F454403

General Info

Members Datasets Scaffolds Average Seq Length
493 242 986 111

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100395780|Ga0070665_1003957802
Length 134
Sequence MEADSNLPARKINLRNVIKLNEVHMAGQNTLTFTDGGFDQEVLQSAVPVLVDFWAEWCGPCRQMTPTIDAVASEYEGKAKIGKLNVDENGQVAMRYNIRGIPTLLLFKGGQVVEQRVGAVGKSEVTKMLDAHVA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.49
Metatranscriptomes 7.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100395780 3300005548 Bacteria 1389
2 Ga0058859_11648225 3300004798 Bacteria 674
3 Ga0058863_11904447 3300004799 Bacteria 555
4 Ga0058863_11907825 3300004799 Bacteria 1813
5 Ga0058861_11434837 3300004800 Bacteria 637
6 Ga0058862_12739220 3300004803 Bacteria 533
7 Ga0070658_10238667 3300005327 Bacteria 1540
8 Ga0070658_10453712 3300005327 Bacteria 1105
9 Ga0070658_10872571 3300005327 Bacteria 782
10 Ga0070676_10344613 3300005328 Bacteria 1023
11 Ga0070683_100000026 3300005329 Bacteria 172308
12 Ga0070683_100006243 3300005329 Bacteria 9996
13 Ga0070683_100172501 3300005329 Bacteria 2053
14 Ga0070670_100414529 3300005331 Bacteria 1190
15 Ga0068869_100668167 3300005334 Bacteria 883
16 Ga0070666_10268208 3300005335 Bacteria 1211
17 Ga0070680_100100320 3300005336 Bacteria 2403
18 Ga0070682_100743092 3300005337 Bacteria 791
19 Ga0068868_100375667 3300005338 Bacteria 1222
20 Ga0068868_100725328 3300005338 Bacteria 891
21 Ga0068868_101220042 3300005338 Bacteria 696
22 Ga0070689_100308635 3300005340 Bacteria 1319
23 Ga0070661_101749325 3300005344 Bacteria 527
24 Ga0070675_100596050 3300005354 Bacteria 1002
25 Ga0070671_100759377 3300005355 Bacteria 843
26 Ga0070671_101225391 3300005355 Bacteria 661
27 Ga0070673_101484330 3300005364 Bacteria 639
28 Ga0070659_100905166 3300005366 Bacteria 771
29 Ga0070667_100536194 3300005367 Bacteria 1075
30 Ga0070667_100786143 3300005367 Bacteria 883
31 Ga0070667_101432733 3300005367 Bacteria 648
32 Ga0070709_10035725 3300005434 Bacteria 3022
33 Ga0070709_10313048 3300005434 Bacteria 1150
34 Ga0070709_10576038 3300005434 Bacteria 864
35 Ga0070709_10988913 3300005434 Bacteria 669
36 Ga0070714_101071558 3300005435 Bacteria 785
37 Ga0070714_101444366 3300005435 Bacteria 672
38 Ga0070714_101777104 3300005435 Bacteria 602
39 Ga0070713_100059764 3300005436 Bacteria 3185
40 Ga0070713_100688958 3300005436 Bacteria 975
41 Ga0070713_100783033 3300005436 Bacteria 914
42 Ga0070713_101086376 3300005436 Bacteria 773
43 Ga0070710_10821929 3300005437 Bacteria 665
44 Ga0070711_100091033 3300005439 Bacteria 2198
45 Ga0070711_100243524 3300005439 Bacteria 1407
46 Ga0070711_100404095 3300005439 Bacteria 1109
47 Ga0070705_100843564 3300005440 Bacteria 732
48 Ga0070694_100139894 3300005444 Bacteria 1757
49 Ga0070708_100693121 3300005445 Bacteria 959
50 Ga0070678_100332962 3300005456 Bacteria 1300
51 Ga0070678_100749508 3300005456 Bacteria 883
52 Ga0070681_10014268 3300005458 Bacteria 7906
53 Ga0070681_10120558 3300005458 Bacteria 2558
54 Ga0070681_10466880 3300005458 Bacteria 1175
55 Ga0070681_11196457 3300005458 Bacteria 682
56 Ga0070706_100464286 3300005467 Bacteria 1178
57 Ga0070698_100481743 3300005471 Bacteria 1178
58 Ga0070698_101097383 3300005471 Bacteria 744
59 Ga0070699_100036136 3300005518 Bacteria 4273
60 Ga0070679_100197245 3300005530 Bacteria 1980
61 Ga0070684_100000012 3300005535 Bacteria 167850
62 Ga0070684_100043235 3300005535 Bacteria 3890
63 Ga0070684_100463308 3300005535 Bacteria 1172
64 Ga0070684_101454051 3300005535 Bacteria 646
65 Ga0070684_102177107 3300005535 Bacteria 523
66 Ga0070684_102221402 3300005535 Bacteria 518
67 Ga0070697_100204070 3300005536 Bacteria 1681
68 Ga0070686_100547587 3300005544 Bacteria 905
69 Ga0070695_100580976 3300005545 Bacteria 877
70 Ga0070696_100000050 3300005546 Bacteria 54623
71 Ga0070693_100251198 3300005547 Bacteria 1172
72 Ga0070665_100542801 3300005548 Bacteria 1175
73 Ga0070665_100901481 3300005548 Bacteria 897
74 Ga0070665_100968813 3300005548 Bacteria 863
75 Ga0070665_102137935 3300005548 Bacteria 564
76 Ga0070704_100804462 3300005549 Bacteria 840
77 Ga0068855_100125793 3300005563 Bacteria 2931
78 Ga0068855_100148486 3300005563 Bacteria 2667
79 Ga0068855_101284328 3300005563 Bacteria 758
80 Ga0068857_100857773 3300005577 Bacteria 869
81 Ga0068852_100215806 3300005616 Bacteria 1822
82 Ga0068859_100248824 3300005617 Bacteria 1868
83 Ga0068859_100513907 3300005617 Bacteria 1293
84 Ga0068859_100979973 3300005617 Bacteria 928
85 Ga0068859_101051316 3300005617 Bacteria 895
86 Ga0068864_100539109 3300005618 Bacteria 1127
87 Ga0068864_100915169 3300005618 Bacteria 866
88 Ga0068863_100166348 3300005841 Bacteria 2115
89 Ga0068858_100350441 3300005842 Bacteria 1414
90 Ga0068858_101590567 3300005842 Bacteria 645
91 Ga0068858_101932567 3300005842 Bacteria 583
92 Ga0068860_100704412 3300005843 Bacteria 1020
93 Ga0068860_100723892 3300005843 Bacteria 1006
94 Ga0068860_100977313 3300005843 Bacteria 864
95 Ga0068860_101878252 3300005843 Bacteria 621
96 Ga0068860_102289299 3300005843 Bacteria 561
97 Ga0070717_10020616 3300006028 Bacteria 5188
98 Ga0070717_10091275 3300006028 Bacteria 2571
99 Ga0070717_11251332 3300006028 Bacteria 675
100 Ga0070717_11313243 3300006028 Bacteria 658
101 Ga0070717_11900878 3300006028 Bacteria 537
102 Ga0070716_100087604 3300006173 Bacteria 1876
103 Ga0070716_101257771 3300006173 Bacteria 596
104 Ga0097621_100157910 3300006237 Bacteria 1948
105 Ga0097621_100243330 3300006237 Bacteria 1573
106 Ga0097621_100634134 3300006237 Bacteria 979
107 Ga0097621_100772635 3300006237 Bacteria 889
108 Ga0097621_100893283 3300006237 Bacteria 827
109 Ga0097621_101076607 3300006237 Bacteria 754
110 Ga0068871_100318805 3300006358 Bacteria 1368
111 Ga0068871_101357139 3300006358 Bacteria 669
112 Ga0068865_100283060 3300006881 Bacteria 1321
113 Ga0075436_100005615 3300006914 Bacteria 8608
114 Ga0075436_100735684 3300006914 Bacteria 732
115 Ga0097620_100248817 3300006931 Bacteria 1868
116 Ga0097620_100513810 3300006931 Bacteria 1293
117 Ga0097620_100980128 3300006931 Bacteria 928
118 Ga0097620_101051087 3300006931 Bacteria 895
119 Ga0075435_100354319 3300007076 Bacteria 1258
120 Ga0075435_100554918 3300007076 Bacteria 995
121 Ga0105240_10002535 3300009093 Bacteria 29306
122 Ga0105240_10045158 3300009093 Bacteria 5592
123 Ga0105240_10124592 3300009093 Bacteria 3098
124 Ga0105240_10161914 3300009093 Bacteria 2657
125 Ga0105240_10667306 3300009093 Bacteria 1138
126 Ga0105240_10706415 3300009093 Bacteria 1100
127 Ga0105240_11393964 3300009093 Archaea 737
128 Ga0105245_10699454 3300009098 Bacteria 1047
129 Ga0105245_12136366 3300009098 Bacteria 614
130 Ga0114129_10623660 3300009147 Bacteria 1394
131 Ga0105241_11381953 3300009174 Bacteria 673
132 Ga0105242_10116738 3300009176 Bacteria 2284
133 Ga0105242_11017882 3300009176 Bacteria 837
134 Ga0105242_11153200 3300009176 Bacteria 792
135 Ga0105248_10033117 3300009177 Bacteria 5772
136 Ga0105248_10301214 3300009177 Bacteria 1805
137 Ga0105248_10997503 3300009177 Bacteria 946
138 Ga0105248_10999387 3300009177 Bacteria 945
139 Ga0105248_11157245 3300009177 Bacteria 874
140 Ga0105248_11388489 3300009177 Bacteria 795
141 Ga0105248_11466409 3300009177 Bacteria 772
142 Ga0105248_12802893 3300009177 Bacteria 556
143 Ga0105237_10034493 3300009545 Bacteria 5123
144 Ga0105237_10087528 3300009545 Bacteria 3104
145 Ga0105237_10478133 3300009545 Bacteria 1252
146 Ga0105237_11505859 3300009545 Bacteria 679
147 Ga0105237_12271106 3300009545 Bacteria 552
148 Ga0105238_10047858 3300009551 Bacteria 4310
149 Ga0105238_10121513 3300009551 Bacteria 2591
150 Ga0105238_10203897 3300009551 Bacteria 1954
151 Ga0105238_10295417 3300009551 Bacteria 1603
152 Ga0105238_10865751 3300009551 Bacteria 921
153 Ga0105238_11549626 3300009551 Bacteria 692
154 Ga0105238_12069705 3300009551 Bacteria 603
155 Ga0105249_10337339 3300009553 Bacteria 1523
156 Ga0105239_10032294 3300010375 Bacteria 5754
157 Ga0105239_10142018 3300010375 Bacteria 2676
158 Ga0105239_11057604 3300010375 Bacteria 934
159 Ga0105239_11446361 3300010375 Bacteria 794
160 Ga0105246_11437201 3300011119 Bacteria 645
161 Ga0105246_11949085 3300011119 Bacteria 565
162 Ga0157370_10328150 3300013104 Bacteria 1411
163 Ga0157370_11294550 3300013104 Bacteria 657
164 Ga0157369_10112229 3300013105 Bacteria 2896
165 Ga0157374_10750327 3300013296 Bacteria 991
166 Ga0157374_11472305 3300013296 Bacteria 704
167 Ga0157378_10830175 3300013297 Bacteria 951
168 Ga0157378_10835119 3300013297 Bacteria 949
169 Ga0157378_11246934 3300013297 Bacteria 784
170 Ga0157378_12832017 3300013297 Bacteria 537
171 Ga0163162_10602515 3300013306 Bacteria 1225
172 Ga0163162_11123187 3300013306 Bacteria 891
173 Ga0163162_11987839 3300013306 Bacteria 666
174 Ga0163162_12144582 3300013306 Bacteria 641
175 Ga0163162_12761948 3300013306 Bacteria 565
176 Ga0157372_10176424 3300013307 Bacteria 2473
177 Ga0157372_12687922 3300013307 Bacteria 571
178 Ga0157372_13001739 3300013307 Bacteria 539
179 Ga0157375_10125431 3300013308 Bacteria 2682
180 Ga0157375_10348226 3300013308 Bacteria 1647
181 Ga0157375_10789721 3300013308 Bacteria 1099
182 Ga0157375_11022141 3300013308 Bacteria 965
183 Ga0163163_10006840 3300014325 Bacteria 10009
184 Ga0163163_10209519 3300014325 Bacteria 1998
185 Ga0163163_10343382 3300014325 Bacteria 1548
186 Ga0163163_10720887 3300014325 Bacteria 1061
187 Ga0157379_10687985 3300014968 Bacteria 959
188 Ga0157379_11122875 3300014968 Bacteria 754
189 Ga0157379_11243017 3300014968 Bacteria 717
190 Ga0157376_10003232 3300014969 Bacteria 11211
191 Ga0157376_10159297 3300014969 Bacteria 2044
192 Ga0157376_10234406 3300014969 Bacteria 1706
193 Ga0157376_10809398 3300014969 Bacteria 950
194 Ga0157376_11092981 3300014969 Bacteria 823
195 Ga0157376_11119132 3300014969 Bacteria 814
196 Ga0157376_12817822 3300014969 Bacteria 526
197 Ga0163161_11366019 3300017792 Bacteria 618
198 Ga0163161_11958570 3300017792 Bacteria 521
199 Ga0197907_10804321 3300020069 Bacteria 584
200 Ga0197907_11314123 3300020069 Bacteria 505
201 Ga0206356_11046369 3300020070 Bacteria 557
202 Ga0206349_1368680 3300020075 Bacteria 590
203 Ga0206355_1068224 3300020076 Bacteria 627
204 Ga0206352_10003420 3300020078 Bacteria 641
205 Ga0206352_10531866 3300020078 Bacteria 2831
206 Ga0206352_10568770 3300020078 Bacteria 525
207 Ga0206352_10781344 3300020078 Bacteria 685
208 Ga0206350_10782418 3300020080 Bacteria 596
209 Ga0206350_11062552 3300020080 Bacteria 691
210 Ga0206354_10101891 3300020081 Bacteria 587
211 Ga0206354_10966995 3300020081 Bacteria 889
212 Ga0154015_1205906 3300020610 Bacteria 697
213 Ga0154015_1613162 3300020610 Bacteria 870
214 Ga0213875_10010784 3300021388 Unclassified 4569
215 Ga0224712_10144085 3300022467 Bacteria 1051
216 Ga0224712_10199303 3300022467 Bacteria 909
217 Ga0224712_10225366 3300022467 Bacteria 859
218 Ga0224712_10495310 3300022467 Bacteria 590
219 Ga0224712_10584322 3300022467 Bacteria 545
220 Ga0207688_10653309 3300025901 Bacteria 664
221 Ga0207680_10362796 3300025903 Bacteria 1019
222 Ga0207680_10593472 3300025903 Bacteria 792
223 Ga0207680_10791500 3300025903 Bacteria 680
224 Ga0207699_10069231 3300025906 Bacteria 2151
225 Ga0207699_10563543 3300025906 Bacteria 827
226 Ga0207645_10415717 3300025907 Bacteria 906
227 Ga0207705_10562781 3300025909 Bacteria 886
228 Ga0207705_10644615 3300025909 Bacteria 824
229 Ga0207684_10149231 3300025910 Bacteria 2011
230 Ga0207684_10805891 3300025910 Bacteria 794
231 Ga0207707_10057191 3300025912 Bacteria 3395
232 Ga0207707_11386923 3300025912 Bacteria 561
233 Ga0207695_10071786 3300025913 Bacteria 3535
234 Ga0207695_10093936 3300025913 Bacteria 3008
235 Ga0207695_10221289 3300025913 Bacteria 1800
236 Ga0207695_10542222 3300025913 Bacteria 1045
237 Ga0207695_11236447 3300025913 Bacteria 627
238 Ga0207695_11646918 3300025913 Bacteria 522
239 Ga0207671_10015068 3300025914 Bacteria 6076
240 Ga0207671_10134788 3300025914 Bacteria 1898
241 Ga0207671_10306770 3300025914 Bacteria 1254
242 Ga0207671_11162170 3300025914 Bacteria 605
243 Ga0207671_11332758 3300025914 Bacteria 558
244 Ga0207663_10071663 3300025916 Bacteria 2237
245 Ga0207660_10088167 3300025917 Bacteria 2294
246 Ga0207660_10769358 3300025917 Bacteria 786
247 Ga0207649_11411823 3300025920 Bacteria 551
248 Ga0207652_10506456 3300025921 Bacteria 1087
249 Ga0207694_10013768 3300025924 Bacteria 6097
250 Ga0207694_10211014 3300025924 Bacteria 1582
251 Ga0207694_10327765 3300025924 Bacteria 1264
252 Ga0207694_10627254 3300025924 Bacteria 905
253 Ga0207694_10760530 3300025924 Bacteria 818
254 Ga0207659_10285021 3300025926 Bacteria 1352
255 Ga0207687_11368203 3300025927 Bacteria 608
256 Ga0207700_10014078 3300025928 Bacteria 5229
257 Ga0207700_10080624 3300025928 Bacteria 2539
258 Ga0207700_11031942 3300025928 Bacteria 736
259 Ga0207664_10583877 3300025929 Bacteria 1003
260 Ga0207664_10968741 3300025929 Bacteria 763
261 Ga0207664_11006154 3300025929 Bacteria 747
262 Ga0207664_11369322 3300025929 Bacteria 628
263 Ga0207644_11028238 3300025931 Bacteria 692
264 Ga0207690_10685591 3300025932 Bacteria 842
265 Ga0207670_10105090 3300025936 Bacteria 2023
266 Ga0207704_10434267 3300025938 Bacteria 1044
267 Ga0207665_10085346 3300025939 Bacteria 2180
268 Ga0207665_11031609 3300025939 Bacteria 655
269 Ga0207691_10500058 3300025940 Bacteria 1032
270 Ga0207711_10222402 3300025941 Bacteria 1727
271 Ga0207711_10273840 3300025941 Bacteria 1553
272 Ga0207711_10935912 3300025941 Bacteria 805
273 Ga0207689_10653771 3300025942 Bacteria 886
274 Ga0207661_10000003 3300025944 Bacteria 611941
275 Ga0207661_10021703 3300025944 Bacteria 4816
276 Ga0207661_10113092 3300025944 Bacteria 2300
277 Ga0207667_10026692 3300025949 Bacteria 6304
278 Ga0207667_10134501 3300025949 Bacteria 2546
279 Ga0207667_12140776 3300025949 Bacteria 517
280 Ga0207658_10444509 3300025986 Bacteria 1147
281 Ga0207658_10849656 3300025986 Bacteria 830
282 Ga0207677_10727981 3300026023 Bacteria 882
283 Ga0207677_11194682 3300026023 Bacteria 696
284 Ga0207703_10136778 3300026035 Bacteria 2122
285 Ga0207703_10222982 3300026035 Bacteria 1687
286 Ga0207703_11799336 3300026035 Bacteria 589
287 Ga0207639_11199206 3300026041 Bacteria 712
288 Ga0207639_11778781 3300026041 Bacteria 577
289 Ga0207641_11335524 3300026088 Bacteria 718
290 Ga0207641_11668278 3300026088 Bacteria 639
291 Ga0207648_10572764 3300026089 Bacteria 1039
292 Ga0207676_10702553 3300026095 Bacteria 980
293 Ga0207676_10902577 3300026095 Bacteria 867
294 Ga0207676_10941756 3300026095 Bacteria 849
295 Ga0207676_10975403 3300026095 Bacteria 834
296 Ga0207674_10698735 3300026116 Bacteria 979
297 Ga0268266_10348297 3300028379 Bacteria 1392
298 Ga0268266_11041153 3300028379 Bacteria 792
299 Ga0268266_11273888 3300028379 Bacteria 710
300 Ga0268265_11210309 3300028380 Bacteria 753
301 Ga0268264_11048106 3300028381 Bacteria 823
302 Ga0268264_11312207 3300028381 Bacteria 734
303 Ga0265768_113976 3300030963 Bacteria 547
304 Ga0265760_10054677 3300031090 Bacteria 1206
305 Ga0265329_10106101 3300031242 Bacteria 896
306 Ga0265316_10020430 3300031344 Bacteria 5635
307 Ga0265316_10026115 3300031344 Bacteria 4866
308 Ga0265316_10030819 3300031344 Bacteria 4391
309 Ga0265316_10031727 3300031344 Bacteria 4317
310 Ga0265316_10032569 3300031344 Bacteria 4253
311 Ga0265316_10522937 3300031344 Bacteria 846
312 Ga0265316_11073356 3300031344 Bacteria 559
313 Ga0265342_10191122 3300031712 Bacteria 1117
314 Ga0307413_11055219 3300031824 Bacteria 699
315 Ga0307406_10623822 3300031901 Bacteria 892
316 Ga0307416_103611031 3300032002 Bacteria 518
317 Ga0373944_0431044 3300035089 Bacteria 512
318 Ga0373923_0079655 3300035111 Bacteria 1419
319 Ga0373954_0046993 3300035118 Bacteria 2019
320 Ga0373954_0077817 3300035118 Bacteria 1582
321 Ga0373954_0332629 3300035118 Bacteria 750
322 Ga0373956_0596190 3300035119 Bacteria 527
323 Ga0373943_0887123 3300035170 Bacteria 533
324 Ga0373946_0466385 3300035171 Bacteria 645
325 Ga0373955_0045415 3300035172 Bacteria 2371
326 Ga0373955_0900018 3300035172 Bacteria 544
327 Ga0373924_0116990 3300035410 Bacteria 1155
328 Ga0373924_0448138 3300035410 Bacteria 578
329 Ga0373935_0543075 3300035692 Bacteria 847
330 Ga0373935_1307801 3300035692 Bacteria 541
331 Ga0373927_0052612 3300035695 Bacteria 2634
332 Ga0373927_0155338 3300035695 Bacteria 1498
333 Ga0373927_0247650 3300035695 Bacteria 1171
334 Ga0373927_1012553 3300035695 Bacteria 548
335 Ga0373933_0170745 3300035724 Bacteria 1384
336 Ga0373933_0225849 3300035724 Bacteria 1202
337 Ga0373933_0230749 3300035724 Bacteria 1189
338 Ga0373933_0309679 3300035724 Bacteria 1023
339 Ga0373933_1144476 3300035724 Bacteria 513
340 Ga0373947_0045568 3300035725 Bacteria 2625
341 Ga0373947_1149536 3300035725 Bacteria 529
342 Ga0373937_0041699 3300036401 Bacteria 4187
343 Ga0373937_0083393 3300036401 Bacteria 2957
344 Ga0373937_0087051 3300036401 Bacteria 2891
345 Ga0373925_0125066 3300037068 Bacteria 1999
346 Ga0373925_0552537 3300037068 Bacteria 947
347 Ga0373925_0577074 3300037068 Bacteria 926
348 Ga0436364_0226607 3300037853 Bacteria 1243
349 Ga0436364_1095466 3300037853 Bacteria 4609
350 Ga0436365_0800529 3300039437 Bacteria 1049
351 Ga0436365_1260272 3300039437 Bacteria 940
352 Ga0436363_1320677 3300039450 Bacteria 617
353 Ga0436362_1113559 3300039453 Bacteria 1381
354 Ga0451839_0096944 3300041496 Bacteria 552
355 Ga0439448_0132150 3300042005 Bacteria 861
356 Ga0451577_0741518 3300042876 Bacteria 889
357 Ga0453683_0242269 3300044673 Bacteria 1149
358 Ga0453683_1056847 3300044673 Bacteria 540
359 Ga0451576_0014948 3300045051 Bacteria 8621
360 Ga0451576_0410068 3300045051 Bacteria 1421
361 Ga0451576_0588935 3300045051 Bacteria 1169
362 Ga0451576_2438777 3300045051 Bacteria 535
363 Ga0495592_0063878 3300046454 Bacteria 2699
364 Ga0495592_0499682 3300046454 Bacteria 755
365 Ga0495629_0250502 3300046459 Bacteria 1219
366 Ga0495651_0003815 3300046462 Bacteria 11525
367 Ga0495651_0052289 3300046462 Bacteria 3146
368 Ga0495580_0002547 3300046472 Bacteria 15885
369 Ga0495580_0007983 3300046472 Bacteria 8459
370 Ga0495580_0019219 3300046472 Bacteria 5078
371 Ga0495580_0032463 3300046472 Bacteria 3768
372 Ga0495580_0130045 3300046472 Bacteria 1747
373 Ga0495582_0351154 3300046473 Bacteria 849
374 Ga0495639_0630200 3300046475 Bacteria 552
375 Ga0495662_0014296 3300046476 Bacteria 3861
376 Ga0495664_0003304 3300046477 Bacteria 8768
377 Ga0495664_0494168 3300046477 Bacteria 731
378 Ga0495664_0811660 3300046477 Bacteria 550
379 Ga0495664_0852056 3300046477 Bacteria 534
380 Ga0495594_0113880 3300046499 Bacteria 1526
381 Ga0495608_0095123 3300046511 Bacteria 1925
382 Ga0495628_0025792 3300046516 Bacteria 4799
383 Ga0495628_0214816 3300046516 Bacteria 1446
384 Ga0495628_0351275 3300046516 Bacteria 1084
385 Ga0495628_0468728 3300046516 Bacteria 913
386 Ga0495630_0055901 3300046517 Bacteria 2957
387 Ga0495652_0172460 3300046529 Bacteria 1668
388 Ga0495652_0630010 3300046529 Bacteria 728
389 Ga0495665_0425635 3300046531 Bacteria 672
390 Ga0495640_0026406 3300046533 Bacteria 4197
391 Ga0495640_0217457 3300046533 Bacteria 1206
392 Ga0495640_0591451 3300046533 Bacteria 671
393 Ga0495586_0359403 3300046535 Bacteria 837
394 Ga0495586_0515757 3300046535 Bacteria 690
395 Ga0495587_0126409 3300046536 Bacteria 1462
396 Ga0495587_0744362 3300046536 Bacteria 536
397 Ga0495587_0754040 3300046536 Bacteria 532
398 Ga0495645_0022568 3300046543 Bacteria 4554
399 Ga0495645_0037075 3300046543 Bacteria 3554
400 Ga0495645_0569288 3300046543 Bacteria 700
401 Ga0495645_0842135 3300046543 Bacteria 548
402 Ga0495667_0060402 3300046559 Bacteria 2486
403 Ga0495667_0797603 3300046559 Bacteria 582
404 Ga0495634_0158634 3300046642 Bacteria 1427
405 Ga0495634_0853401 3300046642 Bacteria 517
406 Ga0495635_0152440 3300046663 Bacteria 1573
407 Ga0495635_0306794 3300046663 Bacteria 1064
408 Ga0495599_0034531 3300046678 Bacteria 3177
409 Ga0495599_0347690 3300046678 Bacteria 889
410 Ga0495599_0349052 3300046678 Bacteria 887
411 Ga0495623_0032274 3300046679 Bacteria 3366
412 Ga0495623_0075475 3300046679 Bacteria 2093
413 Ga0495623_0120593 3300046679 Bacteria 1579
414 Ga0495623_0171325 3300046679 Bacteria 1268
415 Ga0495623_0435651 3300046679 Bacteria 700
416 Ga0495646_0181692 3300046680 Bacteria 1154
417 Ga0495646_0303902 3300046680 Bacteria 843
418 Ga0495646_0481253 3300046680 Bacteria 639
419 Ga0495613_0154963 3300046689 Bacteria 1632
420 Ga0495613_0310040 3300046689 Bacteria 1091
421 Ga0495613_0388662 3300046689 Bacteria 953
422 Ga0495600_0013561 3300046809 Bacteria 5125
423 Ga0495604_0056127 3300047317 Bacteria 3033
424 Ga0495604_0358190 3300047317 Bacteria 968
425 Ga0495674_0009769 3300047319 Bacteria 9112
426 Ga0495674_0025999 3300047319 Bacteria 5357
427 Ga0495674_0155268 3300047319 Bacteria 1917
428 Ga0495674_1294774 3300047319 Bacteria 547
429 Ga0495680_0427924 3300047322 Bacteria 909
430 Ga0495675_0041394 3300047444 Bacteria 2937
431 Ga0495675_0045547 3300047444 Bacteria 2793
432 Ga0495675_0047237 3300047444 Bacteria 2739
433 Ga0495684_0002407 3300047471 Bacteria 14922
434 Ga0495684_0030226 3300047471 Bacteria 4159
435 Ga0495684_0112362 3300047471 Bacteria 2054
436 Ga0495684_0138265 3300047471 Bacteria 1827
437 Ga0495602_0006583 3300048088 Bacteria 12177
438 Ga0495602_0086954 3300048088 Bacteria 2608
439 Ga0495602_0101956 3300048088 Bacteria 2353
440 Ga0495602_0415018 3300048088 Bacteria 957
441 Ga0495614_0175815 3300048089 Bacteria 962
442 Ga0496102_1595045 3300048905 Bacteria 571
443 Ga0496112_1671030 3300048915 Bacteria 550
444 Ga0496115_0302851 3300048918 Bacteria 1309
445 Ga0501306_034466 3300049127 Bacteria 765
446 Ga0501305_052236 3300049161 Bacteria 688
447 Ga0501305_099731 3300049161 Bacteria 540
448 Ga0501311_084248 3300049527 Bacteria 544
449 Ga0501320_062107 3300049536 Bacteria 527
450 Ga0501031_0004849 3300049568 Bacteria 8744
451 Ga0501032_0009137 3300049569 Bacteria 7192
452 Ga0501033_0008182 3300049570 Bacteria 8099
453 Ga0501034_0287448 3300049571 Bacteria 1583
454 Ga0501036_0007251 3300049572 Bacteria 9028
455 Ga0501037_0001533 3300049573 Bacteria 16839
456 Ga0501038_0023730 3300049574 Bacteria 5480
457 Ga0501039_0000786 3300049575 Bacteria 22808
458 Ga0501040_0162966 3300049576 Bacteria 1577
459 Ga0501043_0066485 3300049579 Bacteria 2831
460 Ga0501046_0003375 3300049580 Bacteria 14657
461 Ga0501047_0017702 3300049581 Bacteria 6825
462 Ga0501048_0009039 3300049582 Bacteria 7499
463 Ga0501067_0005842 3300049583 Bacteria 6825
464 Ga0501068_0000590 3300049584 Bacteria 18437
465 Ga0501069_0009057 3300049585 Bacteria 5254
466 Ga0501070_0073897 3300049586 Bacteria 2821
467 Ga0501072_0010906 3300049588 Bacteria 6932
468 Ga0501073_0001480 3300049589 Bacteria 17400
469 Ga0501074_0046679 3300049590 Bacteria 3131
470 Ga0501076_0005325 3300049592 Bacteria 9235
471 Ga0501077_0013581 3300049593 Bacteria 5105
472 Ga0501252_094331 3300049682 Bacteria 511
473 Ga0501253_222564 3300049683 Bacteria 506
474 Ga0501079_0007454 3300049741 Bacteria 8274
475 Ga0501080_0000482 3300049742 Bacteria 30997
476 Ga0501083_0026806 3300049744 Bacteria 3981
477 Ga0501035_0101092 3300049822 Bacteria 2530
478 Ga0501044_0047477 3300049823 Bacteria 4440
479 Ga0501045_0973484 3300049824 Bacteria 622
480 nmdc:mga0n895_1126071_c1 3300050512 Bacteria 761
481 nmdc:mga0rr50_1066582_c1 3300050513 Unclassified 688
482 nmdc:mga0rr50_119628_c1 3300050513 Bacteria 2094
483 nmdc:mga08x19_11612_c1 3300050514 Bacteria 5302
484 Ga0495601_0928748 3300053077 Bacteria 549
485 Ga0495595_0299379 3300053084 Bacteria 809
486 Ga0501084_0003880 3300054114 Bacteria 12170
487 Ga0587073_0301958 3300059492 Bacteria 521
488 Ga0587077_242062 3300059493 Bacteria 518
489 Ga0587083_0226077 3300059505 Bacteria 547
490 Ga0587078_051085 3300059646 Bacteria 606
491 Ga0587111_0259317 3300060346 Bacteria 517
492 Ga0501082_0000500 3300060353 Bacteria 34726
493 Ga0501082_0009933 3300060353 Bacteria 8206
494 Ga0070665_100395780
495 Ga0058859_11648225
496 Ga0058863_11904447
497 Ga0058863_11907825
498 Ga0058861_11434837
499 Ga0058862_12739220
500 Ga0070658_10238667
501 Ga0070658_10453712
502 Ga0070658_10872571
503 Ga0070676_10344613
504 Ga0070683_100000026
505 Ga0070683_100006243
506 Ga0070683_100172501
507 Ga0070670_100414529
508 Ga0068869_100668167
509 Ga0070666_10268208
510 Ga0070680_100100320
511 Ga0070682_100743092
512 Ga0068868_100375667
513 Ga0068868_100725328
514 Ga0068868_101220042
515 Ga0070689_100308635
516 Ga0070661_101749325
517 Ga0070675_100596050
518 Ga0070671_100759377
519 Ga0070671_101225391
520 Ga0070673_101484330
521 Ga0070659_100905166
522 Ga0070667_100536194
523 Ga0070667_100786143
524 Ga0070667_101432733
525 Ga0070709_10035725
526 Ga0070709_10313048
527 Ga0070709_10576038
528 Ga0070709_10988913
529 Ga0070714_101071558
530 Ga0070714_101444366
531 Ga0070714_101777104
532 Ga0070713_100059764
533 Ga0070713_100688958
534 Ga0070713_100783033
535 Ga0070713_101086376
536 Ga0070710_10821929
537 Ga0070711_100091033
538 Ga0070711_100243524
539 Ga0070711_100404095
540 Ga0070705_100843564
541 Ga0070694_100139894
542 Ga0070708_100693121
543 Ga0070678_100332962
544 Ga0070678_100749508
545 Ga0070681_10014268
546 Ga0070681_10120558
547 Ga0070681_10466880
548 Ga0070681_11196457
549 Ga0070706_100464286
550 Ga0070698_100481743
551 Ga0070698_101097383
552 Ga0070699_100036136
553 Ga0070679_100197245
554 Ga0070684_100000012
555 Ga0070684_100043235
556 Ga0070684_100463308
557 Ga0070684_101454051
558 Ga0070684_102177107
559 Ga0070684_102221402
560 Ga0070697_100204070
561 Ga0070686_100547587
562 Ga0070695_100580976
563 Ga0070696_100000050
564 Ga0070693_100251198
565 Ga0070665_100542801
566 Ga0070665_100901481
567 Ga0070665_100968813
568 Ga0070665_102137935
569 Ga0070704_100804462
570 Ga0068855_100125793
571 Ga0068855_100148486
572 Ga0068855_101284328
573 Ga0068857_100857773
574 Ga0068852_100215806
575 Ga0068859_100248824
576 Ga0068859_100513907
577 Ga0068859_100979973
578 Ga0068859_101051316
579 Ga0068864_100539109
580 Ga0068864_100915169
581 Ga0068863_100166348
582 Ga0068858_100350441
583 Ga0068858_101590567
584 Ga0068858_101932567
585 Ga0068860_100704412
586 Ga0068860_100723892
587 Ga0068860_100977313
588 Ga0068860_101878252
589 Ga0068860_102289299
590 Ga0070717_10020616
591 Ga0070717_10091275
592 Ga0070717_11251332
593 Ga0070717_11313243
594 Ga0070717_11900878
595 Ga0070716_100087604
596 Ga0070716_101257771
597 Ga0097621_100157910
598 Ga0097621_100243330
599 Ga0097621_100634134
600 Ga0097621_100772635
601 Ga0097621_100893283
602 Ga0097621_101076607
603 Ga0068871_100318805
604 Ga0068871_101357139
605 Ga0068865_100283060
606 Ga0075436_100005615
607 Ga0075436_100735684
608 Ga0097620_100248817
609 Ga0097620_100513810
610 Ga0097620_100980128
611 Ga0097620_101051087
612 Ga0075435_100354319
613 Ga0075435_100554918
614 Ga0105240_10002535
615 Ga0105240_10045158
616 Ga0105240_10124592
617 Ga0105240_10161914
618 Ga0105240_10667306
619 Ga0105240_10706415
620 Ga0105240_11393964
621 Ga0105245_10699454
622 Ga0105245_12136366
623 Ga0114129_10623660
624 Ga0105241_11381953
625 Ga0105242_10116738
626 Ga0105242_11017882
627 Ga0105242_11153200
628 Ga0105248_10033117
629 Ga0105248_10301214
630 Ga0105248_10997503
631 Ga0105248_10999387
632 Ga0105248_11157245
633 Ga0105248_11388489
634 Ga0105248_11466409
635 Ga0105248_12802893
636 Ga0105237_10034493
637 Ga0105237_10087528
638 Ga0105237_10478133
639 Ga0105237_11505859
640 Ga0105237_12271106
641 Ga0105238_10047858
642 Ga0105238_10121513
643 Ga0105238_10203897
644 Ga0105238_10295417
645 Ga0105238_10865751
646 Ga0105238_11549626
647 Ga0105238_12069705
648 Ga0105249_10337339
649 Ga0105239_10032294
650 Ga0105239_10142018
651 Ga0105239_11057604
652 Ga0105239_11446361
653 Ga0105246_11437201
654 Ga0105246_11949085
655 Ga0157370_10328150
656 Ga0157370_11294550
657 Ga0157369_10112229
658 Ga0157374_10750327
659 Ga0157374_11472305
660 Ga0157378_10830175
661 Ga0157378_10835119
662 Ga0157378_11246934
663 Ga0157378_12832017
664 Ga0163162_10602515
665 Ga0163162_11123187
666 Ga0163162_11987839
667 Ga0163162_12144582
668 Ga0163162_12761948
669 Ga0157372_10176424
670 Ga0157372_12687922
671 Ga0157372_13001739
672 Ga0157375_10125431
673 Ga0157375_10348226
674 Ga0157375_10789721
675 Ga0157375_11022141
676 Ga0163163_10006840
677 Ga0163163_10209519
678 Ga0163163_10343382
679 Ga0163163_10720887
680 Ga0157379_10687985
681 Ga0157379_11122875
682 Ga0157379_11243017
683 Ga0157376_10003232
684 Ga0157376_10159297
685 Ga0157376_10234406
686 Ga0157376_10809398
687 Ga0157376_11092981
688 Ga0157376_11119132
689 Ga0157376_12817822
690 Ga0163161_11366019
691 Ga0163161_11958570
692 Ga0197907_10804321
693 Ga0197907_11314123
694 Ga0206356_11046369
695 Ga0206349_1368680
696 Ga0206355_1068224
697 Ga0206352_10003420
698 Ga0206352_10531866
699 Ga0206352_10568770
700 Ga0206352_10781344
701 Ga0206350_10782418
702 Ga0206350_11062552
703 Ga0206354_10101891
704 Ga0206354_10966995
705 Ga0154015_1205906
706 Ga0154015_1613162
707 Ga0213875_10010784
708 Ga0224712_10144085
709 Ga0224712_10199303
710 Ga0224712_10225366
711 Ga0224712_10495310
712 Ga0224712_10584322
713 Ga0207688_10653309
714 Ga0207680_10362796
715 Ga0207680_10593472
716 Ga0207680_10791500
717 Ga0207699_10069231
718 Ga0207699_10563543
719 Ga0207645_10415717
720 Ga0207705_10562781
721 Ga0207705_10644615
722 Ga0207684_10149231
723 Ga0207684_10805891
724 Ga0207707_10057191
725 Ga0207707_11386923
726 Ga0207695_10071786
727 Ga0207695_10093936
728 Ga0207695_10221289
729 Ga0207695_10542222
730 Ga0207695_11236447
731 Ga0207695_11646918
732 Ga0207671_10015068
733 Ga0207671_10134788
734 Ga0207671_10306770
735 Ga0207671_11162170
736 Ga0207671_11332758
737 Ga0207663_10071663
738 Ga0207660_10088167
739 Ga0207660_10769358
740 Ga0207649_11411823
741 Ga0207652_10506456
742 Ga0207694_10013768
743 Ga0207694_10211014
744 Ga0207694_10327765
745 Ga0207694_10627254
746 Ga0207694_10760530
747 Ga0207659_10285021
748 Ga0207687_11368203
749 Ga0207700_10014078
750 Ga0207700_10080624
751 Ga0207700_11031942
752 Ga0207664_10583877
753 Ga0207664_10968741
754 Ga0207664_11006154
755 Ga0207664_11369322
756 Ga0207644_11028238
757 Ga0207690_10685591
758 Ga0207670_10105090
759 Ga0207704_10434267
760 Ga0207665_10085346
761 Ga0207665_11031609
762 Ga0207691_10500058
763 Ga0207711_10222402
764 Ga0207711_10273840
765 Ga0207711_10935912
766 Ga0207689_10653771
767 Ga0207661_10000003
768 Ga0207661_10021703
769 Ga0207661_10113092
770 Ga0207667_10026692
771 Ga0207667_10134501
772 Ga0207667_12140776
773 Ga0207658_10444509
774 Ga0207658_10849656
775 Ga0207677_10727981
776 Ga0207677_11194682
777 Ga0207703_10136778
778 Ga0207703_10222982
779 Ga0207703_11799336
780 Ga0207639_11199206
781 Ga0207639_11778781
782 Ga0207641_11335524
783 Ga0207641_11668278
784 Ga0207648_10572764
785 Ga0207676_10702553
786 Ga0207676_10902577
787 Ga0207676_10941756
788 Ga0207676_10975403
789 Ga0207674_10698735
790 Ga0268266_10348297
791 Ga0268266_11041153
792 Ga0268266_11273888
793 Ga0268265_11210309
794 Ga0268264_11048106
795 Ga0268264_11312207
796 Ga0265768_113976
797 Ga0265760_10054677
798 Ga0265329_10106101
799 Ga0265316_10020430
800 Ga0265316_10026115
801 Ga0265316_10030819
802 Ga0265316_10031727
803 Ga0265316_10032569
804 Ga0265316_10522937
805 Ga0265316_11073356
806 Ga0265342_10191122
807 Ga0307413_11055219
808 Ga0307406_10623822
809 Ga0307416_103611031
810 Ga0373944_0431044
811 Ga0373923_0079655
812 Ga0373954_0046993
813 Ga0373954_0077817
814 Ga0373954_0332629
815 Ga0373956_0596190
816 Ga0373943_0887123
817 Ga0373946_0466385
818 Ga0373955_0045415
819 Ga0373955_0900018
820 Ga0373924_0116990
821 Ga0373924_0448138
822 Ga0373935_0543075
823 Ga0373935_1307801
824 Ga0373927_0052612
825 Ga0373927_0155338
826 Ga0373927_0247650
827 Ga0373927_1012553
828 Ga0373933_0170745
829 Ga0373933_0225849
830 Ga0373933_0230749
831 Ga0373933_0309679
832 Ga0373933_1144476
833 Ga0373947_0045568
834 Ga0373947_1149536
835 Ga0373937_0041699
836 Ga0373937_0083393
837 Ga0373937_0087051
838 Ga0373925_0125066
839 Ga0373925_0552537
840 Ga0373925_0577074
841 Ga0436364_0226607
842 Ga0436364_1095466
843 Ga0436365_0800529
844 Ga0436365_1260272
845 Ga0436363_1320677
846 Ga0436362_1113559
847 Ga0451839_0096944
848 Ga0439448_0132150
849 Ga0451577_0741518
850 Ga0453683_0242269
851 Ga0453683_1056847
852 Ga0451576_0014948
853 Ga0451576_0410068
854 Ga0451576_0588935
855 Ga0451576_2438777
856 Ga0495592_0063878
857 Ga0495592_0499682
858 Ga0495629_0250502
859 Ga0495651_0003815
860 Ga0495651_0052289
861 Ga0495580_0002547
862 Ga0495580_0007983
863 Ga0495580_0019219
864 Ga0495580_0032463
865 Ga0495580_0130045
866 Ga0495582_0351154
867 Ga0495639_0630200
868 Ga0495662_0014296
869 Ga0495664_0003304
870 Ga0495664_0494168
871 Ga0495664_0811660
872 Ga0495664_0852056
873 Ga0495594_0113880
874 Ga0495608_0095123
875 Ga0495628_0025792
876 Ga0495628_0214816
877 Ga0495628_0351275
878 Ga0495628_0468728
879 Ga0495630_0055901
880 Ga0495652_0172460
881 Ga0495652_0630010
882 Ga0495665_0425635
883 Ga0495640_0026406
884 Ga0495640_0217457
885 Ga0495640_0591451
886 Ga0495586_0359403
887 Ga0495586_0515757
888 Ga0495587_0126409
889 Ga0495587_0744362
890 Ga0495587_0754040
891 Ga0495645_0022568
892 Ga0495645_0037075
893 Ga0495645_0569288
894 Ga0495645_0842135
895 Ga0495667_0060402
896 Ga0495667_0797603
897 Ga0495634_0158634
898 Ga0495634_0853401
899 Ga0495635_0152440
900 Ga0495635_0306794
901 Ga0495599_0034531
902 Ga0495599_0347690
903 Ga0495599_0349052
904 Ga0495623_0032274
905 Ga0495623_0075475
906 Ga0495623_0120593
907 Ga0495623_0171325
908 Ga0495623_0435651
909 Ga0495646_0181692
910 Ga0495646_0303902
911 Ga0495646_0481253
912 Ga0495613_0154963
913 Ga0495613_0310040
914 Ga0495613_0388662
915 Ga0495600_0013561
916 Ga0495604_0056127
917 Ga0495604_0358190
918 Ga0495674_0009769
919 Ga0495674_0025999
920 Ga0495674_0155268
921 Ga0495674_1294774
922 Ga0495680_0427924
923 Ga0495675_0041394
924 Ga0495675_0045547
925 Ga0495675_0047237
926 Ga0495684_0002407
927 Ga0495684_0030226
928 Ga0495684_0112362
929 Ga0495684_0138265
930 Ga0495602_0006583
931 Ga0495602_0086954
932 Ga0495602_0101956
933 Ga0495602_0415018
934 Ga0495614_0175815
935 Ga0496102_1595045
936 Ga0496112_1671030
937 Ga0496115_0302851
938 Ga0501306_034466
939 Ga0501305_052236
940 Ga0501305_099731
941 Ga0501311_084248
942 Ga0501320_062107
943 Ga0501031_0004849
944 Ga0501032_0009137
945 Ga0501033_0008182
946 Ga0501034_0287448
947 Ga0501036_0007251
948 Ga0501037_0001533
949 Ga0501038_0023730
950 Ga0501039_0000786
951 Ga0501040_0162966
952 Ga0501043_0066485
953 Ga0501046_0003375
954 Ga0501047_0017702
955 Ga0501048_0009039
956 Ga0501067_0005842
957 Ga0501068_0000590
958 Ga0501069_0009057
959 Ga0501070_0073897
960 Ga0501072_0010906
961 Ga0501073_0001480
962 Ga0501074_0046679
963 Ga0501076_0005325
964 Ga0501077_0013581
965 Ga0501252_094331
966 Ga0501253_222564
967 Ga0501079_0007454
968 Ga0501080_0000482
969 Ga0501083_0026806
970 Ga0501035_0101092
971 Ga0501044_0047477
972 Ga0501045_0973484
973 nmdc:mga0n895_1126071_c1
974 nmdc:mga0rr50_1066582_c1
975 nmdc:mga0rr50_119628_c1
976 nmdc:mga08x19_11612_c1
977 Ga0495601_0928748
978 Ga0495595_0299379
979 Ga0501084_0003880
980 Ga0587073_0301958
981 Ga0587077_242062
982 Ga0587083_0226077
983 Ga0587078_051085
984 Ga0587111_0259317
985 Ga0501082_0000500
986 Ga0501082_0009933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

29

131

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

42

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fb6-assembly1.cif.gz_A crystal structure of thioredoxin m from spinach chloroplast (oxidized form) 0.9929 6 109
4ba7-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period 0.9896 8 109
2puk-assembly2.cif.gz_G crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m 0.9878 6 109
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9844 5 106
1fb6-assembly1.cif.gz_A crystal structure of thioredoxin m from spinach chloroplast (oxidized form) 0.9835 6 109
ID Description Score Start End Superfamily
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9802 8 108 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9788 6 109 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9767 34 109 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9673 30 105 3.40.30.10
3tcoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9652 4 109 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V8EHB6-F1-model_v4 Thioredoxin 1.002 5 109 GO:0005737
GO:0015035
AF-A0A1V5RFC9-F1-model_v4 deleted 1.001 5 107
AF-A8DJR0-F1-model_v4 Thioredoxin 1 3 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A2P8CKV5-F1-model_v4 Thioredoxin 0.9993 6 109 GO:0005829
GO:0015035
GO:0045454
AF-A0A7X8CRM0-F1-model_v4 Thioredoxin 0.9988 6 108 GO:0005829
GO:0015035
GO:0045454

Map