F454410

General Info

Members Datasets Scaffolds Average Seq Length
493 236 488 206

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1006357|Ga0081540_10063573
Length 219
Sequence MPEASTLALFALAAITLLVIPGPSVLYIVTRSIDQGRAAGLASVGGIHVGTLVHVAAAAFGLSALLVSSATAYHAVRWLGAAYLIWLGVRRLLARDEDGVGSAAGSGTGARRVGLRRVFAQGVVVNVLNPKTALFFFAFLPQFVDTGRGSVPFQVLVFGVAFVLLGLLSDGGYALLASTGAGWLRRRPRVARASRLVSGGVLISLGVTTALAGSRSSSS

Samples

Sample ID Description Type Environment
1 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
2 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
3 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
4 2891562705 Microbispora tritici MT50 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
140 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
143 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
144 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
145 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.81
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 7.51
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009793 3300003203 Unclassified 4280
2 JGI25407J50210_10038187 3300003373 Unclassified 1233
3 JGI25407J50210_10040072 3300003373 Unclassified 1201
4 Ga0070658_10012764 3300005327 Bacteria 6741
5 Ga0070658_10018981 3300005327 Bacteria 5509
6 Ga0070683_100019247 3300005329 Bacteria 6064
7 Ga0070683_100150098 3300005329 Bacteria 2209
8 Ga0070680_100029417 3300005336 Bacteria 4413
9 Ga0070680_100317122 3300005336 Bacteria 1323
10 Ga0070682_100094079 3300005337 Bacteria 1966
11 Ga0068868_100157115 3300005338 Bacteria 1876
12 Ga0070660_100117024 3300005339 Bacteria 2125
13 Ga0070660_100267427 3300005339 Bacteria 1397
14 Ga0070689_100574266 3300005340 Bacteria 974
15 Ga0070661_100070040 3300005344 Bacteria 2579
16 Ga0070661_100082902 3300005344 Bacteria 2368
17 Ga0070668_100101202 3300005347 Bacteria 2283
18 Ga0070669_100519988 3300005353 Bacteria 989
19 Ga0070671_100478418 3300005355 Bacteria 1070
20 Ga0070674_100856233 3300005356 Bacteria 789
21 Ga0070714_100567557 3300005435 Bacteria 1088
22 Ga0070714_100709610 3300005435 Bacteria 971
23 Ga0070694_100041995 3300005444 Bacteria 3053
24 Ga0070663_100239665 3300005455 Bacteria 1431
25 Ga0070678_100342668 3300005456 Bacteria 1283
26 Ga0070681_10017674 3300005458 Bacteria 7127
27 Ga0070681_10053033 3300005458 Bacteria 4042
28 Ga0070681_10074013 3300005458 Bacteria 3368
29 Ga0070681_10108875 3300005458 Bacteria 2711
30 Ga0070706_100055220 3300005467 Unclassified 3666
31 Ga0070707_100147987 3300005468 Bacteria 2286
32 Ga0070707_100483458 3300005468 Bacteria 1200
33 Ga0070698_100032386 3300005471 Bacteria 5415
34 Ga0070698_100264761 3300005471 Bacteria 1651
35 Ga0070699_100412852 3300005518 Unclassified 1221
36 Ga0070679_100157118 3300005530 Bacteria 2249
37 Ga0070684_100005987 3300005535 Bacteria 9369
38 Ga0070697_100198378 3300005536 Bacteria 1705
39 Ga0070697_100341999 3300005536 Bacteria 1291
40 Ga0070697_100502013 3300005536 Unclassified 1061
41 Ga0070693_100006552 3300005547 Bacteria 5649
42 Ga0070665_100375899 3300005548 Bacteria 1428
43 Ga0070704_100049629 3300005549 Bacteria 2945
44 Ga0070704_100170814 3300005549 Bacteria 1729
45 Ga0068855_100005806 3300005563 Bacteria 15060
46 Ga0068855_101341389 3300005563 Bacteria 739
47 Ga0068857_100536002 3300005577 Bacteria 1101
48 Ga0068856_100015370 3300005614 Bacteria 7397
49 Ga0068856_100024457 3300005614 Bacteria 5880
50 Ga0068852_100090687 3300005616 Bacteria 2734
51 Ga0068859_100595305 3300005617 Bacteria 1199
52 Ga0068861_100007345 3300005719 Bacteria 7550
53 Ga0081455_10007386 3300005937 Bacteria 11581
54 Ga0081455_10014947 3300005937 Bacteria 7562
55 Ga0081455_10071781 3300005937 Bacteria 2869
56 Ga0081455_10139320 3300005937 Bacteria 1886
57 Ga0081538_10004517 3300005981 Bacteria 12812
58 Ga0081538_10017483 3300005981 Bacteria 5441
59 Ga0081538_10020664 3300005981 Bacteria 4836
60 Ga0081538_10029392 3300005981 Bacteria 3755
61 Ga0081538_10032675 3300005981 Bacteria 3479
62 Ga0081538_10066443 3300005981 Bacteria 2022
63 Ga0081538_10129813 3300005981 Bacteria 1187
64 Ga0081540_1006357 3300005983 Bacteria 8626
65 Ga0081539_10003951 3300005985 Bacteria 17171
66 Ga0081539_10013807 3300005985 Bacteria 6048
67 Ga0081539_10026925 3300005985 Bacteria 3654
68 Ga0081539_10045444 3300005985 Bacteria 2525
69 Ga0075368_10000164 3300006042 Bacteria 17808
70 Ga0075364_10024318 3300006051 Bacteria 3845
71 Ga0075432_10002067 3300006058 Bacteria 6677
72 Ga0075362_10113547 3300006177 Bacteria 1277
73 Ga0075427_10002315 3300006194 Bacteria 2542
74 Ga0075428_100075996 3300006844 Bacteria 3667
75 Ga0075428_100094254 3300006844 Bacteria 3264
76 Ga0075430_100000087 3300006846 Bacteria 52758
77 Ga0075430_100000806 3300006846 Bacteria 24395
78 Ga0075431_100000559 3300006847 Bacteria 31330
79 Ga0075431_100008857 3300006847 Bacteria 10082
80 Ga0075433_10056284 3300006852 Bacteria 3434
81 Ga0075434_100001481 3300006871 Bacteria 19788
82 Ga0075434_100035254 3300006871 Bacteria 4945
83 Ga0075434_100096789 3300006871 Bacteria 2956
84 Ga0075434_100275698 3300006871 Bacteria 1701
85 Ga0075434_100462566 3300006871 Bacteria 1290
86 Ga0075429_100026617 3300006880 Bacteria 5023
87 Ga0075429_100164222 3300006880 Bacteria 1945
88 Ga0075429_100640045 3300006880 Bacteria 932
89 Ga0075436_100001323 3300006914 Bacteria 16837
90 Ga0075436_100021215 3300006914 Bacteria 4457
91 Ga0097620_100595330 3300006931 Bacteria 1199
92 Ga0075435_100000294 3300007076 Bacteria 30965
93 Ga0075435_100087904 3300007076 Bacteria 2561
94 Ga0075435_100115518 3300007076 Bacteria 2235
95 Ga0075435_100371861 3300007076 Bacteria 1227
96 Ga0075435_100838218 3300007076 Bacteria 801
97 Ga0105240_10079185 3300009093 Bacteria 4044
98 Ga0111539_10014578 3300009094 Bacteria 9814
99 Ga0111539_10626494 3300009094 Bacteria 1253
100 Ga0111539_10835894 3300009094 Bacteria 1071
101 Ga0105245_10017600 3300009098 Bacteria 6239
102 Ga0105245_10696873 3300009098 Bacteria 1049
103 Ga0114129_10000487 3300009147 Bacteria 47969
104 Ga0114129_10005351 3300009147 Bacteria 18115
105 Ga0114129_10333793 3300009147 Bacteria 2012
106 Ga0105241_10357478 3300009174 Bacteria 1270
107 Ga0105242_10099828 3300009176 Bacteria 2457
108 Ga0105248_10823629 3300009177 Bacteria 1048
109 Ga0105238_10247081 3300009551 Bacteria 1762
110 Ga0105249_10586897 3300009553 Unclassified 1168
111 Ga0105239_10297907 3300010375 Bacteria 1816
112 Ga0157373_10197160 3300013100 Bacteria 1419
113 Ga0157370_10103027 3300013104 Bacteria 2672
114 Ga0157370_10162407 3300013104 Unclassified 2078
115 Ga0157369_10019158 3300013105 Bacteria 7659
116 Ga0157369_10135630 3300013105 Bacteria 2606
117 Ga0157369_10267251 3300013105 Bacteria 1783
118 Ga0157369_10341062 3300013105 Bacteria 1556
119 Ga0157374_10128227 3300013296 Bacteria 2454
120 Ga0157378_10393543 3300013297 Bacteria 1364
121 Ga0163162_10088821 3300013306 Bacteria 3170
122 Ga0157372_10644105 3300013307 Bacteria 1234
123 Ga0157375_10112248 3300013308 Bacteria 2826
124 Ga0157375_10304424 3300013308 Bacteria 1758
125 Ga0157375_10478123 3300013308 Bacteria 1411
126 Ga0157377_10203572 3300014745 Bacteria 1258
127 Ga0197907_11034853 3300020069 Bacteria 3558
128 Ga0206356_11138687 3300020070 Bacteria 1163
129 Ga0206354_11012564 3300020081 Bacteria 1198
130 Ga0206353_11008696 3300020082 Bacteria 1446
131 Ga0207710_10210680 3300025900 Bacteria 962
132 Ga0207705_10011990 3300025909 Bacteria 6264
133 Ga0207705_10174359 3300025909 Bacteria 1620
134 Ga0207654_10215775 3300025911 Bacteria 1270
135 Ga0207707_10028965 3300025912 Bacteria 4840
136 Ga0207707_10038134 3300025912 Bacteria 4199
137 Ga0207707_10048509 3300025912 Bacteria 3698
138 Ga0207695_10086065 3300025913 Bacteria 3171
139 Ga0207660_10073252 3300025917 Bacteria 2497
140 Ga0207660_10180671 3300025917 Bacteria 1638
141 Ga0207657_10082379 3300025919 Bacteria 2701
142 Ga0207657_10114062 3300025919 Bacteria 2229
143 Ga0207649_10021599 3300025920 Bacteria 3708
144 Ga0207649_10305085 3300025920 Bacteria 1165
145 Ga0207652_10192387 3300025921 Bacteria 1835
146 Ga0207646_10039533 3300025922 Bacteria 4246
147 Ga0207646_10126940 3300025922 Bacteria 2294
148 Ga0207681_10710725 3300025923 Bacteria 836
149 Ga0207694_10281284 3300025924 Bacteria 1367
150 Ga0207687_10008306 3300025927 Bacteria 6792
151 Ga0207687_10030205 3300025927 Bacteria 3652
152 Ga0207687_10349446 3300025927 Unclassified 1204
153 Ga0207706_10002988 3300025933 Bacteria 16306
154 Ga0207686_10062622 3300025934 Bacteria 2363
155 Ga0207686_10347575 3300025934 Bacteria 1116
156 Ga0207709_10101535 3300025935 Bacteria 1903
157 Ga0207670_10111543 3300025936 Bacteria 1972
158 Ga0207669_10245737 3300025937 Bacteria 1329
159 Ga0207661_10020760 3300025944 Bacteria 4914
160 Ga0207679_11837634 3300025945 Bacteria 553
161 Ga0207667_10437775 3300025949 Bacteria 1329
162 Ga0207651_10722884 3300025960 Bacteria 879
163 Ga0207712_10207275 3300025961 Bacteria 1559
164 Ga0207668_10074047 3300025972 Bacteria 2443
165 Ga0207677_10130728 3300026023 Bacteria 1906
166 Ga0207678_10043827 3300026067 Bacteria 3871
167 Ga0207702_10184213 3300026078 Bacteria 1925
168 Ga0207675_100019826 3300026118 Bacteria 6276
169 Ga0207683_10593266 3300026121 Bacteria 1025
170 Ga0207698_10055570 3300026142 Bacteria 3052
171 Ga0207428_10000441 3300027907 Bacteria 50886
172 Ga0268266_12036028 3300028379 Bacteria 547
173 Ga0268265_11326202 3300028380 Bacteria 720
174 Ga0307408_100085839 3300031548 Bacteria 2365
175 Ga0307408_100126686 3300031548 Bacteria 1987
176 Ga0307405_10054809 3300031731 Bacteria 2491
177 Ga0307405_10070481 3300031731 Bacteria 2245
178 Ga0307405_10231202 3300031731 Bacteria 1363
179 Ga0307405_10375411 3300031731 Bacteria 1105
180 Ga0307413_10010793 3300031824 Bacteria 4453
181 Ga0307413_10088130 3300031824 Bacteria 2012
182 Ga0307413_10134173 3300031824 Bacteria 1699
183 Ga0307410_10007941 3300031852 Bacteria 5849
184 Ga0307410_10208140 3300031852 Bacteria 1497
185 Ga0307410_10250600 3300031852 Bacteria 1376
186 Ga0307410_10527371 3300031852 Bacteria 975
187 Ga0307410_10620234 3300031852 Bacteria 904
188 Ga0307406_10011213 3300031901 Bacteria 5080
189 Ga0307406_10015488 3300031901 Bacteria 4414
190 Ga0307406_10093807 3300031901 Bacteria 2027
191 Ga0307407_10001374 3300031903 Bacteria 8771
192 Ga0307407_10010578 3300031903 Bacteria 4359
193 Ga0307407_10025393 3300031903 Bacteria 3121
194 Ga0307412_10105211 3300031911 Bacteria 2004
195 Ga0307412_10415591 3300031911 Bacteria 1099
196 Ga0307412_10525466 3300031911 Bacteria 989
197 Ga0307409_100001449 3300031995 Bacteria 11658
198 Ga0307409_100001663 3300031995 Bacteria 11169
199 Ga0307409_100039849 3300031995 Bacteria 3490
200 Ga0307409_100137813 3300031995 Bacteria 2097
201 Ga0307409_100146392 3300031995 Bacteria 2043
202 Ga0307409_100237240 3300031995 Bacteria 1657
203 Ga0307409_100810399 3300031995 Bacteria 944
204 Ga0307416_100017664 3300032002 Bacteria 4999
205 Ga0307416_100029758 3300032002 Bacteria 4085
206 Ga0307416_100032355 3300032002 Bacteria 3950
207 Ga0307416_100032774 3300032002 Bacteria 3931
208 Ga0307416_100902885 3300032002 Bacteria 983
209 Ga0307414_10013805 3300032004 Bacteria 4820
210 Ga0307414_10222506 3300032004 Bacteria 1550
211 Ga0307414_10655857 3300032004 Bacteria 946
212 Ga0307411_10126913 3300032005 Bacteria 1857
213 Ga0307411_10288246 3300032005 Bacteria 1310
214 Ga0307415_100002353 3300032126 Bacteria 9401
215 Ga0307415_100003480 3300032126 Bacteria 8027
216 Ga0307415_100007317 3300032126 Bacteria 6028
217 Ga0307415_100064007 3300032126 Bacteria 2557
218 Ga0307415_100360599 3300032126 Bacteria 1227
219 Ga0316212_1008279 3300033547 Bacteria 1497
220 Ga0373951_0131238 3300035091 Bacteria 689
221 Ga0373951_0142454 3300035091 Bacteria 667
222 Ga0373960_0091600 3300035121 Bacteria 973
223 Ga0373931_0021771 3300035691 Bacteria 3219
224 Ga0373947_0024768 3300035725 Bacteria 3499
225 Ga0373947_0259417 3300035725 Bacteria 1151
226 Ga0395899_0075563 3300037312 Bacteria 2460
227 Ga0395899_0101137 3300037312 Bacteria 2081
228 Ga0395900_0037016 3300037418 Bacteria 5031
229 Ga0395900_0043240 3300037418 Bacteria 4643
230 Ga0395900_0073137 3300037418 Bacteria 3524
231 Ga0395900_0096915 3300037418 Bacteria 3030
232 Ga0395900_0160506 3300037418 Bacteria 2293
233 Ga0395900_0239973 3300037418 Bacteria 1819
234 Ga0395898_0012735 3300037466 Bacteria 8686
235 Ga0395898_0046291 3300037466 Bacteria 4273
236 Ga0395898_0048559 3300037466 Bacteria 4161
237 Ga0395905_0013766 3300037471 Bacteria 7744
238 Ga0395905_0199102 3300037471 Bacteria 1878
239 Ga0395905_0354892 3300037471 Bacteria 1358
240 Ga0395905_0457581 3300037471 Bacteria 1174
241 Ga0395905_0849225 3300037471 Bacteria 816
242 Ga0395901_0076480 3300038443 Bacteria 3492
243 Ga0395901_0076481 3300038443 Bacteria 3492
244 Ga0395901_0093570 3300038443 Bacteria 3147
245 Ga0395901_0203547 3300038443 Bacteria 2074
246 Ga0395901_0717669 3300038443 Bacteria 996
247 Ga0439443_007444 3300042003 Bacteria 1524
248 Ga0439443_014780 3300042003 Bacteria 1179
249 Ga0439448_0000623 3300042005 Bacteria 8345
250 Ga0439448_0042719 3300042005 Bacteria 1470
251 Ga0439448_0085518 3300042005 Bacteria 1062
252 Ga0439448_0116218 3300042005 Unclassified 916
253 Ga0439450_000479 3300042008 Bacteria 5212
254 Ga0439450_007890 3300042008 Bacteria 1968
255 Ga0439451_027488 3300042009 Bacteria 1147
256 Ga0439454_001221 3300042011 Bacteria 2398
257 Ga0439455_0016062 3300042012 Bacteria 1727
258 Ga0439463_001192 3300042016 Bacteria 6957
259 Ga0439463_058584 3300042016 Bacteria 985
260 Ga0450888_009622 3300042126 Bacteria 1108
261 Ga0450900_014470 3300042136 Bacteria 1053
262 Ga0450905_004131 3300042142 Bacteria 1917
263 Ga0439458_0014100 3300042157 Bacteria 1803
264 Ga0439444_0008392 3300042437 Bacteria 1609
265 Ga0439444_0039964 3300042437 Bacteria 917
266 Ga0439464_0000658 3300042439 Bacteria 7384
267 Ga0439464_0109081 3300042439 Bacteria 846
268 Ga0439460_0003813 3300042461 Bacteria 3649
269 Ga0450916_000486 3300042530 Bacteria 3459
270 Ga0451577_0155826 3300042876 Bacteria 2056
271 Ga0439440_0000012 3300042993 Bacteria 20240
272 Ga0439440_0007023 3300042993 Bacteria 2281
273 Ga0466972_0163510 3300044658 Bacteria 1045
274 Ga0453683_0028719 3300044673 Bacteria 3520
275 Ga0466961_0291749 3300044693 Bacteria 997
276 Ga0466968_0028426 3300044735 Bacteria 2305
277 Ga0466957_0739313 3300044842 Bacteria 696
278 Ga0466960_0107195 3300044901 Bacteria 1447
279 Ga0451576_0520113 3300045051 Bacteria 1250
280 Ga0466967_0900669 3300045976 Bacteria 880
281 Ga0495582_0043181 3300046473 Bacteria 2483
282 Ga0495631_0066997 3300046518 Bacteria 1554
283 Ga0495663_0069806 3300046525 Bacteria 1117
284 Ga0495586_0090177 3300046535 Bacteria 1693
285 Ga0495656_0002723 3300046615 Bacteria 5903
286 Ga0495668_0229316 3300046616 Bacteria 1017
287 Ga0495634_0002689 3300046642 Bacteria 14612
288 Ga0495613_0001457 3300046689 Bacteria 18048
289 Ga0495670_0170305 3300046691 Bacteria 1147
290 Ga0495670_0355788 3300046691 Bacteria 788
291 Ga0495674_0218578 3300047319 Bacteria 1576
292 Ga0495676_0210601 3300047321 Bacteria 1345
293 Ga0495677_0089539 3300047445 Bacteria 1159
294 Ga0495614_0206880 3300048089 Bacteria 889
295 Ga0496100_0068427 3300048903 Bacteria 2361
296 Ga0496100_0071282 3300048903 Bacteria 2320
297 Ga0496100_0155099 3300048903 Bacteria 1637
298 Ga0496101_0003174 3300048904 Bacteria 10181
299 Ga0496102_0022678 3300048905 Bacteria 5563
300 Ga0496102_0537565 3300048905 Bacteria 1091
301 Ga0496103_0087212 3300048906 Bacteria 1967
302 Ga0496104_0000319 3300048907 Bacteria 42768
303 Ga0496104_0010984 3300048907 Bacteria 8103
304 Ga0496104_0323811 3300048907 Bacteria 1454
305 Ga0496104_1607264 3300048907 Bacteria 553
306 Ga0496105_0000194 3300048908 Bacteria 40666
307 Ga0496105_0113251 3300048908 Bacteria 2239
308 Ga0496105_0117934 3300048908 Bacteria 2189
309 Ga0496106_0186288 3300048909 Bacteria 1649
310 Ga0496106_0407209 3300048909 Bacteria 1093
311 Ga0496106_0458208 3300048909 Bacteria 1024
312 Ga0496108_0045169 3300048911 Bacteria 3679
313 Ga0496108_0049198 3300048911 Bacteria 3526
314 Ga0496109_0060049 3300048912 Bacteria 3474
315 Ga0496109_0083045 3300048912 Bacteria 2954
316 Ga0496109_0123567 3300048912 Bacteria 2412
317 Ga0496109_0216742 3300048912 Bacteria 1800
318 Ga0496109_0323216 3300048912 Bacteria 1456
319 Ga0496110_0000757 3300048913 Bacteria 22349
320 Ga0496110_0228858 3300048913 Bacteria 1690
321 Ga0496110_0235360 3300048913 Bacteria 1666
322 Ga0496111_0014154 3300048914 Bacteria 5443
323 Ga0496111_0037840 3300048914 Bacteria 3454
324 Ga0496111_0123723 3300048914 Bacteria 1911
325 Ga0496112_0717044 3300048915 Bacteria 928
326 Ga0496112_0771332 3300048915 Bacteria 887
327 Ga0496113_0357891 3300048916 Bacteria 1171
328 Ga0496114_0006143 3300048917 Bacteria 9451
329 Ga0496114_0013917 3300048917 Bacteria 6450
330 Ga0496114_0108682 3300048917 Bacteria 2374
331 Ga0496115_0012640 3300048918 Bacteria 6362
332 Ga0501031_0005948 3300049568 Bacteria 7958
333 Ga0501031_0105035 3300049568 Bacteria 1843
334 Ga0501032_0030111 3300049569 Bacteria 3723
335 Ga0501033_0138533 3300049570 Bacteria 1760
336 Ga0501036_0005506 3300049572 Bacteria 10266
337 Ga0501036_0061848 3300049572 Bacteria 3171
338 Ga0501036_0101793 3300049572 Bacteria 2430
339 Ga0501036_0116248 3300049572 Bacteria 2259
340 Ga0501036_0273182 3300049572 Bacteria 1415
341 Ga0501036_0481353 3300049572 Unclassified 1033
342 Ga0501037_0004052 3300049573 Bacteria 10627
343 Ga0501038_0010889 3300049574 Bacteria 8306
344 Ga0501038_0029804 3300049574 Bacteria 4833
345 Ga0501038_0034963 3300049574 Bacteria 4416
346 Ga0501038_0138743 3300049574 Bacteria 1991
347 Ga0501038_0225197 3300049574 Bacteria 1495
348 Ga0501039_0001263 3300049575 Bacteria 18484
349 Ga0501039_0032802 3300049575 Bacteria 4005
350 Ga0501039_0056290 3300049575 Bacteria 3046
351 Ga0501039_0120817 3300049575 Bacteria 2053
352 Ga0501040_0000183 3300049576 Bacteria 35913
353 Ga0501040_0000184 3300049576 Bacteria 35884
354 Ga0501040_0009994 3300049576 Bacteria 6199
355 Ga0501040_0059335 3300049576 Bacteria 2629
356 Ga0501040_0070993 3300049576 Bacteria 2404
357 Ga0501040_0085552 3300049576 Bacteria 2189
358 Ga0501041_0002265 3300049577 Bacteria 10879
359 Ga0501041_0005954 3300049577 Bacteria 7133
360 Ga0501041_0078976 3300049577 Bacteria 2025
361 Ga0501041_0095643 3300049577 Bacteria 1836
362 Ga0501041_0121770 3300049577 Bacteria 1622
363 Ga0501041_0404147 3300049577 Unclassified 865
364 Ga0501042_0000091 3300049578 Bacteria 35203
365 Ga0501042_0000447 3300049578 Bacteria 21140
366 Ga0501042_0014616 3300049578 Bacteria 5362
367 Ga0501042_0040308 3300049578 Bacteria 3321
368 Ga0501042_0066405 3300049578 Bacteria 2578
369 Ga0501042_0432097 3300049578 Bacteria 954
370 Ga0501043_0026788 3300049579 Bacteria 4523
371 Ga0501043_0366147 3300049579 Bacteria 1093
372 Ga0501046_0001135 3300049580 Bacteria 25969
373 Ga0501046_0001744 3300049580 Bacteria 20747
374 Ga0501046_0025050 3300049580 Bacteria 4887
375 Ga0501046_0084370 3300049580 Bacteria 2450
376 Ga0501046_0087402 3300049580 Bacteria 2402
377 Ga0501046_0320377 3300049580 Bacteria 1130
378 Ga0501046_0344207 3300049580 Bacteria 1083
379 Ga0501048_0000392 3300049582 Bacteria 30421
380 Ga0501048_0065495 3300049582 Bacteria 2569
381 Ga0501068_0037907 3300049584 Bacteria 2886
382 Ga0501068_0164031 3300049584 Bacteria 1401
383 Ga0501068_0261254 3300049584 Bacteria 1104
384 Ga0501068_0330476 3300049584 Bacteria 978
385 Ga0501070_0016158 3300049586 Bacteria 6272
386 Ga0501070_0089007 3300049586 Bacteria 2555
387 Ga0501071_0001639 3300049587 Bacteria 13152
388 Ga0501071_0004637 3300049587 Bacteria 8725
389 Ga0501071_0011224 3300049587 Bacteria 6027
390 Ga0501071_0035949 3300049587 Bacteria 3531
391 Ga0501071_0167865 3300049587 Bacteria 1643
392 Ga0501072_0000530 3300049588 Bacteria 27423
393 Ga0501072_0004587 3300049588 Bacteria 10517
394 Ga0501072_0004959 3300049588 Bacteria 10124
395 Ga0501072_0030029 3300049588 Bacteria 4249
396 Ga0501072_0589223 3300049588 Bacteria 877
397 Ga0501073_0133346 3300049589 Bacteria 1722
398 Ga0501074_0009895 3300049590 Bacteria 6927
399 Ga0501074_0015655 3300049590 Bacteria 5513
400 Ga0501075_0000173 3300049591 Bacteria 33422
401 Ga0501075_0000920 3300049591 Bacteria 18675
402 Ga0501075_0003019 3300049591 Bacteria 11242
403 Ga0501075_0004405 3300049591 Bacteria 9532
404 Ga0501075_0028846 3300049591 Bacteria 4099
405 Ga0501075_0254773 3300049591 Bacteria 1338
406 Ga0501075_0280897 3300049591 Bacteria 1269
407 Ga0501076_0000075 3300049592 Bacteria 50094
408 Ga0501076_0001517 3300049592 Bacteria 15563
409 Ga0501076_0001778 3300049592 Bacteria 14606
410 Ga0501076_0007749 3300049592 Bacteria 7827
411 Ga0501076_0207190 3300049592 Bacteria 1602
412 Ga0501076_0436205 3300049592 Bacteria 1078
413 Ga0501077_0001502 3300049593 Bacteria 14060
414 Ga0501077_0075033 3300049593 Bacteria 2141
415 Ga0501077_0195270 3300049593 Bacteria 1286
416 Ga0501077_0228778 3300049593 Bacteria 1182
417 Ga0501079_0000070 3300049741 Bacteria 46969
418 Ga0501079_0002066 3300049741 Bacteria 14394
419 Ga0501079_0176517 3300049741 Bacteria 1666
420 Ga0501079_0343434 3300049741 Bacteria 1169
421 Ga0501080_0002498 3300049742 Bacteria 16103
422 Ga0501080_0045620 3300049742 Bacteria 4080
423 Ga0501080_0249880 3300049742 Bacteria 1617
424 Ga0501081_0000523 3300049743 Bacteria 21582
425 Ga0501081_0023838 3300049743 Bacteria 4104
426 Ga0501081_0063725 3300049743 Bacteria 2559
427 Ga0501081_0102654 3300049743 Bacteria 2023
428 Ga0501081_0108517 3300049743 Bacteria 1969
429 Ga0501081_0209677 3300049743 Bacteria 1415
430 Ga0501081_0254796 3300049743 Bacteria 1281
431 Ga0501081_0302340 3300049743 Bacteria 1174
432 Ga0501083_0072810 3300049744 Bacteria 2284
433 Ga0501083_0217535 3300049744 Bacteria 1245
434 Ga0501083_0297848 3300049744 Bacteria 1049
435 Ga0501035_0013888 3300049822 Bacteria 7431
436 Ga0501044_0177998 3300049823 Bacteria 2095
437 Ga0501044_0356895 3300049823 Bacteria 1380
438 Ga0501045_0000025 3300049824 Bacteria 61508
439 Ga0501045_0018709 3300049824 Bacteria 4931
440 Ga0501045_0048144 3300049824 Bacteria 3107
441 Ga0501045_0716284 3300049824 Bacteria 738
442 nmdc:mga0yw44_482840_c1 3300050492 Bacteria 840
443 nmdc:mga06z11_228472_c1 3300050494 Bacteria 1090
444 nmdc:mga05p37_16758_c1 3300050507 Bacteria 8834
445 nmdc:mga05p37_6620_c1 3300050507 Bacteria 13660
446 nmdc:mga09592_156396_c1 3300050508 Bacteria 1968
447 nmdc:mga09592_520632_c1 3300050508 Bacteria 1023
448 nmdc:mga09592_58013_c1 3300050508 Bacteria 3274
449 nmdc:mga0qj67_120084_c1 3300050509 Bacteria 2126
450 nmdc:mga0qj67_365_c1 3300050509 Bacteria 31254
451 nmdc:mga06r32_161684_c1 3300050510 Bacteria 2222
452 nmdc:mga06r32_498256_c1 3300050510 Bacteria 1195
453 nmdc:mga06r32_7587_c1 3300050510 Bacteria 9750
454 nmdc:mga08y16_159878_c1 3300050511 Bacteria 2340
455 nmdc:mga08y16_19311_c1 3300050511 Bacteria 7184
456 nmdc:mga0n895_1371_c1 3300050512 Bacteria 18107
457 nmdc:mga0n895_21983_c1 3300050512 Bacteria 5976
458 nmdc:mga0n895_59890_c1 3300050512 Bacteria 3757
459 nmdc:mga0n895_780455_c1 3300050512 Bacteria 947
460 nmdc:mga0rr50_172289_c1 3300050513 Bacteria 1764
461 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
462 nmdc:mga08x19_694_c1 3300050514 Bacteria 21632
463 nmdc:mga0a205_40922_c1 3300050515 Bacteria 4463
464 Ga0500560_003681 3300053107 Bacteria 3139
465 Ga0500560_103652 3300053107 Bacteria 953
466 Ga0501084_0005744 3300054114 Bacteria 10203
467 Ga0501084_0007449 3300054114 Bacteria 9021
468 Ga0501084_0011420 3300054114 Bacteria 7355
469 Ga0501084_0022286 3300054114 Bacteria 5286
470 Ga0501084_0034286 3300054114 Bacteria 4244
471 Ga0501084_0118344 3300054114 Bacteria 2227
472 Ga0501084_0166038 3300054114 Bacteria 1863
473 Ga0501084_0407224 3300054114 Bacteria 1149
474 Ga0501084_0492497 3300054114 Bacteria 1036
475 Ga0590071_056613 3300059421 Bacteria 954
476 Ga0590075_004078 3300059424 Bacteria 3455
477 Ga0590077_023178 3300059426 Bacteria 1327
478 Ga0501082_0000987 3300060353 Bacteria 25129
479 Ga0501082_0003321 3300060353 Bacteria 14051
480 Ga0501082_0114909 3300060353 Bacteria 2331
481 Ga0501082_0308126 3300060353 Bacteria 1379
482 Ga0501082_0365026 3300060353 Bacteria 1259
483 Ga0501082_0910162 3300060353 Bacteria 769
484 Ga0530510_0000766 3300061734 Bacteria 20881
485 Ga0530510_0005832 3300061734 Bacteria 8533
486 Ga0530510_0025316 3300061734 Bacteria 4242
487 Ga0530510_0202515 3300061734 Bacteria 1474
488 Ga0530510_0416974 3300061734 Bacteria 1013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10021599 Ga0207649_100215995 151
2 3300025945 Ga0207679_11837634 Ga0207679_118376341 151
3 3300028379 Ga0268266_12036028 Ga0268266_120360281 151
4 3300035091 Ga0373951_0131238 Ga0373951_0131238_209_679 151
5 3300048907 Ga0496104_1607264 Ga0496104_1607264_38_508 151
6 3300044673 Ga0453683_0028719 Ga0453683_0028719_16_519 161
7 3300050494 nmdc:mga06z11_228472_c1 nmdc:mga06z11_228472_c1_13_522 161
8 3300035725 Ga0373947_0259417 Ga0373947_0259417_482_1129 165
9 3300050510 nmdc:mga06r32_498256_c1 nmdc:mga06r32_498256_c1_23_682 165
10 3300044901 Ga0466960_0107195 Ga0466960_0107195_387_1022 170
11 3300048903 Ga0496100_0155099 Ga0496100_0155099_768_1376 170
12 3300035091 Ga0373951_0142454 Ga0373951_0142454_74_652 171
13 3300046691 Ga0495670_0355788 Ga0495670_0355788_237_770 171
14 3300006871 Ga0075434_100275698 Ga0075434_1002756982 172
15 3300007076 Ga0075435_100115518 Ga0075435_1001155182 172
16 3300010375 Ga0105239_10297907 Ga0105239_102979073 172
17 3300013308 Ga0157375_10304424 Ga0157375_103044242 172
18 3300048905 Ga0496102_0537565 Ga0496102_0537565_220_828 172
19 3300048907 Ga0496104_0323811 Ga0496104_0323811_118_726 172
20 3300048908 Ga0496105_0113251 Ga0496105_0113251_924_1532 172
21 3300048909 Ga0496106_0407209 Ga0496106_0407209_368_976 172
22 3300048912 Ga0496109_0060049 Ga0496109_0060049_1737_2345 172
23 3300048913 Ga0496110_0228858 Ga0496110_0228858_356_964 172
24 3300048914 Ga0496111_0123723 Ga0496111_0123723_322_930 172
25 3300048917 Ga0496114_0108682 Ga0496114_0108682_379_987 172
26 3300050512 nmdc:mga0n895_780455_c1 nmdc:mga0n895_780455_c1_222_830 172
27 3300050513 nmdc:mga0rr50_172289_c1 nmdc:mga0rr50_172289_c1_369_977 172
28 3300005435 Ga0070714_100709610 Ga0070714_1007096101 173
29 3300009177 Ga0105248_10823629 Ga0105248_108236291 174
30 3300042005 Ga0439448_0116218 Ga0439448_0116218_52_666 175
31 3300044658 Ga0466972_0163510 Ga0466972_0163510_349_963 175
32 3300044735 Ga0466968_0028426 Ga0466968_0028426_803_1417 175
33 3300049570 Ga0501033_0138533 Ga0501033_0138533_379_1032 175
34 3300049576 Ga0501040_0085552 Ga0501040_0085552_287_940 175
35 3300049579 Ga0501043_0366147 Ga0501043_0366147_96_749 175
36 3300049580 Ga0501046_0084370 Ga0501046_0084370_207_860 175
37 3300049591 Ga0501075_0028846 Ga0501075_0028846_256_909 175
38 3300061734 Ga0530510_0202515 Ga0530510_0202515_777_1430 175
39 3300049575 Ga0501039_0120817 Ga0501039_0120817_359_1012 177
40 3300049578 Ga0501042_0040308 Ga0501042_0040308_2353_3006 177
41 3300037312 Ga0395899_0075563 Ga0395899_0075563_402_1040 178
42 3300037418 Ga0395900_0043240 Ga0395900_0043240_3957_4595 178
43 3300037466 Ga0395898_0046291 Ga0395898_0046291_2252_2890 178
44 3300037471 Ga0395905_0013766 Ga0395905_0013766_6664_7302 178
45 3300038443 Ga0395901_0093570 Ga0395901_0093570_267_905 178
46 3300049824 Ga0501045_0716284 Ga0501045_0716284_40_684 178
47 3300053107 Ga0500560_103652 Ga0500560_103652_21_581 178
48 3300006844 Ga0075428_100075996 Ga0075428_1000759963 179
49 3300006846 Ga0075430_100000087 Ga0075430_10000008737 179
50 3300006847 Ga0075431_100000559 Ga0075431_1000005592 179
51 3300006880 Ga0075429_100164222 Ga0075429_1001642222 179
52 3300009147 Ga0114129_10000487 Ga0114129_1000048725 179
53 3300044842 Ga0466957_0739313 Ga0466957_0739313_126_680 179
54 3300049744 Ga0501083_0217535 Ga0501083_0217535_677_1231 179
55 3300050507 nmdc:mga05p37_6620_c1 nmdc:mga05p37_6620_c1_1857_2516 179
56 3300050508 nmdc:mga09592_156396_c1 nmdc:mga09592_156396_c1_1076_1735 179
57 3300050509 nmdc:mga0qj67_365_c1 nmdc:mga0qj67_365_c1_14516_15175 179
58 3300050510 nmdc:mga06r32_7587_c1 nmdc:mga06r32_7587_c1_7386_8045 179
59 3300005937 Ga0081455_10139320 Ga0081455_101393202 180
60 3300049591 Ga0501075_0280897 Ga0501075_0280897_400_1041 180
61 3300049743 Ga0501081_0302340 Ga0501081_0302340_415_1056 181
62 3300060353 Ga0501082_0308126 Ga0501082_0308126_647_1288 181
63 3300060353 Ga0501082_0910162 Ga0501082_0910162_20_586 182
64 3300049742 Ga0501080_0249880 Ga0501080_0249880_160_819 184
65 3300048912 Ga0496109_0216742 Ga0496109_0216742_1029_1652 185
66 3300005336 Ga0070680_100029417 Ga0070680_1000294172 186
67 3300005981 Ga0081538_10066443 Ga0081538_100664432 186
68 3300025917 Ga0207660_10073252 Ga0207660_100732522 186
69 3300033547 Ga0316212_1008279 Ga0316212_10082792 186
70 3300046473 Ga0495582_0043181 Ga0495582_0043181_747_1391 186
71 3300047321 Ga0495676_0210601 Ga0495676_0210601_399_1043 186
72 3300049574 Ga0501038_0029804 Ga0501038_0029804_2375_3025 186
73 3300049588 Ga0501072_0004587 Ga0501072_0004587_1200_1850 186
74 3300054114 Ga0501084_0005744 Ga0501084_0005744_44_697 186
75 3300013105 Ga0157369_10135630 Ga0157369_101356303 188
76 3300049577 Ga0501041_0005954 Ga0501041_0005954_1646_2296 189
77 3300049578 Ga0501042_0014616 Ga0501042_0014616_2190_2840 189
78 3300049580 Ga0501046_0087402 Ga0501046_0087402_1020_1670 189
79 3300049582 Ga0501048_0065495 Ga0501048_0065495_165_815 189
80 3300049584 Ga0501068_0330476 Ga0501068_0330476_253_903 189
81 3300049587 Ga0501071_0004637 Ga0501071_0004637_4656_5306 189
82 3300049591 Ga0501075_0003019 Ga0501075_0003019_7217_7867 189
83 3300049592 Ga0501076_0007749 Ga0501076_0007749_5586_6236 189
84 3300054114 Ga0501084_0011420 Ga0501084_0011420_5492_6142 189
85 3300005937 Ga0081455_10007386 Ga0081455_100073866 190
86 3300048911 Ga0496108_0045169 Ga0496108_0045169_3027_3644 190
87 3300049574 Ga0501038_0225197 Ga0501038_0225197_375_998 194
88 3300049576 Ga0501040_0059335 Ga0501040_0059335_258_896 194
89 3300049587 Ga0501071_0167865 Ga0501071_0167865_849_1487 194
90 3300049593 Ga0501077_0228778 Ga0501077_0228778_307_960 194
91 3300054114 Ga0501084_0407224 Ga0501084_0407224_391_1029 194
92 3300005336 Ga0070680_100317122 Ga0070680_1003171221 195
93 3300005340 Ga0070689_100574266 Ga0070689_1005742661 195
94 3300005444 Ga0070694_100041995 Ga0070694_1000419952 195
95 3300005458 Ga0070681_10017674 Ga0070681_100176743 195
96 3300005549 Ga0070704_100049629 Ga0070704_1000496293 195
97 3300005617 Ga0068859_100595305 Ga0068859_1005953052 195
98 3300006931 Ga0097620_100595330 Ga0097620_1005953302 195
99 3300025912 Ga0207707_10048509 Ga0207707_100485093 195
100 3300025936 Ga0207670_10111543 Ga0207670_101115432 195
101 3300035121 Ga0373960_0091600 Ga0373960_0091600_153_812 195
102 3300035691 Ga0373931_0021771 Ga0373931_0021771_1363_2022 195
103 3300042876 Ga0451577_0155826 Ga0451577_0155826_813_1472 195
104 3300048906 Ga0496103_0087212 Ga0496103_0087212_309_968 195
105 3300048909 Ga0496106_0458208 Ga0496106_0458208_98_757 195
106 3300049580 Ga0501046_0320377 Ga0501046_0320377_231_869 195
107 3300054114 Ga0501084_0166038 Ga0501084_0166038_581_1219 195
108 3300005329 Ga0070683_100019247 Ga0070683_1000192473 196
109 3300005337 Ga0070682_100094079 Ga0070682_1000940793 196
110 3300005338 Ga0068868_100157115 Ga0068868_1001571153 196
111 3300005339 Ga0070660_100267427 Ga0070660_1002674272 196
112 3300005344 Ga0070661_100070040 Ga0070661_1000700402 196
113 3300005355 Ga0070671_100478418 Ga0070671_1004784182 196
114 3300005455 Ga0070663_100239665 Ga0070663_1002396651 196
115 3300005456 Ga0070678_100342668 Ga0070678_1003426682 196
116 3300005458 Ga0070681_10108875 Ga0070681_101088753 196
117 3300005535 Ga0070684_100005987 Ga0070684_1000059873 196
118 3300005547 Ga0070693_100006552 Ga0070693_1000065526 196
119 3300005548 Ga0070665_100375899 Ga0070665_1003758992 196
120 3300005549 Ga0070704_100170814 Ga0070704_1001708142 196
121 3300005614 Ga0068856_100015370 Ga0068856_1000153708 196
122 3300005614 Ga0068856_100024457 Ga0068856_1000244572 196
123 3300006871 Ga0075434_100462566 Ga0075434_1004625662 196
124 3300007076 Ga0075435_100371861 Ga0075435_1003718612 196
125 3300009094 Ga0111539_10626494 Ga0111539_106264941 196
126 3300009098 Ga0105245_10017600 Ga0105245_100176008 196
127 3300009174 Ga0105241_10357478 Ga0105241_103574782 196
128 3300013296 Ga0157374_10128227 Ga0157374_101282273 196
129 3300013308 Ga0157375_10112248 Ga0157375_101122481 196
130 3300014745 Ga0157377_10203572 Ga0157377_102035722 196
131 3300025911 Ga0207654_10215775 Ga0207654_102157752 196
132 3300025912 Ga0207707_10038134 Ga0207707_100381345 196
133 3300025917 Ga0207660_10180671 Ga0207660_101806712 196
134 3300025919 Ga0207657_10114062 Ga0207657_101140623 196
135 3300025927 Ga0207687_10030205 Ga0207687_100302053 196
136 3300025934 Ga0207686_10347575 Ga0207686_103475752 196
137 3300025935 Ga0207709_10101535 Ga0207709_101015353 196
138 3300025937 Ga0207669_10245737 Ga0207669_102457372 196
139 3300025944 Ga0207661_10020760 Ga0207661_100207604 196
140 3300026023 Ga0207677_10130728 Ga0207677_101307282 196
141 3300026067 Ga0207678_10043827 Ga0207678_100438273 196
142 3300026078 Ga0207702_10184213 Ga0207702_101842131 196
143 3300026121 Ga0207683_10593266 Ga0207683_105932661 196
144 3300046616 Ga0495668_0229316 Ga0495668_0229316_349_957 196
145 3300048903 Ga0496100_0068427 Ga0496100_0068427_481_1089 196
146 3300048904 Ga0496101_0003174 Ga0496101_0003174_9120_9728 196
147 3300048905 Ga0496102_0022678 Ga0496102_0022678_3068_3676 196
148 3300048907 Ga0496104_0000319 Ga0496104_0000319_7779_8387 196
149 3300048907 Ga0496104_0010984 Ga0496104_0010984_6529_7137 196
150 3300048908 Ga0496105_0000194 Ga0496105_0000194_2069_2677 196
151 3300048908 Ga0496105_0117934 Ga0496105_0117934_1135_1743 196
152 3300048909 Ga0496106_0186288 Ga0496106_0186288_567_1175 196
153 3300048911 Ga0496108_0049198 Ga0496108_0049198_1907_2515 196
154 3300048912 Ga0496109_0123567 Ga0496109_0123567_790_1398 196
155 3300048912 Ga0496109_0323216 Ga0496109_0323216_362_970 196
156 3300048913 Ga0496110_0000757 Ga0496110_0000757_18631_19239 196
157 3300048914 Ga0496111_0014154 Ga0496111_0014154_3818_4426 196
158 3300048915 Ga0496112_0771332 Ga0496112_0771332_80_688 196
159 3300048916 Ga0496113_0357891 Ga0496113_0357891_182_790 196
160 3300048917 Ga0496114_0006143 Ga0496114_0006143_1211_1819 196
161 3300048917 Ga0496114_0013917 Ga0496114_0013917_225_833 196
162 3300048918 Ga0496115_0012640 Ga0496115_0012640_4466_5074 196
163 3300049577 Ga0501041_0095643 Ga0501041_0095643_1161_1769 196
164 3300049578 Ga0501042_0432097 Ga0501042_0432097_150_758 196
165 3300049580 Ga0501046_0344207 Ga0501046_0344207_88_696 196
166 3300049592 Ga0501076_0436205 Ga0501076_0436205_388_996 196
167 3300049741 Ga0501079_0176517 Ga0501079_0176517_784_1392 196
168 3300049743 Ga0501081_0254796 Ga0501081_0254796_175_783 196
169 3300054114 Ga0501084_0118344 Ga0501084_0118344_1410_2018 196
170 3300060353 Ga0501082_0365026 Ga0501082_0365026_222_830 196
171 3300049568 Ga0501031_0105035 Ga0501031_0105035_16_654 197
172 3300049572 Ga0501036_0101793 Ga0501036_0101793_1081_1719 197
173 3300049575 Ga0501039_0056290 Ga0501039_0056290_874_1512 197
174 3300049576 Ga0501040_0009994 Ga0501040_0009994_150_788 197
175 3300049578 Ga0501042_0066405 Ga0501042_0066405_803_1441 197
176 3300049580 Ga0501046_0025050 Ga0501046_0025050_3511_4149 197
177 3300049587 Ga0501071_0035949 Ga0501071_0035949_1540_2178 197
178 3300049588 Ga0501072_0004959 Ga0501072_0004959_208_846 197
179 3300049593 Ga0501077_0075033 Ga0501077_0075033_654_1292 197
180 3300049741 Ga0501079_0343434 Ga0501079_0343434_128_766 197
181 3300049743 Ga0501081_0063725 Ga0501081_0063725_433_1071 197
182 3300049744 Ga0501083_0072810 Ga0501083_0072810_649_1287 197
183 3300049824 Ga0501045_0048144 Ga0501045_0048144_1872_2510 197
184 3300060353 Ga0501082_0114909 Ga0501082_0114909_854_1492 197
185 3300061734 Ga0530510_0025316 Ga0530510_0025316_282_920 197
186 3300037471 Ga0395905_0354892 Ga0395905_0354892_404_1042 198
187 3300038443 Ga0395901_0076481 Ga0395901_0076481_1064_1702 198
188 3300048903 Ga0496100_0071282 Ga0496100_0071282_1353_1997 198
189 3300048912 Ga0496109_0083045 Ga0496109_0083045_1528_2172 198
190 3300048913 Ga0496110_0235360 Ga0496110_0235360_298_942 198
191 3300048914 Ga0496111_0037840 Ga0496111_0037840_1163_1807 198
192 3300048915 Ga0496112_0717044 Ga0496112_0717044_250_894 198
193 iso_pu_bacteria 650716007 650739609 198
194 3300005985 Ga0081539_10026925 Ga0081539_100269252 199
195 3300025922 Ga0207646_10039533 Ga0207646_100395332 199
196 3300050492 nmdc:mga0yw44_482840_c1 nmdc:mga0yw44_482840_c1_158_802 199
197 3300005327 Ga0070658_10018981 Ga0070658_100189812 200
198 3300005339 Ga0070660_100117024 Ga0070660_1001170243 200
199 3300005344 Ga0070661_100082902 Ga0070661_1000829022 200
200 3300005435 Ga0070714_100567557 Ga0070714_1005675572 200
201 3300005458 Ga0070681_10053033 Ga0070681_100530334 200
202 3300005530 Ga0070679_100157118 Ga0070679_1001571182 200
203 3300005563 Ga0068855_100005806 Ga0068855_10000580610 200
204 3300005616 Ga0068852_100090687 Ga0068852_1000906872 200
205 3300009093 Ga0105240_10079185 Ga0105240_100791856 200
206 3300009551 Ga0105238_10247081 Ga0105238_102470811 200
207 3300013100 Ga0157373_10197160 Ga0157373_101971601 200
208 3300013104 Ga0157370_10103027 Ga0157370_101030272 200
209 3300013104 Ga0157370_10162407 Ga0157370_101624073 200
210 3300013105 Ga0157369_10019158 Ga0157369_100191584 200
211 3300013105 Ga0157369_10267251 Ga0157369_102672513 200
212 3300013105 Ga0157369_10341062 Ga0157369_103410623 200
213 3300020069 Ga0197907_11034853 Ga0197907_110348534 200
214 3300020070 Ga0206356_11138687 Ga0206356_111386872 200
215 3300020081 Ga0206354_11012564 Ga0206354_110125642 200
216 3300020082 Ga0206353_11008696 Ga0206353_110086962 200
217 3300025909 Ga0207705_10011990 Ga0207705_100119903 200
218 3300025909 Ga0207705_10174359 Ga0207705_101743592 200
219 3300025912 Ga0207707_10028965 Ga0207707_100289654 200
220 3300025913 Ga0207695_10086065 Ga0207695_100860652 200
221 3300025919 Ga0207657_10082379 Ga0207657_100823793 200
222 3300025920 Ga0207649_10305085 Ga0207649_103050852 200
223 3300025921 Ga0207652_10192387 Ga0207652_101923873 200
224 3300025924 Ga0207694_10281284 Ga0207694_102812841 200
225 3300025949 Ga0207667_10437775 Ga0207667_104377752 200
226 3300026142 Ga0207698_10055570 Ga0207698_100555703 200
227 3300037418 Ga0395900_0096915 Ga0395900_0096915_1734_2351 200
228 3300037418 Ga0395900_0160506 Ga0395900_0160506_1044_1661 200
229 3300037466 Ga0395898_0048559 Ga0395898_0048559_1092_1709 200
230 3300037471 Ga0395905_0199102 Ga0395905_0199102_405_1022 200
231 3300038443 Ga0395901_0076480 Ga0395901_0076480_2701_3318 200
232 3300038443 Ga0395901_0203547 Ga0395901_0203547_659_1276 200
233 3300038443 Ga0395901_0717669 Ga0395901_0717669_53_670 200
234 3300049584 Ga0501068_0037907 Ga0501068_0037907_945_1583 200
235 3300049744 Ga0501083_0297848 Ga0501083_0297848_200_838 200
236 3300049589 Ga0501073_0133346 Ga0501073_0133346_165_806 201
237 3300006042 Ga0075368_10000164 Ga0075368_100001644 202
238 3300006051 Ga0075364_10024318 Ga0075364_100243185 202
239 3300006177 Ga0075362_10113547 Ga0075362_101135472 202
240 3300035725 Ga0373947_0024768 Ga0373947_0024768_1868_2491 202
241 3300053107 Ga0500560_003681 Ga0500560_003681_175_822 202
242 3300005327 Ga0070658_10012764 Ga0070658_100127642 203
243 3300005329 Ga0070683_100150098 Ga0070683_1001500983 203
244 3300005467 Ga0070706_100055220 Ga0070706_1000552205 203
245 3300005468 Ga0070707_100147987 Ga0070707_1001479873 203
246 3300005471 Ga0070698_100032386 Ga0070698_1000323861 203
247 3300005518 Ga0070699_100412852 Ga0070699_1004128522 203
248 3300005536 Ga0070697_100198378 Ga0070697_1001983781 203
249 3300005577 Ga0068857_100536002 Ga0068857_1005360022 203
250 3300007076 Ga0075435_100838218 Ga0075435_1008382182 203
251 3300025922 Ga0207646_10126940 Ga0207646_101269401 203
252 3300031852 Ga0307410_10620234 Ga0307410_106202342 203
253 3300044693 Ga0466961_0291749 Ga0466961_0291749_275_922 203
254 3300045976 Ga0466967_0900669 Ga0466967_0900669_155_796 203
255 3300049572 Ga0501036_0116248 Ga0501036_0116248_807_1436 203
256 3300049588 Ga0501072_0589223 Ga0501072_0589223_123_767 203
257 3300061734 Ga0530510_0416974 Ga0530510_0416974_121_753 203
258 iso_pu_bacteria 2873314349 2873321801 203
259 iso_pu_bacteria 2891395885 2891398155 203
260 iso_pu_bacteria 2891554331 2891555293 203
261 iso_pu_bacteria 2891562705 2891566621 203
262 3300005468 Ga0070707_100483458 Ga0070707_1004834581 204
263 3300005536 Ga0070697_100341999 Ga0070697_1003419992 204
264 3300005536 Ga0070697_100502013 Ga0070697_1005020132 204
265 3300005937 Ga0081455_10014947 Ga0081455_100149477 204
266 3300006871 Ga0075434_100001481 Ga0075434_1000014819 204
267 3300006871 Ga0075434_100035254 Ga0075434_1000352543 204
268 3300006914 Ga0075436_100001323 Ga0075436_1000013235 204
269 3300006914 Ga0075436_100021215 Ga0075436_1000212154 204
270 3300007076 Ga0075435_100000294 Ga0075435_10000029419 204
271 3300007076 Ga0075435_100087904 Ga0075435_1000879044 204
272 3300009098 Ga0105245_10696873 Ga0105245_106968732 204
273 3300009176 Ga0105242_10099828 Ga0105242_100998282 204
274 3300013297 Ga0157378_10393543 Ga0157378_103935432 204
275 3300025927 Ga0207687_10008306 Ga0207687_100083063 204
276 3300025934 Ga0207686_10062622 Ga0207686_100626223 204
277 3300037418 Ga0395900_0037016 Ga0395900_0037016_147_779 204
278 3300037466 Ga0395898_0012735 Ga0395898_0012735_6059_6691 204
279 3300046535 Ga0495586_0090177 Ga0495586_0090177_774_1412 204
280 3300046642 Ga0495634_0002689 Ga0495634_0002689_8217_8855 204
281 3300046689 Ga0495613_0001457 Ga0495613_0001457_16808_17446 204
282 3300047319 Ga0495674_0218578 Ga0495674_0218578_141_779 204
283 3300048089 Ga0495614_0206880 Ga0495614_0206880_172_810 204
284 3300049572 Ga0501036_0481353 Ga0501036_0481353_275_928 204
285 3300049577 Ga0501041_0404147 Ga0501041_0404147_189_821 204
286 3300049586 Ga0501070_0016158 Ga0501070_0016158_2668_3300 204
287 3300049586 Ga0501070_0089007 Ga0501070_0089007_1677_2309 204
288 3300049591 Ga0501075_0004405 Ga0501075_0004405_3559_4191 204
289 3300049592 Ga0501076_0001778 Ga0501076_0001778_7405_8037 204
290 3300049743 Ga0501081_0102654 Ga0501081_0102654_997_1629 204
291 3300050512 nmdc:mga0n895_1371_c1 nmdc:mga0n895_1371_c1_8194_8826 204
292 3300050512 nmdc:mga0n895_59890_c1 nmdc:mga0n895_59890_c1_394_1095 204
293 3300050513 nmdc:mga0rr50_18_c1 nmdc:mga0rr50_18_c1_130762_131394 204
294 3300050514 nmdc:mga08x19_694_c1 nmdc:mga08x19_694_c1_19322_19954 204
295 3300054114 Ga0501084_0034286 Ga0501084_0034286_889_1521 204
296 3300005356 Ga0070674_100856233 Ga0070674_1008562331 205
297 3300005471 Ga0070698_100264761 Ga0070698_1002647612 205
298 3300005985 Ga0081539_10003951 Ga0081539_100039519 205
299 3300009147 Ga0114129_10005351 Ga0114129_100053519 205
300 3300009553 Ga0105249_10586897 Ga0105249_105868972 205
301 3300013308 Ga0157375_10478123 Ga0157375_104781232 205
302 3300025927 Ga0207687_10349446 Ga0207687_103494462 205
303 3300025960 Ga0207651_10722884 Ga0207651_107228842 205
304 3300037418 Ga0395900_0239973 Ga0395900_0239973_522_1157 205
305 3300045051 Ga0451576_0520113 Ga0451576_0520113_77_718 205
306 3300049584 Ga0501068_0164031 Ga0501068_0164031_390_1022 205
307 3300049591 Ga0501075_0254773 Ga0501075_0254773_163_801 205
308 3300049743 Ga0501081_0108517 Ga0501081_0108517_1297_1950 205
309 3300005458 Ga0070681_10074013 Ga0070681_100740133 206
310 3300005563 Ga0068855_101341389 Ga0068855_1013413891 206
311 3300025900 Ga0207710_10210680 Ga0207710_102106802 206
312 3300005981 Ga0081538_10017483 Ga0081538_100174834 207
313 3300005981 Ga0081538_10020664 Ga0081538_100206643 207
314 3300031548 Ga0307408_100085839 Ga0307408_1000858392 207
315 3300031731 Ga0307405_10231202 Ga0307405_102312022 207
316 3300031852 Ga0307410_10250600 Ga0307410_102506002 207
317 3300031901 Ga0307406_10011213 Ga0307406_100112132 207
318 3300031903 Ga0307407_10025393 Ga0307407_100253933 207
319 3300031911 Ga0307412_10105211 Ga0307412_101052112 207
320 3300031995 Ga0307409_100001449 Ga0307409_10000144911 207
321 3300032002 Ga0307416_100032774 Ga0307416_1000327742 207
322 3300032005 Ga0307411_10288246 Ga0307411_102882462 207
323 3300032126 Ga0307415_100002353 Ga0307415_10000235311 207
324 3300037471 Ga0395905_0457581 Ga0395905_0457581_165_803 207
325 3300037471 Ga0395905_0849225 Ga0395905_0849225_11_649 207
326 3300049569 Ga0501032_0030111 Ga0501032_0030111_2446_3093 207
327 3300049572 Ga0501036_0005506 Ga0501036_0005506_2942_3589 207
328 3300049572 Ga0501036_0273182 Ga0501036_0273182_31_681 207
329 3300049573 Ga0501037_0004052 Ga0501037_0004052_2438_3085 207
330 3300049574 Ga0501038_0010889 Ga0501038_0010889_4989_5636 207
331 3300049574 Ga0501038_0138743 Ga0501038_0138743_1290_1931 207
332 3300049575 Ga0501039_0001263 Ga0501039_0001263_17110_17757 207
333 3300049576 Ga0501040_0000184 Ga0501040_0000184_10158_10805 207
334 3300049576 Ga0501040_0070993 Ga0501040_0070993_1675_2316 207
335 3300049577 Ga0501041_0078976 Ga0501041_0078976_98_745 207
336 3300049577 Ga0501041_0121770 Ga0501041_0121770_378_1019 207
337 3300049578 Ga0501042_0000091 Ga0501042_0000091_1521_2168 207
338 3300049579 Ga0501043_0026788 Ga0501043_0026788_2600_3247 207
339 3300049580 Ga0501046_0001135 Ga0501046_0001135_20590_21237 207
340 3300049582 Ga0501048_0000392 Ga0501048_0000392_17106_17753 207
341 3300049584 Ga0501068_0261254 Ga0501068_0261254_135_782 207
342 3300049587 Ga0501071_0001639 Ga0501071_0001639_4856_5503 207
343 3300049588 Ga0501072_0000530 Ga0501072_0000530_6874_7521 207
344 3300049590 Ga0501074_0015655 Ga0501074_0015655_3464_4111 207
345 3300049591 Ga0501075_0000173 Ga0501075_0000173_25904_26551 207
346 3300049592 Ga0501076_0000075 Ga0501076_0000075_48966_49613 207
347 3300049592 Ga0501076_0207190 Ga0501076_0207190_440_1090 207
348 3300049593 Ga0501077_0001502 Ga0501077_0001502_6810_7457 207
349 3300049593 Ga0501077_0195270 Ga0501077_0195270_306_947 207
350 3300049741 Ga0501079_0002066 Ga0501079_0002066_2942_3589 207
351 3300049742 Ga0501080_0002498 Ga0501080_0002498_4934_5581 207
352 3300049743 Ga0501081_0023838 Ga0501081_0023838_92_739 207
353 3300049743 Ga0501081_0209677 Ga0501081_0209677_712_1353 207
354 3300049822 Ga0501035_0013888 Ga0501035_0013888_6531_7178 207
355 3300049823 Ga0501044_0177998 Ga0501044_0177998_233_880 207
356 3300049824 Ga0501045_0000025 Ga0501045_0000025_25598_26245 207
357 3300054114 Ga0501084_0007449 Ga0501084_0007449_6887_7534 207
358 3300054114 Ga0501084_0492497 Ga0501084_0492497_280_921 207
359 3300060353 Ga0501082_0003321 Ga0501082_0003321_7782_8429 207
360 3300061734 Ga0530510_0005832 Ga0530510_0005832_2814_3461 207
361 3300003203 JGI25406J46586_10009793 JGI25406J46586_100097933 208
362 3300003373 JGI25407J50210_10038187 JGI25407J50210_100381872 208
363 3300003373 JGI25407J50210_10040072 JGI25407J50210_100400722 208
364 3300005347 Ga0070668_100101202 Ga0070668_1001012022 208
365 3300005353 Ga0070669_100519988 Ga0070669_1005199881 208
366 3300005719 Ga0068861_100007345 Ga0068861_1000073456 208
367 3300005937 Ga0081455_10071781 Ga0081455_100717813 208
368 3300005981 Ga0081538_10004517 Ga0081538_100045179 208
369 3300005981 Ga0081538_10029392 Ga0081538_100293924 208
370 3300005981 Ga0081538_10032675 Ga0081538_100326755 208
371 3300005981 Ga0081538_10129813 Ga0081538_101298132 208
372 3300005983 Ga0081540_1006357 Ga0081540_10063573 208
373 3300005985 Ga0081539_10013807 Ga0081539_100138073 208
374 3300005985 Ga0081539_10045444 Ga0081539_100454442 208
375 3300006058 Ga0075432_10002067 Ga0075432_100020674 208
376 3300006194 Ga0075427_10002315 Ga0075427_100023153 208
377 3300006844 Ga0075428_100094254 Ga0075428_1000942542 208
378 3300006846 Ga0075430_100000806 Ga0075430_1000008064 208
379 3300006847 Ga0075431_100008857 Ga0075431_1000088572 208
380 3300006852 Ga0075433_10056284 Ga0075433_100562842 208
381 3300006871 Ga0075434_100096789 Ga0075434_1000967892 208
382 3300006880 Ga0075429_100026617 Ga0075429_1000266173 208
383 3300006880 Ga0075429_100640045 Ga0075429_1006400452 208
384 3300009094 Ga0111539_10014578 Ga0111539_100145784 208
385 3300009094 Ga0111539_10835894 Ga0111539_108358942 208
386 3300009147 Ga0114129_10333793 Ga0114129_103337932 208
387 3300013306 Ga0163162_10088821 Ga0163162_100888211 208
388 3300013307 Ga0157372_10644105 Ga0157372_106441052 208
389 3300025923 Ga0207681_10710725 Ga0207681_107107251 208
390 3300025933 Ga0207706_10002988 Ga0207706_1000298813 208
391 3300025961 Ga0207712_10207275 Ga0207712_102072752 208
392 3300025972 Ga0207668_10074047 Ga0207668_100740472 208
393 3300026118 Ga0207675_100019826 Ga0207675_1000198263 208
394 3300027907 Ga0207428_10000441 Ga0207428_1000044127 208
395 3300028380 Ga0268265_11326202 Ga0268265_113262021 208
396 3300031548 Ga0307408_100126686 Ga0307408_1001266862 208
397 3300031731 Ga0307405_10054809 Ga0307405_100548093 208
398 3300031731 Ga0307405_10070481 Ga0307405_100704812 208
399 3300031731 Ga0307405_10375411 Ga0307405_103754111 208
400 3300031824 Ga0307413_10010793 Ga0307413_100107934 208
401 3300031824 Ga0307413_10088130 Ga0307413_100881302 208
402 3300031824 Ga0307413_10134173 Ga0307413_101341732 208
403 3300031852 Ga0307410_10007941 Ga0307410_100079416 208
404 3300031852 Ga0307410_10208140 Ga0307410_102081401 208
405 3300031852 Ga0307410_10527371 Ga0307410_105273712 208
406 3300031901 Ga0307406_10015488 Ga0307406_100154885 208
407 3300031901 Ga0307406_10093807 Ga0307406_100938072 208
408 3300031903 Ga0307407_10001374 Ga0307407_100013749 208
409 3300031903 Ga0307407_10010578 Ga0307407_100105782 208
410 3300031911 Ga0307412_10415591 Ga0307412_104155912 208
411 3300031911 Ga0307412_10525466 Ga0307412_105254661 208
412 3300031995 Ga0307409_100001663 Ga0307409_1000016633 208
413 3300031995 Ga0307409_100039849 Ga0307409_1000398494 208
414 3300031995 Ga0307409_100137813 Ga0307409_1001378132 208
415 3300031995 Ga0307409_100146392 Ga0307409_1001463922 208
416 3300031995 Ga0307409_100237240 Ga0307409_1002372402 208
417 3300031995 Ga0307409_100810399 Ga0307409_1008103992 208
418 3300032002 Ga0307416_100017664 Ga0307416_1000176644 208
419 3300032002 Ga0307416_100029758 Ga0307416_1000297582 208
420 3300032002 Ga0307416_100032355 Ga0307416_1000323553 208
421 3300032002 Ga0307416_100902885 Ga0307416_1009028852 208
422 3300032004 Ga0307414_10013805 Ga0307414_100138053 208
423 3300032004 Ga0307414_10222506 Ga0307414_102225062 208
424 3300032004 Ga0307414_10655857 Ga0307414_106558572 208
425 3300032005 Ga0307411_10126913 Ga0307411_101269133 208
426 3300032126 Ga0307415_100003480 Ga0307415_1000034806 208
427 3300032126 Ga0307415_100007317 Ga0307415_1000073175 208
428 3300032126 Ga0307415_100064007 Ga0307415_1000640073 208
429 3300032126 Ga0307415_100360599 Ga0307415_1003605992 208
430 3300037312 Ga0395899_0101137 Ga0395899_0101137_590_1240 208
431 3300037418 Ga0395900_0073137 Ga0395900_0073137_624_1274 208
432 3300042003 Ga0439443_007444 Ga0439443_007444_776_1426 208
433 3300042003 Ga0439443_014780 Ga0439443_014780_35_685 208
434 3300042005 Ga0439448_0000623 Ga0439448_0000623_6170_6820 208
435 3300042005 Ga0439448_0042719 Ga0439448_0042719_159_809 208
436 3300042005 Ga0439448_0085518 Ga0439448_0085518_128_778 208
437 3300042008 Ga0439450_000479 Ga0439450_000479_3783_4433 208
438 3300042008 Ga0439450_007890 Ga0439450_007890_901_1551 208
439 3300042009 Ga0439451_027488 Ga0439451_027488_123_773 208
440 3300042011 Ga0439454_001221 Ga0439454_001221_620_1270 208
441 3300042012 Ga0439455_0016062 Ga0439455_0016062_575_1225 208
442 3300042016 Ga0439463_001192 Ga0439463_001192_4782_5432 208
443 3300042016 Ga0439463_058584 Ga0439463_058584_107_757 208
444 3300042126 Ga0450888_009622 Ga0450888_009622_106_759 208
445 3300042136 Ga0450900_014470 Ga0450900_014470_280_930 208
446 3300042142 Ga0450905_004131 Ga0450905_004131_25_675 208
447 3300042157 Ga0439458_0014100 Ga0439458_0014100_715_1365 208
448 3300042437 Ga0439444_0008392 Ga0439444_0008392_497_1147 208
449 3300042437 Ga0439444_0039964 Ga0439444_0039964_75_725 208
450 3300042439 Ga0439464_0000658 Ga0439464_0000658_3873_4523 208
451 3300042439 Ga0439464_0109081 Ga0439464_0109081_155_805 208
452 3300042461 Ga0439460_0003813 Ga0439460_0003813_2279_2929 208
453 3300042530 Ga0450916_000486 Ga0450916_000486_1139_1789 208
454 3300042993 Ga0439440_0000012 Ga0439440_0000012_35_685 208
455 3300042993 Ga0439440_0007023 Ga0439440_0007023_242_892 208
456 3300046518 Ga0495631_0066997 Ga0495631_0066997_321_974 208
457 3300046525 Ga0495663_0069806 Ga0495663_0069806_389_1039 208
458 3300046615 Ga0495656_0002723 Ga0495656_0002723_1198_1851 208
459 3300046691 Ga0495670_0170305 Ga0495670_0170305_458_1111 208
460 3300047445 Ga0495677_0089539 Ga0495677_0089539_134_787 208
461 3300049568 Ga0501031_0005948 Ga0501031_0005948_4586_5242 208
462 3300049572 Ga0501036_0061848 Ga0501036_0061848_2254_2910 208
463 3300049574 Ga0501038_0034963 Ga0501038_0034963_1259_1915 208
464 3300049575 Ga0501039_0032802 Ga0501039_0032802_1932_2588 208
465 3300049576 Ga0501040_0000183 Ga0501040_0000183_3007_3663 208
466 3300049577 Ga0501041_0002265 Ga0501041_0002265_5514_6170 208
467 3300049578 Ga0501042_0000447 Ga0501042_0000447_17146_17802 208
468 3300049580 Ga0501046_0001744 Ga0501046_0001744_16843_17499 208
469 3300049587 Ga0501071_0011224 Ga0501071_0011224_2740_3396 208
470 3300049588 Ga0501072_0030029 Ga0501072_0030029_2186_2842 208
471 3300049590 Ga0501074_0009895 Ga0501074_0009895_3075_3731 208
472 3300049591 Ga0501075_0000920 Ga0501075_0000920_13824_14480 208
473 3300049592 Ga0501076_0001517 Ga0501076_0001517_878_1534 208
474 3300049741 Ga0501079_0000070 Ga0501079_0000070_46185_46841 208
475 3300049742 Ga0501080_0045620 Ga0501080_0045620_1283_1939 208
476 3300049743 Ga0501081_0000523 Ga0501081_0000523_15974_16630 208
477 3300049823 Ga0501044_0356895 Ga0501044_0356895_395_1051 208
478 3300049824 Ga0501045_0018709 Ga0501045_0018709_2998_3654 208
479 3300050507 nmdc:mga05p37_16758_c1 nmdc:mga05p37_16758_c1_6616_7266 208
480 3300050508 nmdc:mga09592_520632_c1 nmdc:mga09592_520632_c1_50_703 208
481 3300050508 nmdc:mga09592_58013_c1 nmdc:mga09592_58013_c1_1441_2091 208
482 3300050509 nmdc:mga0qj67_120084_c1 nmdc:mga0qj67_120084_c1_36_686 208
483 3300050510 nmdc:mga06r32_161684_c1 nmdc:mga06r32_161684_c1_36_686 208
484 3300050511 nmdc:mga08y16_159878_c1 nmdc:mga08y16_159878_c1_330_980 208
485 3300050511 nmdc:mga08y16_19311_c1 nmdc:mga08y16_19311_c1_2538_3188 208
486 3300050512 nmdc:mga0n895_21983_c1 nmdc:mga0n895_21983_c1_3657_4307 208
487 3300050515 nmdc:mga0a205_40922_c1 nmdc:mga0a205_40922_c1_3166_3816 208
488 3300054114 Ga0501084_0022286 Ga0501084_0022286_1269_1925 208
489 3300059421 Ga0590071_056613 Ga0590071_056613_188_838 208
490 3300059424 Ga0590075_004078 Ga0590075_004078_737_1390 208
491 3300059426 Ga0590077_023178 Ga0590077_023178_443_1096 208
492 3300060353 Ga0501082_0000987 Ga0501082_0000987_3219_3875 208
493 3300061734 Ga0530510_0000766 Ga0530510_0000766_9609_10265 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

15

213

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.5069 5 185
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4572 5 185
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4218 1 189
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.3925 1 189
7vq7-assembly1.cif.gz_B the al-bound atalmt1 structure at ph 5 (almt1al/ph5) 0.3505 4 154
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5368 7 200 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5261 5 205 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5086 5 205 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5072 7 200 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4874 37 197 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A8B3VBC3-F1-model_v4 Lysine exporter protein LysE/YggA 0.9099 1 200 GO:0005886
GO:0015171
AF-A0A1Z9E1P1-F1-model_v4 Threonine transporter RhtB 0.9077 1 172 GO:0005886
GO:0015171
AF-A0A4R5TMY3-F1-model_v4 LysE family translocator 0.9071 1 170 GO:0005886
GO:0015171
AF-A0A317DY16-F1-model_v4 LysE family translocator 0.9017 2 171 GO:0005886
GO:0015171
AF-A0A0J7I6I4-F1-model_v4 Lysine transporter LysE 0.897 1 199 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
72.51 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map