0000182 | 3300046518 | Bacteria | 42891 |
| 345 | Ga0495637_0005214 | 3300046520 | Bacteria | 6658 |
| 346 | Ga0495637_0049029 | 3300046520 | Bacteria | 1776 |
| 347 | Ga0495652_0048602 | 3300046529 | Bacteria | 3634 |
| 348 | Ga0495621_0015140 | 3300046539 | Bacteria | 2455 |
| 349 | Ga0495656_0005544 | 3300046615 | Bacteria | 4360 |
| 350 | Ga0495625_0026207 | 3300046660 | Bacteria | 4408 |
| 351 | Ga0495625_0033000 | 3300046660 | Bacteria | 3833 |
| 352 | Ga0495625_0037321 | 3300046660 | Bacteria | 3566 |
| 353 | Ga0495635_0067847 | 3300046663 | Bacteria | 2446 |
| 354 | Ga0495661_0097486 | 3300046665 | Bacteria | 1661 |
| 355 | Ga0495588_0003415 | 3300046674 | Bacteria | 6905 |
| 356 | Ga0495657_0030285 | 3300046675 | Bacteria | 3792 |
| 357 | Ga0495670_0305038 | 3300046691 | Bacteria | 853 |
| 358 | Ga0495671_0011682 | 3300046692 | Bacteria | 4817 |
| 359 | Ga0495649_0001452 | 3300046694 | Bacteria | 17830 |
| 360 | Ga0495589_0024524 | 3300046794 | Bacteria | 3066 |
| 361 | Ga0495600_0049428 | 3300046809 | Bacteria | 2744 |
| 362 | Ga0495581_0297656 | 3300047315 | Bacteria | 943 |
| 363 | Ga0495604_0030421 | 3300047317 | Bacteria | 4288 |
| 364 | Ga0495676_0347900 | 3300047321 | Bacteria | 991 |
| 365 | Ga0495686_0023741 | 3300047472 | Bacteria | 4038 |
| 366 | Ga0495614_0031447 | 3300048089 | Bacteria | 2284 |
| 367 | Ga0496103_0306873 | 3300048906 | Bacteria | 1021 |
| 368 | Ga0496108_0025314 | 3300048911 | Bacteria | 4890 |
| 369 | Ga0496109_0160511 | 3300048912 | Bacteria | 2106 |
| 370 | Ga0496110_0100793 | 3300048913 | Bacteria | 2588 |
| 371 | Ga0496110_0328938 | 3300048913 | Bacteria | 1392 |
| 372 | Ga0496113_0013520 | 3300048916 | Bacteria | 5535 |
| 373 | Ga0496114_0018095 | 3300048917 | Bacteria | 5694 |
| 374 | Ga0496114_0065814 | 3300048917 | Bacteria | 3037 |
| 375 | Ga0496117_0015763 | 3300048920 | Bacteria | 6417 |
| 376 | Ga0496117_0253971 | 3300048920 | Bacteria | 957 |
| 377 | Ga0496118_0044115 | 3300048921 | Bacteria | 3495 |
| 378 | Ga0496119_0032738 | 3300048922 | Bacteria | 3460 |
| 379 | Ga0496121_0002770 | 3300048924 | Bacteria | 26007 |
| 380 | Ga0496121_0003970 | 3300048924 | Bacteria | 20411 |
| 381 | Ga0496121_0006784 | 3300048924 | Bacteria | 14029 |
| 382 | Ga0496121_0103534 | 3300048924 | Bacteria | 2189 |
| 383 | Ga0496121_0157683 | 3300048924 | Bacteria | 1663 |
| 384 | Ga0496122_0000034 | 3300048925 | Bacteria | 320661 |
| 385 | Ga0496122_0056202 | 3300048925 | Bacteria | 2936 |
| 386 | Ga0496122_0176058 | 3300048925 | Bacteria | 1282 |
| 387 | Ga0496122_0248869 | 3300048925 | Bacteria | 996 |
| 388 | Ga0496123_0000069 | 3300048926 | Bacteria | 201579 |
| 389 | Ga0496123_0012813 | 3300048926 | Bacteria | 7108 |
| 390 | Ga0496123_0066207 | 3300048926 | Bacteria | 2290 |
| 391 | Ga0496124_0002098 | 3300048927 | Bacteria | 26914 |
| 392 | Ga0496124_0039338 | 3300048927 | Bacteria | 4100 |
| 393 | Ga0496124_0109204 | 3300048927 | Bacteria | 2230 |
| 394 | Ga0496124_0172180 | 3300048927 | Bacteria | 1675 |
| 395 | Ga0496125_0005512 | 3300048928 | Bacteria | 14021 |
| 396 | Ga0496125_0024648 | 3300048928 | Bacteria | 5526 |
| 397 | Ga0496125_0028303 | 3300048928 | Bacteria | 5065 |
| 398 | Ga0496125_0080178 | 3300048928 | Bacteria | 2499 |
| 399 | Ga0496125_0131428 | 3300048928 | Bacteria | 1761 |
| 400 | Ga0496125_0305786 | 3300048928 | Bacteria | 971 |
| 401 | Ga0496126_0055580 | 3300048929 | Bacteria | 3581 |
| 402 | Ga0501032_0178871 | 3300049569 | Bacteria | 1389 |
| 403 | Ga0501033_0089603 | 3300049570 | Bacteria | 2250 |
| 404 | Ga0501034_0000224 | 3300049571 | Bacteria | 107481 |
| 405 | Ga0501039_0087218 | 3300049575 | Bacteria | 2431 |
| 406 | Ga0501041_0029940 | 3300049577 | Bacteria | 3285 |
| 407 | Ga0501042_0041450 | 3300049578 | Bacteria | 3274 |
| 408 | Ga0501046_0186616 | 3300049580 | Bacteria | 1548 |
| 409 | Ga0501047_0007163 | 3300049581 | Bacteria | 10480 |
| 410 | Ga0501048_0011300 | 3300049582 | Bacteria | 6657 |
| 411 | Ga0501067_0110412 | 3300049583 | Bacteria | 1529 |
| 412 | Ga0501068_0004405 | 3300049584 | Bacteria | 7658 |
| 413 | Ga0501068_0126029 | 3300049584 | Bacteria | 1599 |
| 414 | Ga0501070_0420078 | 3300049586 | Bacteria | 1080 |
| 415 | Ga0501072_0002629 | 3300049588 | Bacteria | 13467 |
| 416 | Ga0501072_0069187 | 3300049588 | Bacteria | 2787 |
| 417 | Ga0501073_0004182 | 3300049589 | Bacteria | 10828 |
| 418 | Ga0501074_0017231 | 3300049590 | Bacteria | 5242 |
| 419 | Ga0501074_0083986 | 3300049590 | Bacteria | 2283 |
| 420 | Ga0501075_0247688 | 3300049591 | Bacteria | 1358 |
| 421 | Ga0501077_0119224 | 3300049593 | Bacteria | 1672 |
| 422 | Ga0501249_001690 | 3300049679 | Bacteria | 4501 |
| 423 | Ga0501225_0001600 | 3300049705 | Bacteria | 7080 |
| 424 | Ga0501080_0003598 | 3300049742 | Bacteria | 13645 |
| 425 | Ga0501080_0107340 | 3300049742 | Bacteria | 2588 |
| 426 | Ga0501083_0021092 | 3300049744 | Bacteria | 4528 |
| 427 | Ga0501262_000243 | 3300049759 | Bacteria | 6726 |
| 428 | Ga0501035_0351930 | 3300049822 | Bacteria | 1232 |
| 429 | Ga0501044_0101201 | 3300049823 | Bacteria | 2899 |
| 430 | Ga0501045_0022744 | 3300049824 | Bacteria | 4490 |
| 431 | nmdc:mga00v17_6785_c2 | 3300050491 | Bacteria | 2840 |
| 432 | nmdc:mga0k408_3538_c1 | 3300050493 | Bacteria | 8251 |
| 433 | nmdc:mga07m45_10440_c1 | 3300050496 | Bacteria | 4851 |
| 434 | nmdc:mga07m45_1090_c1 | 3300050496 | Bacteria | 12102 |
| 435 | nmdc:mga0qj67_123767_c1 | 3300050509 | Bacteria | 2092 |
| 436 | Ga0495601_0006750 | 3300053077 | Bacteria | 6721 |
| 437 | Ga0500610_0000424 | 3300053079 | Bacteria | 13016 |
| 438 | Ga0500610_0000721 | 3300053079 | Bacteria | 10319 |
| 439 | Ga0500635_0000237 | 3300053080 | Bacteria | 24396 |
| 440 | Ga0500635_0006347 | 3300053080 | Bacteria | 3154 |
| 441 | Ga0495619_0004392 | 3300053085 | Bacteria | 8994 |
| 442 | Ga0495619_0016762 | 3300053085 | Bacteria | 4639 |
| 443 | Ga0500643_009531 | 3300053087 | Bacteria | 3701 |
| 444 | Ga0500643_062510 | 3300053087 | Bacteria | 1043 |
| 445 | Ga0500644_0019949 | 3300053088 | Bacteria | 1986 |
| 446 | Ga0500593_002973 | 3300053117 | Bacteria | 6311 |
| 447 | Ga0500594_0000469 | 3300053118 | Bacteria | 8865 |
| 448 | Ga0500607_114868 | 3300053121 | Bacteria | 1313 |
| 449 | Ga0500655_000096 | 3300053133 | Bacteria | 23067 |
| 450 | Ga0500658_0001231 | 3300053134 | Bacteria | 10410 |
| 451 | Ga0500559_0004378 | 3300053136 | Bacteria | 6723 |
| 452 | Ga0500559_0060760 | 3300053136 | Bacteria | 1684 |
| 453 | Ga0500564_065359 | 3300053138 | Bacteria | 1646 |
| 454 | Ga0500568_0000111 | 3300053139 | Bacteria | 75413 |
| 455 | Ga0500573_0014690 | 3300053140 | Bacteria | 4433 |
| 456 | Ga0500590_010171 | 3300053148 | Bacteria | 4745 |
| 457 | Ga0500616_0069065 | 3300053153 | Bacteria | 1807 |
| 458 | Ga0500622_0004724 | 3300053156 | Bacteria | 8418 |
| 459 | Ga0500627_0001793 | 3300053158 | Bacteria | 6105 |
| 460 | Ga0500634_0028374 | 3300053161 | Bacteria | 3049 |
| 461 | Ga0500634_0030027 | 3300053161 | Bacteria | 2962 |
| 462 | Ga0500638_033270 | 3300053162 | Bacteria | 2492 |
| 463 | Ga0501084_0303825 | 3300054114 | Bacteria | 1348 |
| 464 | Ga0501082_0074400 | 3300060353 | Bacteria | 2926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025934 | Ga0207686_10206254 | Ga0207686_102062541 | 215 |
| 2 | 3300006358 | Ga0068871_100183307 | Ga0068871_1001833072 | 219 |
| 3 | 3300009098 | Ga0105245_10133495 | Ga0105245_101334953 | 219 |
| 4 | 3300005364 | Ga0070673_100436403 | Ga0070673_1004364032 | 221 |
| 5 | 3300005328 | Ga0070676_10002168 | Ga0070676_100021682 | 222 |
| 6 | 3300005330 | Ga0070690_100165934 | Ga0070690_1001659342 | 222 |
| 7 | 3300005331 | Ga0070670_100101334 | Ga0070670_1001013342 | 222 |
| 8 | 3300005333 | Ga0070677_10002636 | Ga0070677_100026363 | 222 |
| 9 | 3300005334 | Ga0068869_100039148 | Ga0068869_1000391483 | 222 |
| 10 | 3300005353 | Ga0070669_100062853 | Ga0070669_1000628534 | 222 |
| 11 | 3300005354 | Ga0070675_100107370 | Ga0070675_1001073702 | 222 |
| 12 | 3300005355 | Ga0070671_100190626 | Ga0070671_1001906262 | 222 |
| 13 | 3300005356 | Ga0070674_100021368 | Ga0070674_1000213684 | 222 |
| 14 | 3300005364 | Ga0070673_100057112 | Ga0070673_1000571123 | 222 |
| 15 | 3300005365 | Ga0070688_100216897 | Ga0070688_1002168972 | 222 |
| 16 | 3300005367 | Ga0070667_100063789 | Ga0070667_1000637892 | 222 |
| 17 | 3300005438 | Ga0070701_10125537 | Ga0070701_101255372 | 222 |
| 18 | 3300005456 | Ga0070678_100125427 | Ga0070678_1001254272 | 222 |
| 19 | 3300005457 | Ga0070662_100136498 | Ga0070662_1001364982 | 222 |
| 20 | 3300005466 | Ga0070685_10143304 | Ga0070685_101433042 | 222 |
| 21 | 3300005543 | Ga0070672_100006556 | Ga0070672_1000065569 | 222 |
| 22 | 3300005615 | Ga0070702_100143369 | Ga0070702_1001433692 | 222 |
| 23 | 3300005719 | Ga0068861_100084371 | Ga0068861_1000843713 | 222 |
| 24 | 3300005842 | Ga0068858_100024019 | Ga0068858_1000240194 | 222 |
| 25 | 3300005844 | Ga0068862_100008022 | Ga0068862_1000080227 | 222 |
| 26 | 3300009094 | Ga0111539_10442492 | Ga0111539_104424922 | 222 |
| 27 | 3300009177 | Ga0105248_10174487 | Ga0105248_101744873 | 222 |
| 28 | 3300013306 | Ga0163162_10028639 | Ga0163162_100286395 | 222 |
| 29 | 3300013308 | Ga0157375_10056482 | Ga0157375_100564824 | 222 |
| 30 | 3300014325 | Ga0163163_10276978 | Ga0163163_102769782 | 222 |
| 31 | 3300017792 | Ga0163161_10088345 | Ga0163161_100883453 | 222 |
| 32 | 3300025315 | Ga0207697_10011631 | Ga0207697_100116314 | 222 |
| 33 | 3300025893 | Ga0207682_10005031 | Ga0207682_100050312 | 222 |
| 34 | 3300025901 | Ga0207688_10012812 | Ga0207688_100128123 | 222 |
| 35 | 3300025907 | Ga0207645_10001804 | Ga0207645_1000180412 | 222 |
| 36 | 3300025923 | Ga0207681_10077086 | Ga0207681_100770863 | 222 |
| 37 | 3300025931 | Ga0207644_10123995 | Ga0207644_101239952 | 222 |
| 38 | 3300025933 | Ga0207706_10176295 | Ga0207706_101762952 | 222 |
| 39 | 3300025940 | Ga0207691_10007218 | Ga0207691_100072189 | 222 |
| 40 | 3300025942 | Ga0207689_10014750 | Ga0207689_100147506 | 222 |
| 41 | 3300025986 | Ga0207658_10244132 | Ga0207658_102441322 | 222 |
| 42 | 3300026023 | Ga0207677_10115355 | Ga0207677_101153553 | 222 |
| 43 | 3300026035 | Ga0207703_10035895 | Ga0207703_100358953 | 222 |
| 44 | 3300026089 | Ga0207648_10007828 | Ga0207648_1000782810 | 222 |
| 45 | 3300026095 | Ga0207676_10100829 | Ga0207676_101008293 | 222 |
| 46 | 3300026118 | Ga0207675_100013307 | Ga0207675_1000133076 | 222 |
| 47 | 3300026121 | Ga0207683_10017558 | Ga0207683_100175585 | 222 |
| 48 | 3300025925 | Ga0207650_10157511 | Ga0207650_101575113 | 223 |
| 49 | 3300025926 | Ga0207659_10078880 | Ga0207659_100788803 | 223 |
| 50 | 3300037471 | Ga0395905_0665512 | Ga0395905_0665512_21_725 | 225 |
| 51 | 3300031665 | Ga0316575_10123220 | Ga0316575_101232201 | 226 |
| 52 | 3300005354 | Ga0070675_100048834 | Ga0070675_1000488343 | 229 |
| 53 | 3300005456 | Ga0070678_100339855 | Ga0070678_1003398552 | 229 |
| 54 | 3300005543 | Ga0070672_100056419 | Ga0070672_1000564192 | 229 |
| 55 | 3300025893 | Ga0207682_10024121 | Ga0207682_100241212 | 229 |
| 56 | 3300025933 | Ga0207706_10080743 | Ga0207706_100807433 | 229 |
| 57 | 3300048925 | Ga0496122_0248869 | Ga0496122_0248869_18_791 | 229 |
| 58 | 3300049584 | Ga0501068_0126029 | Ga0501068_0126029_218_958 | 231 |
| 59 | 3300031728 | Ga0316578_10125863 | Ga0316578_101258632 | 232 |
| 60 | 3300049759 | Ga0501262_000243 | Ga0501262_000243_4585_5391 | 233 |
| 61 | 3300048920 | Ga0496117_0253971 | Ga0496117_0253971_13_735 | 235 |
| 62 | 3300013306 | Ga0163162_10529534 | Ga0163162_105295342 | 236 |
| 63 | 3300031691 | Ga0316579_10068157 | Ga0316579_100681572 | 236 |
| 64 | 3300046539 | Ga0495621_0015140 | Ga0495621_0015140_766_1518 | 236 |
| 65 | 3300046615 | Ga0495656_0005544 | Ga0495656_0005544_742_1494 | 236 |
| 66 | 3300003775 | Ga0055524_1000454 | Ga0055524_100045416 | 237 |
| 67 | 3300003794 | Ga0055531_10025658 | Ga0055531_100256582 | 237 |
| 68 | 3300006051 | Ga0075364_10008608 | Ga0075364_100086082 | 237 |
| 69 | 3300012497 | Ga0157319_1000006 | Ga0157319_100000672 | 237 |
| 70 | 3300025299 | Ga0209256_1001030 | Ga0209256_100103018 | 237 |
| 71 | 3300025304 | Ga0209257_1001321 | Ga0209257_100132115 | 237 |
| 72 | 3300050491 | nmdc:mga00v17_6785_c2 | nmdc:mga00v17_6785_c2_1406_2200 | 237 |
| 73 | 3300050496 | nmdc:mga07m45_10440_c1 | nmdc:mga07m45_10440_c1_2794_3609 | 237 |
| 74 | 3300025937 | Ga0207669_10254891 | Ga0207669_102548912 | 239 |
| 75 | 3300048927 | Ga0496124_0172180 | Ga0496124_0172180_802_1596 | 239 |
| 76 | 3300049570 | Ga0501033_0089603 | Ga0501033_0089603_637_1410 | 239 |
| 77 | 3300049575 | Ga0501039_0087218 | Ga0501039_0087218_274_1047 | 239 |
| 78 | 3300049577 | Ga0501041_0029940 | Ga0501041_0029940_1761_2534 | 239 |
| 79 | 3300049578 | Ga0501042_0041450 | Ga0501042_0041450_217_990 | 239 |
| 80 | 3300049580 | Ga0501046_0186616 | Ga0501046_0186616_631_1404 | 239 |
| 81 | 3300049582 | Ga0501048_0011300 | Ga0501048_0011300_3487_4260 | 239 |
| 82 | 3300049588 | Ga0501072_0069187 | Ga0501072_0069187_956_1729 | 239 |
| 83 | 3300049824 | Ga0501045_0022744 | Ga0501045_0022744_2295_3068 | 239 |
| 84 | 3300053161 | Ga0500634_0030027 | Ga0500634_0030027_1651_2451 | 239 |
| 85 | 3300005339 | Ga0070660_100196629 | Ga0070660_1001966292 | 240 |
| 86 | 3300005355 | Ga0070671_100039946 | Ga0070671_1000399463 | 240 |
| 87 | 3300005356 | Ga0070674_100031753 | Ga0070674_1000317532 | 240 |
| 88 | 3300005364 | Ga0070673_100058750 | Ga0070673_1000587503 | 240 |
| 89 | 3300005455 | Ga0070663_100010056 | Ga0070663_1000100562 | 240 |
| 90 | 3300005456 | Ga0070678_100059442 | Ga0070678_1000594423 | 240 |
| 91 | 3300005457 | Ga0070662_100063142 | Ga0070662_1000631422 | 240 |
| 92 | 3300005459 | Ga0068867_100282914 | Ga0068867_1002829141 | 240 |
| 93 | 3300005543 | Ga0070672_100066157 | Ga0070672_1000661573 | 240 |
| 94 | 3300005564 | Ga0070664_100098539 | Ga0070664_1000985392 | 240 |
| 95 | 3300005616 | Ga0068852_100254537 | Ga0068852_1002545372 | 240 |
| 96 | 3300005618 | Ga0068864_100316068 | Ga0068864_1003160682 | 240 |
| 97 | 3300005841 | Ga0068863_100283419 | Ga0068863_1002834191 | 240 |
| 98 | 3300006237 | Ga0097621_100145011 | Ga0097621_1001450112 | 240 |
| 99 | 3300013297 | Ga0157378_10624954 | Ga0157378_106249542 | 240 |
| 100 | 3300014745 | Ga0157377_10011592 | Ga0157377_100115922 | 240 |
| 101 | 3300014968 | Ga0157379_10110992 | Ga0157379_101109922 | 240 |
| 102 | 3300025321 | Ga0207656_10007230 | Ga0207656_100072304 | 240 |
| 103 | 3300025919 | Ga0207657_10209456 | Ga0207657_102094562 | 240 |
| 104 | 3300025931 | Ga0207644_10401475 | Ga0207644_104014752 | 240 |
| 105 | 3300025933 | Ga0207706_10067774 | Ga0207706_100677743 | 240 |
| 106 | 3300025940 | Ga0207691_10010611 | Ga0207691_100106113 | 240 |
| 107 | 3300026041 | Ga0207639_10206998 | Ga0207639_102069982 | 240 |
| 108 | 3300026067 | Ga0207678_10006442 | Ga0207678_100064425 | 240 |
| 109 | 3300026089 | Ga0207648_10203906 | Ga0207648_102039062 | 240 |
| 110 | 3300026121 | Ga0207683_10040285 | Ga0207683_100402854 | 240 |
| 111 | 3300026142 | Ga0207698_10419850 | Ga0207698_104198502 | 240 |
| 112 | 3300046515 | Ga0495620_0123504 | Ga0495620_0123504_144_935 | 240 |
| 113 | 3300002773 | JGI25152J39213_1003930 | JGI25152J39213_10039304 | 241 |
| 114 | 3300003215 | JGI25153J46596_10004269 | JGI25153J46596_100042697 | 241 |
| 115 | 3300003323 | rootH1_10028275 | rootH1_100282756 | 241 |
| 116 | 3300003771 | Ga0055526_1021208 | Ga0055526_10212082 | 241 |
| 117 | 3300006846 | Ga0075430_100021253 | Ga0075430_1000212534 | 241 |
| 118 | 3300006880 | Ga0075429_100048946 | Ga0075429_1000489462 | 241 |
| 119 | 3300025245 | Ga0207425_1000260 | Ga0207425_100026018 | 241 |
| 120 | 3300025258 | Ga0209129_1000012 | Ga0209129_100001247 | 241 |
| 121 | 3300025273 | Ga0209673_1011231 | Ga0209673_10112312 | 241 |
| 122 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022467 | 241 |
| 123 | 3300025297 | Ga0209758_1000198 | Ga0209758_100019860 | 241 |
| 124 | 3300027666 | Ga0209282_1217279 | Ga0209282_12172791 | 241 |
| 125 | 3300042876 | Ga0451577_0095219 | Ga0451577_0095219_439_1209 | 241 |
| 126 | 3300044712 | Ga0453684_0101220 | Ga0453684_0101220_1625_2395 | 241 |
| 127 | 3300044712 | Ga0453684_0593910 | Ga0453684_0593910_214_984 | 241 |
| 128 | 3300045051 | Ga0451576_0104504 | Ga0451576_0104504_1166_1936 | 241 |
| 129 | 3300048927 | Ga0496124_0002098 | Ga0496124_0002098_8817_9587 | 241 |
| 130 | 3300048928 | Ga0496125_0028303 | Ga0496125_0028303_1196_1966 | 241 |
| 131 | 3300050509 | nmdc:mga0qj67_123767_c1 | nmdc:mga0qj67_123767_c1_1163_1927 | 241 |
| 132 | 3300013308 | Ga0157375_10050672 | Ga0157375_100506724 | 242 |
| 133 | 3300030731 | Ga0316177_1131487 | Ga0316177_11314873 | 242 |
| 134 | 3300030744 | Ga0316181_1090846 | Ga0316181_10908467 | 242 |
| 135 | 3300032005 | Ga0307411_10366764 | Ga0307411_103667642 | 242 |
| 136 | 3300049679 | Ga0501249_001690 | Ga0501249_001690_3006_3812 | 242 |
| 137 | 3300049705 | Ga0501225_0001600 | Ga0501225_0001600_4950_5756 | 242 |
| 138 | 3300005356 | Ga0070674_100445044 | Ga0070674_1004450442 | 243 |
| 139 | 3300005843 | Ga0068860_100017865 | Ga0068860_1000178655 | 243 |
| 140 | 3300025936 | Ga0207670_10338474 | Ga0207670_103384742 | 243 |
| 141 | 3300025986 | Ga0207658_10426312 | Ga0207658_104263121 | 243 |
| 142 | 3300026089 | Ga0207648_10070575 | Ga0207648_100705753 | 243 |
| 143 | 3300026118 | Ga0207675_100045092 | Ga0207675_1000450922 | 243 |
| 144 | 3300031235 | Ga0265330_10019835 | Ga0265330_100198353 | 243 |
| 145 | 3300048924 | Ga0496121_0006784 | Ga0496121_0006784_1897_2676 | 243 |
| 146 | iso_pu_bacteria | 2928115317 | 2928118634 | 243 |
| 147 | 3300025926 | Ga0207659_10126095 | Ga0207659_101260952 | 244 |
| 148 | 3300025940 | Ga0207691_10107584 | Ga0207691_101075842 | 244 |
| 149 | 3300026067 | Ga0207678_10334383 | Ga0207678_103343832 | 244 |
| 150 | 3300048925 | Ga0496122_0000034 | Ga0496122_0000034_8384_9157 | 244 |
| 151 | 3300048926 | Ga0496123_0000069 | Ga0496123_0000069_166317_167090 | 244 |
| 152 | 3300005331 | Ga0070670_100293365 | Ga0070670_1002933652 | 245 |
| 153 | 3300005364 | Ga0070673_100063496 | Ga0070673_1000634963 | 245 |
| 154 | 3300005365 | Ga0070688_100209736 | Ga0070688_1002097362 | 245 |
| 155 | 3300005564 | Ga0070664_100047846 | Ga0070664_1000478463 | 245 |
| 156 | 3300005840 | Ga0068870_10183822 | Ga0068870_101838222 | 245 |
| 157 | 3300025925 | Ga0207650_10005595 | Ga0207650_100055952 | 245 |
| 158 | 3300025945 | Ga0207679_10115166 | Ga0207679_101151662 | 245 |
| 159 | 3300025945 | Ga0207679_10200584 | Ga0207679_102005842 | 245 |
| 160 | 3300026121 | Ga0207683_10067781 | Ga0207683_100677813 | 245 |
| 161 | 3300044694 | Ga0466963_0179685 | Ga0466963_0179685_689_1465 | 245 |
| 162 | 3300049569 | Ga0501032_0178871 | Ga0501032_0178871_557_1339 | 245 |
| 163 | 3300049571 | Ga0501034_0000224 | Ga0501034_0000224_24770_25552 | 245 |
| 164 | 3300049583 | Ga0501067_0110412 | Ga0501067_0110412_495_1277 | 245 |
| 165 | 3300049584 | Ga0501068_0004405 | Ga0501068_0004405_4077_4859 | 245 |
| 166 | 3300049586 | Ga0501070_0420078 | Ga0501070_0420078_243_1025 | 245 |
| 167 | 3300049588 | Ga0501072_0002629 | Ga0501072_0002629_7896_8678 | 245 |
| 168 | 3300049589 | Ga0501073_0004182 | Ga0501073_0004182_6816_7598 | 245 |
| 169 | 3300049590 | Ga0501074_0017231 | Ga0501074_0017231_1420_2202 | 245 |
| 170 | 3300049593 | Ga0501077_0119224 | Ga0501077_0119224_463_1245 | 245 |
| 171 | 3300049742 | Ga0501080_0003598 | Ga0501080_0003598_9809_10591 | 245 |
| 172 | 3300049744 | Ga0501083_0021092 | Ga0501083_0021092_1412_2194 | 245 |
| 173 | 3300060353 | Ga0501082_0074400 | Ga0501082_0074400_111_893 | 245 |
| 174 | iso_pu_bacteria | 2974320154 | 2974321052 | 245 |
| 175 | 3300005367 | Ga0070667_100030174 | Ga0070667_1000301745 | 246 |
| 176 | 3300013308 | Ga0157375_10668361 | Ga0157375_106683611 | 246 |
| 177 | 3300021384 | Ga0213876_10018611 | Ga0213876_100186113 | 246 |
| 178 | 3300030735 | Ga0316178_1107021 | Ga0316178_11070213 | 246 |
| 179 | 3300030742 | Ga0316183_1091282 | Ga0316183_10912827 | 246 |
| 180 | 3300037068 | Ga0373925_0247764 | Ga0373925_0247764_429_1214 | 246 |
| 181 | 3300039437 | Ga0436365_1480692 | Ga0436365_1480692_2906_3691 | 246 |
| 182 | 3300046459 | Ga0495629_0113153 | Ga0495629_0113153_604_1389 | 246 |
| 183 | 3300046511 | Ga0495608_0156646 | Ga0495608_0156646_454_1239 | 246 |
| 184 | 3300046516 | Ga0495628_0251874 | Ga0495628_0251874_203_988 | 246 |
| 185 | 3300046517 | Ga0495630_0000714 | Ga0495630_0000714_19741_20526 | 246 |
| 186 | 3300046663 | Ga0495635_0067847 | Ga0495635_0067847_225_1010 | 246 |
| 187 | 3300046675 | Ga0495657_0030285 | Ga0495657_0030285_218_1003 | 246 |
| 188 | 3300046809 | Ga0495600_0049428 | Ga0495600_0049428_1391_2176 | 246 |
| 189 | 3300047315 | Ga0495581_0297656 | Ga0495581_0297656_84_869 | 246 |
| 190 | 3300047321 | Ga0495676_0347900 | Ga0495676_0347900_81_866 | 246 |
| 191 | 3300048911 | Ga0496108_0025314 | Ga0496108_0025314_603_1415 | 246 |
| 192 | 3300048912 | Ga0496109_0160511 | Ga0496109_0160511_975_1787 | 246 |
| 193 | 3300048913 | Ga0496110_0100793 | Ga0496110_0100793_217_1029 | 246 |
| 194 | 3300048916 | Ga0496113_0013520 | Ga0496113_0013520_612_1397 | 246 |
| 195 | 3300048924 | Ga0496121_0002770 | Ga0496121_0002770_9105_9890 | 246 |
| 196 | 3300049581 | Ga0501047_0007163 | Ga0501047_0007163_2316_3101 | 246 |
| 197 | 3300049590 | Ga0501074_0083986 | Ga0501074_0083986_1398_2183 | 246 |
| 198 | 3300049742 | Ga0501080_0107340 | Ga0501080_0107340_584_1369 | 246 |
| 199 | 3300049822 | Ga0501035_0351930 | Ga0501035_0351930_296_1081 | 246 |
| 200 | 3300049823 | Ga0501044_0101201 | Ga0501044_0101201_2083_2868 | 246 |
| 201 | 3300053077 | Ga0495601_0006750 | Ga0495601_0006750_2775_3560 | 246 |
| 202 | 3300053085 | Ga0495619_0004392 | Ga0495619_0004392_7416_8201 | 246 |
| 203 | iso_pu_bacteria | 2738541307 | 2738882949 | 246 |
| 204 | 3300005262 | Ga0065165_1000727 | Ga0065165_100072713 | 247 |
| 205 | 3300006195 | Ga0075366_10008924 | Ga0075366_100089244 | 247 |
| 206 | 3300006353 | Ga0075370_10001046 | Ga0075370_1000104611 | 247 |
| 207 | 3300009094 | Ga0111539_10847105 | Ga0111539_108471051 | 247 |
| 208 | 3300025273 | Ga0209673_1011107 | Ga0209673_10111072 | 247 |
| 209 | 3300050493 | nmdc:mga0k408_3538_c1 | nmdc:mga0k408_3538_c1_2415_3203 | 247 |
| 210 | 3300050496 | nmdc:mga07m45_1090_c1 | nmdc:mga07m45_1090_c1_1886_2674 | 247 |
| 211 | 3300053156 | Ga0500622_0004724 | Ga0500622_0004724_1729_2544 | 247 |
| 212 | 3300053161 | Ga0500634_0028374 | Ga0500634_0028374_1845_2654 | 247 |
| 213 | iso_pu_bacteria | 2842747753 | 2842751115 | 247 |
| 214 | 3300003203 | JGI25406J46586_10024516 | JGI25406J46586_100245162 | 248 |
| 215 | 3300005327 | Ga0070658_10019306 | Ga0070658_100193062 | 248 |
| 216 | 3300005327 | Ga0070658_10122956 | Ga0070658_101229562 | 248 |
| 217 | 3300005339 | Ga0070660_100034574 | Ga0070660_1000345743 | 248 |
| 218 | 3300005563 | Ga0068855_100162338 | Ga0068855_1001623382 | 248 |
| 219 | 3300005985 | Ga0081539_10003186 | Ga0081539_1000318622 | 248 |
| 220 | 3300009176 | Ga0105242_10007627 | Ga0105242_100076278 | 248 |
| 221 | 3300011119 | Ga0105246_10117303 | Ga0105246_101173033 | 248 |
| 222 | 3300025253 | Ga0209677_104139 | Ga0209677_1041393 | 248 |
| 223 | 3300025909 | Ga0207705_10217374 | Ga0207705_102173742 | 248 |
| 224 | 3300025919 | Ga0207657_10011824 | Ga0207657_100118246 | 248 |
| 225 | 3300025934 | Ga0207686_10001268 | Ga0207686_100012688 | 248 |
| 226 | 3300031251 | Ga0265327_10000327 | Ga0265327_1000032766 | 248 |
| 227 | 3300046462 | Ga0495651_0134467 | Ga0495651_0134467_272_1057 | 248 |
| 228 | 3300046471 | Ga0495650_0001042 | Ga0495650_0001042_26807_27604 | 248 |
| 229 | 3300049591 | Ga0501075_0247688 | Ga0501075_0247688_166_957 | 248 |
| 230 | 3300054114 | Ga0501084_0303825 | Ga0501084_0303825_30_821 | 248 |
| 231 | iso_pu_bacteria | 2904541872 | 2904550001 | 248 |
| 232 | iso_pu_bacteria | 2929160207 | 2929164887 | 248 |
| 233 | 3300005548 | Ga0070665_100048395 | Ga0070665_1000483953 | 249 |
| 234 | 3300028666 | Ga0265336_10000022 | Ga0265336_1000002226 | 249 |
| 235 | 3300029957 | Ga0265324_10005667 | Ga0265324_100056673 | 249 |
| 236 | 3300036401 | Ga0373937_0179714 | Ga0373937_0179714_564_1367 | 249 |
| 237 | 3300048917 | Ga0496114_0018095 | Ga0496114_0018095_2114_2908 | 249 |
| 238 | 3300048928 | Ga0496125_0080178 | Ga0496125_0080178_347_1135 | 249 |
| 239 | 3300048929 | Ga0496126_0055580 | Ga0496126_0055580_1738_2526 | 249 |
| 240 | iso_pu_bacteria | 2738541277 | 2738723314 | 249 |
| 241 | iso_pu_bacteria | 2738543019 | 2739284045 | 249 |
| 242 | iso_pu_bacteria | 2885198086 | 2885198238 | 249 |
| 243 | iso_pu_bacteria | 2885211737 | 2885212382 | 249 |
| 244 | iso_pu_bacteria | 2928084124 | 2928088099 | 249 |
| 245 | 3300005353 | Ga0070669_100327288 | Ga0070669_1003272881 | 250 |
| 246 | 3300017792 | Ga0163161_10211315 | Ga0163161_102113151 | 250 |
| 247 | 3300025923 | Ga0207681_10218224 | Ga0207681_102182242 | 250 |
| 248 | 3300026118 | Ga0207675_100133237 | Ga0207675_1001332372 | 250 |
| 249 | 3300028573 | Ga0265334_10042817 | Ga0265334_100428173 | 250 |
| 250 | 3300031731 | Ga0307405_10691042 | Ga0307405_106910421 | 250 |
| 251 | 3300036401 | Ga0373937_0067294 | Ga0373937_0067294_916_1713 | 250 |
| 252 | 3300046515 | Ga0495620_0010958 | Ga0495620_0010958_2600_3391 | 250 |
| 253 | 3300046665 | Ga0495661_0097486 | Ga0495661_0097486_367_1158 | 250 |
| 254 | 3300047317 | Ga0495604_0030421 | Ga0495604_0030421_2784_3581 | 250 |
| 255 | 3300048925 | Ga0496122_0056202 | Ga0496122_0056202_316_1107 | 250 |
| 256 | 3300048926 | Ga0496123_0012813 | Ga0496123_0012813_3185_3976 | 250 |
| 257 | 3300048927 | Ga0496124_0039338 | Ga0496124_0039338_2222_3016 | 250 |
| 258 | 3300053085 | Ga0495619_0016762 | Ga0495619_0016762_993_1790 | 250 |
| 259 | 3300053121 | Ga0500607_114868 | Ga0500607_114868_276_1067 | 250 |
| 260 | 3300053148 | Ga0500590_010171 | Ga0500590_010171_2840_3637 | 250 |
| 261 | iso_pu_bacteria | 2818991446 | 2819602186 | 250 |
| 262 | iso_pu_bacteria | 2831265667 | 2831267469 | 250 |
| 263 | iso_pu_bacteria | 2838054893 | 2838060422 | 250 |
| 264 | iso_pu_bacteria | 2842677519 | 2842679252 | 250 |
| 265 | iso_pu_bacteria | 2842733646 | 2842735116 | 250 |
| 266 | iso_pu_bacteria | 2899924645 | 2899928748 | 250 |
| 267 | iso_pu_bacteria | 2919462493 | 2919466183 | 250 |
| 268 | iso_pu_bacteria | 2928037797 | 2928043315 | 250 |
| 269 | iso_pu_bacteria | 2928044640 | 2928050757 | 250 |
| 270 | iso_pu_bacteria | 2928051484 | 2928058751 | 250 |
| 271 | iso_pu_bacteria | 2928064002 | 2928066176 | 250 |
| 272 | 3300003752 | Ga0055539_1000213 | Ga0055539_100021324 | 251 |
| 273 | 3300003756 | Ga0055533_1000073 | Ga0055533_100007342 | 251 |
| 274 | 3300014497 | Ga0182008_10000400 | Ga0182008_1000040011 | 251 |
| 275 | 3300025226 | Ga0209674_100039 | Ga0209674_100039234 | 251 |
| 276 | 3300025230 | Ga0209563_100110 | Ga0209563_10011096 | 251 |
| 277 | 3300025253 | Ga0209677_100123 | Ga0209677_10012321 | 251 |
| 278 | 3300028794 | Ga0307515_10021161 | Ga0307515_100211616 | 251 |
| 279 | 3300031507 | Ga0307509_10205357 | Ga0307509_102053573 | 251 |
| 280 | 3300041512 | Ga0451853_2804152 | Ga0451853_2804152_435_1247 | 251 |
| 281 | 3300042004 | Ga0439445_0002631 | Ga0439445_0002631_2161_2961 | 251 |
| 282 | 3300042115 | Ga0450911_000185 | Ga0450911_000185_19014_19814 | 251 |
| 283 | 3300045976 | Ga0466967_0021387 | Ga0466967_0021387_1622_2425 | 251 |
| 284 | 3300046692 | Ga0495671_0011682 | Ga0495671_0011682_1830_2624 | 251 |
| 285 | 3300048924 | Ga0496121_0157683 | Ga0496121_0157683_539_1339 | 251 |
| 286 | 3300048928 | Ga0496125_0024648 | Ga0496125_0024648_477_1277 | 251 |
| 287 | 3300053079 | Ga0500610_0000721 | Ga0500610_0000721_5012_5806 | 251 |
| 288 | 3300053087 | Ga0500643_062510 | Ga0500643_062510_196_996 | 251 |
| 289 | 3300053117 | Ga0500593_002973 | Ga0500593_002973_4694_5488 | 251 |
| 290 | 3300053136 | Ga0500559_0004378 | Ga0500559_0004378_495_1295 | 251 |
| 291 | 3300053140 | Ga0500573_0014690 | Ga0500573_0014690_514_1314 | 251 |
| 292 | 3300053158 | Ga0500627_0001793 | Ga0500627_0001793_1876_2670 | 251 |
| 293 | iso_pu_bacteria | 2945909444 | 2945910504 | 251 |
| 294 | iso_pu_bacteria | 2945984333 | 2945987440 | 251 |
| 295 | 3300005616 | Ga0068852_100095558 | Ga0068852_1000955583 | 252 |
| 296 | 3300009036 | Ga0105244_10085212 | Ga0105244_100852122 | 252 |
| 297 | 3300013104 | Ga0157370_10004322 | Ga0157370_100043229 | 252 |
| 298 | 3300013306 | Ga0163162_10174960 | Ga0163162_101749602 | 252 |
| 299 | 3300014497 | Ga0182008_10005123 | Ga0182008_100051237 | 252 |
| 300 | 3300015262 | Ga0182007_10002167 | Ga0182007_100021675 | 252 |
| 301 | 3300025292 | Ga0209676_1030213 | Ga0209676_10302132 | 252 |
| 302 | 3300025294 | Ga0209025_1000686 | Ga0209025_100068655 | 252 |
| 303 | 3300026121 | Ga0207683_10011446 | Ga0207683_100114467 | 252 |
| 304 | 3300031730 | Ga0307516_10025219 | Ga0307516_100252197 | 252 |
| 305 | 3300032002 | Ga0307416_100011500 | Ga0307416_1000115004 | 252 |
| 306 | 3300044694 | Ga0466963_0035097 | Ga0466963_0035097_1732_2535 | 252 |
| 307 | 3300046462 | Ga0495651_0235537 | Ga0495651_0235537_257_1060 | 252 |
| 308 | 3300046471 | Ga0495650_0004944 | Ga0495650_0004944_1604_2407 | 252 |
| 309 | 3300046475 | Ga0495639_0011236 | Ga0495639_0011236_302_1105 | 252 |
| 310 | 3300046506 | Ga0495583_0000164 | Ga0495583_0000164_46446_47249 | 252 |
| 311 | 3300046507 | Ga0495606_0001489 | Ga0495606_0001489_25628_26431 | 252 |
| 312 | 3300046512 | Ga0495610_0085071 | Ga0495610_0085071_164_964 | 252 |
| 313 | 3300046520 | Ga0495637_0005214 | Ga0495637_0005214_2856_3656 | 252 |
| 314 | 3300046529 | Ga0495652_0048602 | Ga0495652_0048602_2521_3324 | 252 |
| 315 | 3300046660 | Ga0495625_0033000 | Ga0495625_0033000_1687_2487 | 252 |
| 316 | 3300046660 | Ga0495625_0037321 | Ga0495625_0037321_397_1200 | 252 |
| 317 | 3300046674 | Ga0495588_0003415 | Ga0495588_0003415_5027_5827 | 252 |
| 318 | 3300046691 | Ga0495670_0305038 | Ga0495670_0305038_14_814 | 252 |
| 319 | 3300046694 | Ga0495649_0001452 | Ga0495649_0001452_7874_8677 | 252 |
| 320 | 3300046794 | Ga0495589_0024524 | Ga0495589_0024524_681_1484 | 252 |
| 321 | 3300048089 | Ga0495614_0031447 | Ga0495614_0031447_1097_1897 | 252 |
| 322 | 3300048913 | Ga0496110_0328938 | Ga0496110_0328938_333_1130 | 252 |
| 323 | 3300048917 | Ga0496114_0065814 | Ga0496114_0065814_276_1088 | 252 |
| 324 | 3300048924 | Ga0496121_0003970 | Ga0496121_0003970_14550_15353 | 252 |
| 325 | 3300048928 | Ga0496125_0005512 | Ga0496125_0005512_3016_3819 | 252 |
| 326 | 3300053079 | Ga0500610_0000424 | Ga0500610_0000424_5776_6576 | 252 |
| 327 | 3300053080 | Ga0500635_0006347 | Ga0500635_0006347_1544_2347 | 252 |
| 328 | 3300053088 | Ga0500644_0019949 | Ga0500644_0019949_1127_1927 | 252 |
| 329 | 3300053136 | Ga0500559_0060760 | Ga0500559_0060760_562_1365 | 252 |
| 330 | 3300053138 | Ga0500564_065359 | Ga0500564_065359_420_1223 | 252 |
| 331 | iso_pu_bacteria | 2599185214 | 2599625296 | 252 |
| 332 | iso_pu_bacteria | 2599185226 | 2599673252 | 252 |
| 333 | iso_pu_bacteria | 2599185227 | 2599682922 | 252 |
| 334 | iso_pu_bacteria | 2599185229 | 2599694860 | 252 |
| 335 | iso_pu_bacteria | 2928070936 | 2928077793 | 252 |
| 336 | 3300002774 | JGI25150J39212_1000489 | JGI25150J39212_100048917 | 253 |
| 337 | 3300002987 | JGI25159J45721_1000405 | JGI25159J45721_100040516 | 253 |
| 338 | 3300003187 | JGI25151J46595_10001020 | JGI25151J46595_1000102017 | 253 |
| 339 | 3300003215 | JGI25153J46596_10000667 | JGI25153J46596_1000066717 | 253 |
| 340 | 3300003354 | JGI25160J50197_1000610 | JGI25160J50197_100061016 | 253 |
| 341 | 3300003374 | JGI25161J50226_1000462 | JGI25161J50226_10004627 | 253 |
| 342 | 3300003771 | Ga0055526_1001065 | Ga0055526_10010657 | 253 |
| 343 | 3300003773 | Ga0055537_1000558 | Ga0055537_100055817 | 253 |
| 344 | 3300003775 | Ga0055524_1000847 | Ga0055524_100084716 | 253 |
| 345 | 3300003781 | Ga0055536_1033357 | Ga0055536_10333572 | 253 |
| 346 | 3300003784 | Ga0055534_1000524 | Ga0055534_100052417 | 253 |
| 347 | 3300003790 | Ga0055528_1000834 | Ga0055528_100083417 | 253 |
| 348 | 3300003792 | Ga0055540_1013330 | Ga0055540_10133304 | 253 |
| 349 | 3300003794 | Ga0055531_10002005 | Ga0055531_100020057 | 253 |
| 350 | 3300004625 | Ga0055543_1000420 | Ga0055543_100042012 | 253 |
| 351 | 3300005262 | Ga0065165_1001375 | Ga0065165_100137517 | 253 |
| 352 | 3300009551 | Ga0105238_10725233 | Ga0105238_107252332 | 253 |
| 353 | 3300017792 | Ga0163161_10008137 | Ga0163161_100081371 | 253 |
| 354 | 3300025208 | Ga0209436_102111 | Ga0209436_1021114 | 253 |
| 355 | 3300025245 | Ga0207425_1000282 | Ga0207425_100028220 | 253 |
| 356 | 3300025258 | Ga0209129_1000436 | Ga0209129_100043618 | 253 |
| 357 | 3300025263 | Ga0209565_1000165 | Ga0209565_100016520 | 253 |
| 358 | 3300025273 | Ga0209673_1001101 | Ga0209673_100110112 | 253 |
| 359 | 3300025284 | Ga0209130_1000427 | Ga0209130_100042727 | 253 |
| 360 | 3300025291 | Ga0209675_1000321 | Ga0209675_100032120 | 253 |
| 361 | 3300025291 | Ga0209675_1002144 | Ga0209675_10021444 | 253 |
| 362 | 3300025292 | Ga0209676_1001670 | Ga0209676_100167012 | 253 |
| 363 | 3300025294 | Ga0209025_1001318 | Ga0209025_100131820 | 253 |
| 364 | 3300025294 | Ga0209025_1026829 | Ga0209025_10268292 | 253 |
| 365 | 3300025295 | Ga0209564_1000352 | Ga0209564_100035220 | 253 |
| 366 | 3300025297 | Ga0209758_1000297 | Ga0209758_100029720 | 253 |
| 367 | 3300025299 | Ga0209256_1000238 | Ga0209256_100023820 | 253 |
| 368 | 3300025302 | Ga0207426_1000294 | Ga0207426_100029420 | 253 |
| 369 | 3300025303 | Ga0209051_1012012 | Ga0209051_10120122 | 253 |
| 370 | 3300025304 | Ga0209257_1001472 | Ga0209257_100147212 | 253 |
| 371 | 3300025933 | Ga0207706_10111615 | Ga0207706_101116152 | 253 |
| 372 | 3300035691 | Ga0373931_0010782 | Ga0373931_0010782_481_1287 | 253 |
| 373 | 3300046512 | Ga0495610_0048904 | Ga0495610_0048904_930_1733 | 253 |
| 374 | 3300046513 | Ga0495616_0000350 | Ga0495616_0000350_4300_5103 | 253 |
| 375 | 3300046518 | Ga0495631_0000182 | Ga0495631_0000182_7261_8064 | 253 |
| 376 | 3300046520 | Ga0495637_0049029 | Ga0495637_0049029_552_1355 | 253 |
| 377 | 3300046660 | Ga0495625_0026207 | Ga0495625_0026207_3271_4074 | 253 |
| 378 | 3300047472 | Ga0495686_0023741 | Ga0495686_0023741_1426_2232 | 253 |
| 379 | 3300048906 | Ga0496103_0306873 | Ga0496103_0306873_146_952 | 253 |
| 380 | 3300048920 | Ga0496117_0015763 | Ga0496117_0015763_5096_5896 | 253 |
| 381 | 3300048922 | Ga0496119_0032738 | Ga0496119_0032738_2597_3400 | 253 |
| 382 | 3300048924 | Ga0496121_0103534 | Ga0496121_0103534_1210_2010 | 253 |
| 383 | 3300048925 | Ga0496122_0176058 | Ga0496122_0176058_110_913 | 253 |
| 384 | 3300048926 | Ga0496123_0066207 | Ga0496123_0066207_880_1683 | 253 |
| 385 | 3300048927 | Ga0496124_0109204 | Ga0496124_0109204_1185_1985 | 253 |
| 386 | 3300048928 | Ga0496125_0305786 | Ga0496125_0305786_130_933 | 253 |
| 387 | 3300053087 | Ga0500643_009531 | Ga0500643_009531_722_1525 | 253 |
| 388 | 3300053118 | Ga0500594_0000469 | Ga0500594_0000469_2941_3744 | 253 |
| 389 | 3300053133 | Ga0500655_000096 | Ga0500655_000096_2390_3193 | 253 |
| 390 | 3300053134 | Ga0500658_0001231 | Ga0500658_0001231_7750_8553 | 253 |
| 391 | 3300053139 | Ga0500568_0000111 | Ga0500568_0000111_33557_34360 | 253 |
| 392 | 3300053153 | Ga0500616_0069065 | Ga0500616_0069065_327_1130 | 253 |
| 393 | 3300053162 | Ga0500638_033270 | Ga0500638_033270_359_1162 | 253 |
| 394 | 3300001979 | JGI24740J21852_10011266 | JGI24740J21852_100112661 | 254 |
| 395 | 3300001989 | JGI24739J22299_10028999 | JGI24739J22299_100289993 | 254 |
| 396 | 3300002705 | JGI25156J39149_1000250 | JGI25156J39149_100025020 | 254 |
| 397 | 3300002738 | JGI25154J39366_1000822 | JGI25154J39366_10008226 | 254 |
| 398 | 3300002741 | JGI25157J39369_1000027 | JGI25157J39369_100002739 | 254 |
| 399 | 3300002773 | JGI25152J39213_1001782 | JGI25152J39213_10017829 | 254 |
| 400 | 3300002987 | JGI25159J45721_1005983 | JGI25159J45721_10059832 | 254 |
| 401 | 3300003187 | JGI25151J46595_10017389 | JGI25151J46595_100173891 | 254 |
| 402 | 3300003215 | JGI25153J46596_10013036 | JGI25153J46596_100130363 | 254 |
| 403 | 3300003316 | rootH1_10084040 | rootH1_100840401 | 254 |
| 404 | 3300003320 | rootH2_10001994 | rootH2_100019942 | 254 |
| 405 | 3300003320 | rootH2_10001995 | rootH2_100019953 | 254 |
| 406 | 3300003320 | rootH2_10038664 | rootH2_100386648 | 254 |
| 407 | 3300003323 | rootH1_10038052 | rootH1_100380524 | 254 |
| 408 | 3300003354 | JGI25160J50197_1004983 | JGI25160J50197_10049832 | 254 |
| 409 | 3300003374 | JGI25161J50226_1001148 | JGI25161J50226_10011483 | 254 |
| 410 | 3300003578 | Ga0006562J51391_1187520 | Ga0006562J51391_11875201 | 254 |
| 411 | 3300003578 | Ga0006562J51391_1187522 | Ga0006562J51391_11875222 | 254 |
| 412 | 3300003761 | Ga0055535_1000338 | Ga0055535_100033832 | 254 |
| 413 | 3300003762 | Ga0055542_1000103 | Ga0055542_100010332 | 254 |
| 414 | 3300003771 | Ga0055526_1003242 | Ga0055526_10032425 | 254 |
| 415 | 3300003773 | Ga0055537_1001751 | Ga0055537_10017514 | 254 |
| 416 | 3300003775 | Ga0055524_1001073 | Ga0055524_10010737 | 254 |
| 417 | 3300003781 | Ga0055536_1002194 | Ga0055536_100219413 | 254 |
| 418 | 3300003790 | Ga0055528_1007360 | Ga0055528_10073605 | 254 |
| 419 | 3300003791 | Ga0055530_10000342 | Ga0055530_1000034244 | 254 |
| 420 | 3300003792 | Ga0055540_1001923 | Ga0055540_100192313 | 254 |
| 421 | 3300003794 | Ga0055531_10002643 | Ga0055531_1000264313 | 254 |
| 422 | 3300004625 | Ga0055543_1000674 | Ga0055543_10006749 | 254 |
| 423 | 3300005262 | Ga0065165_1003647 | Ga0065165_10036473 | 254 |
| 424 | 3300005327 | Ga0070658_10009746 | Ga0070658_100097462 | 254 |
| 425 | 3300005327 | Ga0070658_10407827 | Ga0070658_104078271 | 254 |
| 426 | 3300005329 | Ga0070683_100197544 | Ga0070683_1001975442 | 254 |
| 427 | 3300005364 | Ga0070673_100014147 | Ga0070673_1000141477 | 254 |
| 428 | 3300005539 | Ga0068853_100011269 | Ga0068853_1000112693 | 254 |
| 429 | 3300005563 | Ga0068855_100012007 | Ga0068855_1000120079 | 254 |
| 430 | 3300005563 | Ga0068855_100062920 | Ga0068855_1000629203 | 254 |
| 431 | 3300005577 | Ga0068857_100000496 | Ga0068857_10000049616 | 254 |
| 432 | 3300005578 | Ga0068854_100001904 | Ga0068854_1000019048 | 254 |
| 433 | 3300005614 | Ga0068856_100013896 | Ga0068856_1000138968 | 254 |
| 434 | 3300006353 | Ga0075370_10091311 | Ga0075370_100913112 | 254 |
| 435 | 3300009093 | Ga0105240_10080524 | Ga0105240_100805244 | 254 |
| 436 | 3300009093 | Ga0105240_10147254 | Ga0105240_101472543 | 254 |
| 437 | 3300009093 | Ga0105240_10302339 | Ga0105240_103023392 | 254 |
| 438 | 3300009174 | Ga0105241_10155862 | Ga0105241_101558622 | 254 |
| 439 | 3300009545 | Ga0105237_10051539 | Ga0105237_100515394 | 254 |
| 440 | 3300009551 | Ga0105238_10058996 | Ga0105238_100589964 | 254 |
| 441 | 3300010375 | Ga0105239_10148120 | Ga0105239_101481203 | 254 |
| 442 | 3300013105 | Ga0157369_10058014 | Ga0157369_100580142 | 254 |
| 443 | 3300015261 | Ga0182006_1083814 | Ga0182006_10838141 | 254 |
| 444 | 3300025208 | Ga0209436_101114 | Ga0209436_1011142 | 254 |
| 445 | 3300025228 | Ga0209672_101942 | Ga0209672_1019425 | 254 |
| 446 | 3300025229 | Ga0209147_100483 | Ga0209147_1004838 | 254 |
| 447 | 3300025231 | Ga0207427_100388 | Ga0207427_1003888 | 254 |
| 448 | 3300025242 | Ga0209258_100133 | Ga0209258_100133129 | 254 |
| 449 | 3300025242 | Ga0209258_100567 | Ga0209258_10056721 | 254 |
| 450 | 3300025245 | Ga0207425_1001985 | Ga0207425_10019857 | 254 |
| 451 | 3300025246 | Ga0209646_1000231 | Ga0209646_100023136 | 254 |
| 452 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011107 | 254 |
| 453 | 3300025253 | Ga0209677_100287 | Ga0209677_10028717 | 254 |
| 454 | 3300025254 | Ga0209148_1000188 | Ga0209148_100018833 | 254 |
| 455 | 3300025256 | Ga0209759_1000107 | Ga0209759_1000107107 | 254 |
| 456 | 3300025256 | Ga0209759_1001140 | Ga0209759_10011405 | 254 |
| 457 | 3300025258 | Ga0209129_1000425 | Ga0209129_10004253 | 254 |
| 458 | 3300025263 | Ga0209565_1000820 | Ga0209565_100082012 | 254 |
| 459 | 3300025273 | Ga0209673_1000454 | Ga0209673_100045412 | 254 |
| 460 | 3300025284 | Ga0209130_1000924 | Ga0209130_100092411 | 254 |
| 461 | 3300025291 | Ga0209675_1001260 | Ga0209675_10012609 | 254 |
| 462 | 3300025292 | Ga0209676_1000111 | Ga0209676_1000111148 | 254 |
| 463 | 3300025294 | Ga0209025_1010672 | Ga0209025_10106724 | 254 |
| 464 | 3300025295 | Ga0209564_1000070 | Ga0209564_1000070172 | 254 |
| 465 | 3300025297 | Ga0209758_1003512 | Ga0209758_10035129 | 254 |
| 466 | 3300025298 | Ga0209050_1000111 | Ga0209050_100011143 | 254 |
| 467 | 3300025299 | Ga0209256_1000047 | Ga0209256_1000047184 | 254 |
| 468 | 3300025302 | Ga0207426_1000194 | Ga0207426_100019493 | 254 |
| 469 | 3300025303 | Ga0209051_1000340 | Ga0209051_100034027 | 254 |
| 470 | 3300025304 | Ga0209257_1000690 | Ga0209257_100069043 | 254 |
| 471 | 3300025909 | Ga0207705_10090331 | Ga0207705_100903312 | 254 |
| 472 | 3300025911 | Ga0207654_10105101 | Ga0207654_101051012 | 254 |
| 473 | 3300025913 | Ga0207695_10021906 | Ga0207695_100219064 | 254 |
| 474 | 3300025913 | Ga0207695_10105599 | Ga0207695_101055993 | 254 |
| 475 | 3300025913 | Ga0207695_10233343 | Ga0207695_102333432 | 254 |
| 476 | 3300025914 | Ga0207671_10278100 | Ga0207671_102781001 | 254 |
| 477 | 3300025924 | Ga0207694_10038070 | Ga0207694_100380703 | 254 |
| 478 | 3300025937 | Ga0207669_10069638 | Ga0207669_100696383 | 254 |
| 479 | 3300025944 | Ga0207661_10145681 | Ga0207661_101456812 | 254 |
| 480 | 3300025949 | Ga0207667_10014499 | Ga0207667_100144994 | 254 |
| 481 | 3300025960 | Ga0207651_10060165 | Ga0207651_100601651 | 254 |
| 482 | 3300025981 | Ga0207640_10010683 | Ga0207640_100106835 | 254 |
| 483 | 3300026041 | Ga0207639_10008330 | Ga0207639_100083303 | 254 |
| 484 | 3300026078 | Ga0207702_10000270 | Ga0207702_1000027053 | 254 |
| 485 | 3300026116 | Ga0207674_10003612 | Ga0207674_1000361215 | 254 |
| 486 | 3300031911 | Ga0307412_10003587 | Ga0307412_100035877 | 254 |
| 487 | 3300037466 | Ga0395898_0069276 | Ga0395898_0069276_1797_2606 | 254 |
| 488 | 3300037471 | Ga0395905_0096937 | Ga0395905_0096937_889_1698 | 254 |
| 489 | 3300042012 | Ga0439455_0005516 | Ga0439455_0005516_1334_2137 | 254 |
| 490 | 3300044842 | Ga0466957_0020924 | Ga0466957_0020924_2416_3225 | 254 |
| 491 | 3300048921 | Ga0496118_0044115 | Ga0496118_0044115_1282_2085 | 254 |
| 492 | 3300048928 | Ga0496125_0131428 | Ga0496125_0131428_116_919 | 254 |
| 493 | 3300053080 | Ga0500635_0000237 | Ga0500635_0000237_9085_9894 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7c83-assembly1.cif.gz_A | crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a | 0.721 | 19 | 244 |
| 7c83-assembly1.cif.gz_A | crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a | 0.6037 | 19 | 244 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.5101 | 2 | 244 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.4912 | 2 | 244 |
| 4hyj-assembly1.cif.gz_A | crystal structure of exiguobacterium sibiricum rhodopsin | 0.4306 | 13 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53731_51_249_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9228 | 44 | 245 | 1.20.120.1630 |
| af_O53731_51_249_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9183 | 44 | 245 | 1.20.120.1630 |
| af_F1QW92_73_271_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8971 | 48 | 245 | 1.20.120.1630 |
| af_C6TD75_105_305_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8928 | 48 | 244 | 1.20.120.1630 |
| af_I1KQJ7_60_258_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8851 | 48 | 245 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S9CYB9-F1-model_v4 | Uncharacterized protein | 0.9808 | 106 | 247 |
GO:0016020
|
| AF-A0A7C5F542-F1-model_v4 | DUF1295 domain-containing protein | 0.9698 | 54 | 247 |
GO:0016020
|
| AF-A0A2R7S3V4-F1-model_v4 | deleted | 0.9651 | 109 | 247 |
|
| AF-A0A1W9ID13-F1-model_v4 | Uncharacterized protein | 0.9647 | 18 | 253 |
GO:0016020
|
| AF-A0A1S9CYB9-F1-model_v4 | Uncharacterized protein | 0.9604 | 106 | 247 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar