F454385

General Info

Members Datasets Scaffolds Average Seq Length
493 287 485 151

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100916009|Ga0068868_1009160092
Length 145
Sequence MAKPIYILNGANLNRLGTREPKIYGKTTLAQVEALCRKAAGRHKVEFRQTNAEHQMVDWIQEAIDRASAIVINPAGFSFHSVPVLDALRMFDGPIIEVHISNLARRDEAHRHSLMSGAATGVVMGLGAEGYRIAVEAVLQGLGKS

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
3 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
4 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
5 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
6 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
118 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
119 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
120 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
121 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
122 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
162 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
282 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
283 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
287 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 1.01
Rhizoplane 8.72
Rhizosphere 72.82
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10195698 3300002067 Bacteria 586
2 JGI25156J39149_1000817 3300002705 Bacteria 15862
3 JGI25165J46597_1000281 3300003214 Bacteria 65020
4 Ga0055533_1000104 3300003756 Bacteria 106505
5 Ga0055532_1000003 3300003758 Bacteria 494004
6 Ga0055527_1000006 3300003760 Bacteria 494004
7 Ga0055535_1000003 3300003761 Bacteria 494004
8 Ga0055542_1000007 3300003762 Bacteria 494004
9 Ga0055529_1000003 3300003763 Bacteria 494004
10 Ga0055524_1000080 3300003775 Bacteria 120203
11 Ga0055530_10001678 3300003791 Bacteria 15712
12 Ga0055530_10031027 3300003791 Bacteria 1407
13 Ga0055540_1000002 3300003792 Bacteria 436954
14 Ga0055531_10007463 3300003794 Bacteria 5960
15 Ga0065165_1000957 3300005262 Bacteria 36333
16 Ga0070658_10134500 3300005327 Bacteria 2062
17 Ga0070683_100557408 3300005329 Bacteria 1096
18 Ga0070677_10154379 3300005333 Bacteria 1071
19 Ga0070666_10060360 3300005335 Bacteria 2566
20 Ga0070680_101319167 3300005336 Bacteria 625
21 Ga0070682_100868735 3300005337 Bacteria 738
22 Ga0068868_100531157 3300005338 Bacteria 1034
23 Ga0068868_100916009 3300005338 Unclassified 797
24 Ga0070660_100217038 3300005339 Bacteria 1554
25 Ga0070668_100799015 3300005347 Bacteria 838
26 Ga0070669_100334305 3300005353 Bacteria 1226
27 Ga0070671_100849326 3300005355 Bacteria 796
28 Ga0070667_100326544 3300005367 Bacteria 1385
29 Ga0070709_10152043 3300005434 Bacteria 1600
30 Ga0070714_101598456 3300005435 Bacteria 637
31 Ga0070713_101332254 3300005436 Bacteria 696
32 Ga0070711_100305638 3300005439 Bacteria 1266
33 Ga0068867_100156699 3300005459 Bacteria 1793
34 Ga0070697_101048142 3300005536 Bacteria 725
35 Ga0070665_100352222 3300005548 Bacteria 1478
36 Ga0068855_100110895 3300005563 Bacteria 3149
37 Ga0068856_100023413 3300005614 Bacteria 6005
38 Ga0068864_100446128 3300005618 Bacteria 1237
39 Ga0068866_10198988 3300005718 Bacteria 1196
40 Ga0068862_100071855 3300005844 Bacteria 2988
41 Ga0068862_100252952 3300005844 Bacteria 1606
42 Ga0081455_10218044 3300005937 Bacteria 1416
43 Ga0075366_10002542 3300006195 Bacteria 9377
44 Ga0075366_10058444 3300006195 Bacteria 2291
45 Ga0075428_100494690 3300006844 Bacteria 1308
46 Ga0079104_1000017 3300006946 Bacteria 313784
47 Ga0105251_10055251 3300009011 Bacteria 1883
48 Ga0105244_10000094 3300009036 Bacteria 94550
49 Ga0105250_10019990 3300009092 Bacteria 2707
50 Ga0105240_10092248 3300009093 Bacteria 3699
51 Ga0105240_10433561 3300009093 Bacteria 1474
52 Ga0111539_10515722 3300009094 Bacteria 1393
53 Ga0105245_10191685 3300009098 Bacteria 1958
54 Ga0105247_10185164 3300009101 Bacteria 1392
55 Ga0105241_11032962 3300009174 Bacteria 771
56 Ga0105248_10643414 3300009177 Bacteria 1196
57 Ga0105248_11214594 3300009177 Bacteria 852
58 Ga0105249_10495047 3300009553 Bacteria 1267
59 Ga0105246_10929344 3300011119 Bacteria 782
60 Ga0157369_10093150 3300013105 Bacteria 3216
61 Ga0157378_10501611 3300013297 Unclassified 1212
62 Ga0163162_10023889 3300013306 Bacteria 6033
63 Ga0163162_10036324 3300013306 Bacteria 4910
64 Ga0163162_10105977 3300013306 Bacteria 2906
65 Ga0163162_10479944 3300013306 Bacteria 1375
66 Ga0157375_10105631 3300013308 Bacteria 2907
67 Ga0163163_10031766 3300014325 Bacteria 5098
68 Ga0157380_10278102 3300014326 Bacteria 1530
69 Ga0157380_10308846 3300014326 Bacteria 1460
70 Ga0182008_10012523 3300014497 Bacteria 4475
71 Ga0157379_10042225 3300014968 Bacteria 4071
72 Ga0183361_10020 3300016635 Bacteria 128627
73 Ga0163161_10419863 3300017792 Bacteria 1076
74 Ga0213874_10132894 3300021377 Bacteria 856
75 Ga0213876_10117555 3300021384 Bacteria 1411
76 Ga0209674_100025 3300025226 Bacteria 515942
77 Ga0209672_100002 3300025228 Bacteria 1733325
78 Ga0209147_100003 3300025229 Bacteria 1733325
79 Ga0207427_101164 3300025231 Bacteria 10275
80 Ga0209437_100566 3300025233 Bacteria 24156
81 Ga0209258_100005 3300025242 Bacteria 1087938
82 Ga0209148_1000006 3300025254 Bacteria 1733325
83 Ga0209759_1000014 3300025256 Bacteria 396291
84 Ga0209759_1000097 3300025256 Bacteria 157627
85 Ga0209233_1000018 3300025261 Bacteria 886857
86 Ga0209455_1000003 3300025272 Bacteria 1471893
87 Ga0209130_1001878 3300025284 Bacteria 11959
88 Ga0209050_1000457 3300025298 Bacteria 73281
89 Ga0209050_1009810 3300025298 Bacteria 4824
90 Ga0209256_1000011 3300025299 Bacteria 865309
91 Ga0207426_1000107 3300025302 Bacteria 242623
92 Ga0209051_1000024 3300025303 Bacteria 437007
93 Ga0209257_1000079 3300025304 Bacteria 316420
94 Ga0207655_1000102 3300025728 Bacteria 185859
95 Ga0207713_1142506 3300025735 Bacteria 781
96 Ga0207642_10574596 3300025899 Bacteria 699
97 Ga0207688_10484916 3300025901 Bacteria 773
98 Ga0207680_10243484 3300025903 Bacteria 1240
99 Ga0207699_10065852 3300025906 Bacteria 2198
100 Ga0207707_10449600 3300025912 Bacteria 1103
101 Ga0207695_10024861 3300025913 Bacteria 6722
102 Ga0207695_10317728 3300025913 Bacteria 1447
103 Ga0207660_10989142 3300025917 Bacteria 686
104 Ga0207657_10198546 3300025919 Bacteria 1615
105 Ga0207681_10277111 3300025923 Bacteria 1319
106 Ga0207700_11266501 3300025928 Bacteria 657
107 Ga0207711_10653164 3300025941 Bacteria 981
108 Ga0207711_10845134 3300025941 Bacteria 852
109 Ga0207661_10637737 3300025944 Bacteria 979
110 Ga0207667_10036683 3300025949 Bacteria 5249
111 Ga0207712_10121160 3300025961 Bacteria 1979
112 Ga0207658_10332451 3300025986 Bacteria 1318
113 Ga0207703_10304481 3300026035 Bacteria 1455
114 Ga0207703_10343426 3300026035 Bacteria 1373
115 Ga0207708_10567699 3300026075 Bacteria 958
116 Ga0207702_10016888 3300026078 Bacteria 6041
117 Ga0207648_10127274 3300026089 Bacteria 2241
118 Ga0207676_10538784 3300026095 Bacteria 1114
119 Ga0207675_101086342 3300026118 Bacteria 820
120 Ga0209281_1000042 3300027111 Bacteria 344748
121 Ga0209282_1190287 3300027666 Bacteria 954
122 Ga0268266_10050150 3300028379 Bacteria 3581
123 Ga0268265_11089879 3300028380 Bacteria 792
124 Ga0268264_11089372 3300028381 Bacteria 807
125 Ga0265338_10851353 3300028800 Unclassified 623
126 Ga0316177_1220166 3300030731 Bacteria 3772
127 Ga0314311_1023036 3300030733 Bacteria 7083
128 Ga0316179_1110809 3300030734 Bacteria 3163
129 Ga0316178_1007908 3300030735 Bacteria 4019
130 Ga0316180_1019296 3300030736 Bacteria 4028
131 Ga0316183_1085563 3300030742 Bacteria 847
132 Ga0316183_1126188 3300030742 Bacteria 20738
133 Ga0316181_1028270 3300030744 Bacteria 9388
134 Ga0316181_1246800 3300030744 Bacteria 1267
135 Ga0316182_1295858 3300030745 Bacteria 1946
136 Ga0265331_10001202 3300031250 Bacteria 19515
137 Ga0265327_10000194 3300031251 Bacteria 129264
138 Ga0307513_10016881 3300031456 Bacteria 8780
139 Ga0307509_10002259 3300031507 Bacteria 31538
140 Ga0307509_10057194 3300031507 Bacteria 4136
141 Ga0307509_10214908 3300031507 Bacteria 1743
142 Ga0307408_100086649 3300031548 Bacteria 2354
143 Ga0307408_100129207 3300031548 Bacteria 1969
144 Ga0307408_100539998 3300031548 Bacteria 1027
145 Ga0307508_10221059 3300031616 Bacteria 1494
146 Ga0265314_10031117 3300031711 Bacteria 3944
147 Ga0307516_10094109 3300031730 Bacteria 2821
148 Ga0307413_10778313 3300031824 Bacteria 802
149 Ga0307410_10229702 3300031852 Bacteria 1432
150 Ga0307406_10036472 3300031901 Bacteria 3030
151 Ga0307406_10645630 3300031901 Bacteria 878
152 Ga0307406_10966247 3300031901 Bacteria 729
153 Ga0307412_10146077 3300031911 Bacteria 1738
154 Ga0307416_100581190 3300032002 Bacteria 1197
155 Ga0307411_10286149 3300032005 Bacteria 1314
156 Ga0307507_10177338 3300033179 Bacteria 1532
157 Ga0307510_10329444 3300033180 Bacteria 982
158 Ga0373932_0104122 3300035112 Bacteria 927
159 Ga0373954_0089012 3300035118 Bacteria 1481
160 Ga0373960_0397618 3300035121 Bacteria 531
161 Ga0373931_0014287 3300035691 Bacteria 3878
162 Ga0373927_0238407 3300035695 Bacteria 1195
163 Ga0373947_0036539 3300035725 Bacteria 2913
164 Ga0373925_0212612 3300037068 Bacteria 1541
165 Ga0395905_0000017 3300037471 Bacteria 376619
166 Ga0436364_1322810 3300037853 Bacteria 1250
167 Ga0436364_1364485 3300037853 Bacteria 1069
168 Ga0436364_1384778 3300037853 Bacteria 2167
169 Ga0436365_0358191 3300039437 Bacteria 1993
170 Ga0436363_0726810 3300039450 Bacteria 1169
171 Ga0439466_0001559 3300041411 Bacteria 8965
172 Ga0439465_0032681 3300041413 Bacteria 1662
173 Ga0451797_0974209 3300041453 Bacteria 678
174 Ga0439433_0007252 3300041999 Bacteria 2394
175 Ga0439445_0112678 3300042004 Bacteria 777
176 Ga0439445_0121308 3300042004 Bacteria 750
177 Ga0439432_003144 3300042006 Bacteria 6140
178 Ga0439432_018008 3300042006 Bacteria 2365
179 Ga0439449_0000761 3300042007 Bacteria 12371
180 Ga0439449_0011470 3300042007 Bacteria 3334
181 Ga0439449_0062613 3300042007 Bacteria 1372
182 Ga0439452_003055 3300042010 Bacteria 5950
183 Ga0439457_012788 3300042014 Bacteria 1889
184 Ga0450920_043358 3300042122 Bacteria 899
185 Ga0450896_070670 3300042133 Bacteria 578
186 Ga0439446_0122701 3300042156 Bacteria 837
187 Ga0450909_023112 3300042185 Bacteria 932
188 Ga0439434_0002734 3300042435 Bacteria 5140
189 Ga0450918_002606 3300042531 Bacteria 3410
190 Ga0495592_0007194 3300046454 Bacteria 8343
191 Ga0495592_0081823 3300046454 Bacteria 2334
192 Ga0495592_0262110 3300046454 Bacteria 1138
193 Ga0495603_0008340 3300046455 Bacteria 6263
194 Ga0495603_0045547 3300046455 Bacteria 2616
195 Ga0495603_0265446 3300046455 Bacteria 988
196 Ga0495603_0562981 3300046455 Bacteria 653
197 Ga0495590_0004527 3300046457 Bacteria 5598
198 Ga0495590_0032943 3300046457 Bacteria 1812
199 Ga0495590_0203122 3300046457 Bacteria 728
200 Ga0495591_002431 3300046458 Bacteria 10369
201 Ga0495629_0000033 3300046459 Bacteria 120105
202 Ga0495629_0002913 3300046459 Bacteria 13050
203 Ga0495629_0002962 3300046459 Bacteria 12925
204 Ga0495629_0041455 3300046459 Bacteria 3239
205 Ga0495629_0893389 3300046459 Bacteria 583
206 Ga0495638_0002449 3300046460 Bacteria 15148
207 Ga0495638_0028742 3300046460 Bacteria 3588
208 Ga0495641_0007361 3300046461 Bacteria 6885
209 Ga0495641_0133010 3300046461 Bacteria 1110
210 Ga0495651_0036169 3300046462 Bacteria 3844
211 Ga0495651_0990959 3300046462 Bacteria 510
212 Ga0495653_0002745 3300046463 Bacteria 14030
213 Ga0495653_0010676 3300046463 Bacteria 7520
214 Ga0495653_0028378 3300046463 Bacteria 4473
215 Ga0495653_0261390 3300046463 Bacteria 1144
216 Ga0495653_0381763 3300046463 Bacteria 899
217 Ga0495650_0000785 3300046471 Bacteria 38956
218 Ga0495650_0001794 3300046471 Bacteria 19376
219 Ga0495650_0032857 3300046471 Bacteria 2316
220 Ga0495650_0048218 3300046471 Bacteria 1777
221 Ga0495580_0000064 3300046472 Bacteria 63381
222 Ga0495580_0002321 3300046472 Bacteria 16595
223 Ga0495580_0007956 3300046472 Bacteria 8476
224 Ga0495580_0013020 3300046472 Bacteria 6368
225 Ga0495580_0130360 3300046472 Bacteria 1744
226 Ga0495582_0004182 3300046473 Bacteria 8115
227 Ga0495582_0015611 3300046473 Bacteria 4170
228 Ga0495582_0186268 3300046473 Bacteria 1183
229 Ga0495582_0559135 3300046473 Bacteria 662
230 Ga0495605_0001183 3300046474 Bacteria 17357
231 Ga0495605_0014805 3300046474 Bacteria 4258
232 Ga0495605_0150807 3300046474 Bacteria 1037
233 Ga0495639_0019722 3300046475 Bacteria 2943
234 Ga0495662_0034968 3300046476 Bacteria 2425
235 Ga0495662_0182116 3300046476 Bacteria 1035
236 Ga0495662_0482073 3300046476 Bacteria 608
237 Ga0495664_0005785 3300046477 Bacteria 6805
238 Ga0495664_0010364 3300046477 Bacteria 5229
239 Ga0495664_0233976 3300046477 Bacteria 1111
240 Ga0495664_0263770 3300046477 Bacteria 1041
241 Ga0495664_0270192 3300046477 Bacteria 1027
242 Ga0495585_0075327 3300046492 Bacteria 1835
243 Ga0495596_0022045 3300046500 Bacteria 2595
244 Ga0495596_0238388 3300046500 Bacteria 706
245 Ga0495607_0190399 3300046501 Bacteria 1022
246 Ga0495583_0009947 3300046506 Bacteria 5616
247 Ga0495583_0015485 3300046506 Bacteria 4145
248 Ga0495606_0016896 3300046507 Bacteria 5540
249 Ga0495606_0132205 3300046507 Bacteria 1482
250 Ga0495608_0001973 3300046511 Bacteria 14703
251 Ga0495608_0023136 3300046511 Bacteria 4260
252 Ga0495608_0235485 3300046511 Bacteria 1145
253 Ga0495616_0021845 3300046513 Bacteria 3460
254 Ga0495616_0376688 3300046513 Bacteria 587
255 Ga0495618_0019493 3300046514 Bacteria 4174
256 Ga0495618_0078422 3300046514 Bacteria 2105
257 Ga0495618_0103335 3300046514 Bacteria 1824
258 Ga0495620_0025697 3300046515 Bacteria 2781
259 Ga0495628_0013244 3300046516 Bacteria 6936
260 Ga0495628_0029202 3300046516 Bacteria 4474
261 Ga0495628_0048566 3300046516 Bacteria 3363
262 Ga0495628_0218587 3300046516 Bacteria 1431
263 Ga0495628_0548942 3300046516 Bacteria 830
264 Ga0495630_0005756 3300046517 Bacteria 8760
265 Ga0495630_0033417 3300046517 Bacteria 3836
266 Ga0495630_0055291 3300046517 Bacteria 2974
267 Ga0495630_0315392 3300046517 Bacteria 1195
268 Ga0495630_1110558 3300046517 Bacteria 599
269 Ga0495643_0373413 3300046522 Bacteria 634
270 Ga0495644_0008851 3300046523 Bacteria 3869
271 Ga0495648_0020295 3300046524 Bacteria 4637
272 Ga0495648_0040348 3300046524 Bacteria 2960
273 Ga0495648_0055017 3300046524 Bacteria 2400
274 Ga0495666_0000290 3300046526 Bacteria 21969
275 Ga0495666_0010977 3300046526 Bacteria 4518
276 Ga0495666_0078448 3300046526 Bacteria 1564
277 Ga0495642_0008003 3300046528 Bacteria 4045
278 Ga0495642_0015125 3300046528 Bacteria 2996
279 Ga0495642_0028690 3300046528 Bacteria 2218
280 Ga0495642_0071106 3300046528 Bacteria 1455
281 Ga0495642_0255602 3300046528 Bacteria 766
282 Ga0495652_0013882 3300046529 Bacteria 7245
283 Ga0495652_0059323 3300046529 Bacteria 3237
284 Ga0495652_0196466 3300046529 Bacteria 1535
285 Ga0495652_0465102 3300046529 Bacteria 883
286 Ga0495654_0035519 3300046530 Bacteria 2509
287 Ga0495654_0130219 3300046530 Bacteria 1130
288 Ga0495654_0134461 3300046530 Bacteria 1107
289 Ga0495665_0005619 3300046531 Bacteria 6759
290 Ga0495665_0121094 3300046531 Bacteria 1370
291 Ga0495665_0140103 3300046531 Bacteria 1264
292 Ga0495665_0164280 3300046531 Bacteria 1157
293 Ga0495640_0002924 3300046533 Bacteria 13750
294 Ga0495586_0706519 3300046535 Bacteria 582
295 Ga0495587_0018063 3300046536 Bacteria 4373
296 Ga0495587_0154950 3300046536 Bacteria 1305
297 Ga0495597_0179382 3300046542 Bacteria 856
298 Ga0495645_0000208 3300046543 Bacteria 42020
299 Ga0495645_0008913 3300046543 Bacteria 7008
300 Ga0495645_0019038 3300046543 Bacteria 4942
301 Ga0495622_0000083 3300046557 Bacteria 84580
302 Ga0495622_0005342 3300046557 Bacteria 5962
303 Ga0495622_0047628 3300046557 Bacteria 1992
304 Ga0495667_0071096 3300046559 Bacteria 2270
305 Ga0495667_0313585 3300046559 Bacteria 993
306 Ga0495656_0037690 3300046615 Bacteria 1999
307 Ga0495656_0125030 3300046615 Bacteria 1218
308 Ga0495668_0154900 3300046616 Bacteria 1255
309 Ga0495634_0010313 3300046642 Bacteria 6848
310 Ga0495634_0020294 3300046642 Bacteria 4714
311 Ga0495634_0246087 3300046642 Bacteria 1095
312 Ga0495611_0035867 3300046648 Bacteria 2199
313 Ga0495625_0001753 3300046660 Bacteria 25093
314 Ga0495625_0377561 3300046660 Bacteria 890
315 Ga0495635_0000843 3300046663 Bacteria 20064
316 Ga0495661_0007832 3300046665 Bacteria 7431
317 Ga0495661_0022431 3300046665 Bacteria 4107
318 Ga0495588_0078368 3300046674 Bacteria 1724
319 Ga0495588_0552358 3300046674 Bacteria 603
320 Ga0495657_0007089 3300046675 Bacteria 8694
321 Ga0495623_0149630 3300046679 Bacteria 1381
322 Ga0495623_0252910 3300046679 Bacteria 990
323 Ga0495623_0347567 3300046679 Bacteria 808
324 Ga0495646_0039916 3300046680 Bacteria 2892
325 Ga0495646_0049138 3300046680 Bacteria 2561
326 Ga0495646_0079274 3300046680 Bacteria 1917
327 Ga0495646_0248873 3300046680 Bacteria 953
328 Ga0495646_0374338 3300046680 Bacteria 743
329 Ga0495658_0532864 3300046683 Bacteria 752
330 Ga0495669_0011884 3300046684 Bacteria 3703
331 Ga0495669_0041729 3300046684 Bacteria 2038
332 Ga0495613_0013682 3300046689 Bacteria 6020
333 Ga0495613_0013806 3300046689 Bacteria 5991
334 Ga0495624_0025650 3300046690 Bacteria 3869
335 Ga0495624_0082916 3300046690 Bacteria 1983
336 Ga0495624_0244635 3300046690 Bacteria 1085
337 Ga0495624_0794364 3300046690 Bacteria 559
338 Ga0495670_0003558 3300046691 Bacteria 7653
339 Ga0495670_0577929 3300046691 Bacteria 612
340 Ga0495671_0014268 3300046692 Bacteria 4280
341 Ga0495649_0012813 3300046694 Bacteria 4862
342 Ga0495649_0017166 3300046694 Bacteria 4088
343 Ga0495589_0017667 3300046794 Bacteria 3660
344 Ga0495589_0031608 3300046794 Bacteria 2664
345 Ga0495589_0062806 3300046794 Bacteria 1822
346 Ga0495589_0151639 3300046794 Bacteria 1106
347 Ga0495600_0002998 3300046809 Bacteria 9861
348 Ga0495600_0092717 3300046809 Bacteria 1970
349 Ga0495600_0097042 3300046809 Bacteria 1921
350 Ga0495600_0410814 3300046809 Bacteria 841
351 Ga0495660_0041193 3300046810 Bacteria 2559
352 Ga0495660_0083802 3300046810 Bacteria 1668
353 Ga0495660_0165989 3300046810 Bacteria 1079
354 Ga0495660_0176253 3300046810 Bacteria 1038
355 Ga0495660_0205646 3300046810 Bacteria 937
356 Ga0495581_0000660 3300047315 Bacteria 18106
357 Ga0495581_0010491 3300047315 Bacteria 5355
358 Ga0495581_0105873 3300047315 Bacteria 1635
359 Ga0495581_0464436 3300047315 Bacteria 737
360 Ga0495604_0027776 3300047317 Bacteria 4500
361 Ga0495604_0088171 3300047317 Bacteria 2308
362 Ga0495604_0117254 3300047317 Bacteria 1931
363 Ga0495604_0728169 3300047317 Bacteria 628
364 Ga0495674_0015366 3300047319 Bacteria 7159
365 Ga0495674_0016689 3300047319 Bacteria 6851
366 Ga0495674_0142563 3300047319 Bacteria 2013
367 Ga0495674_0311988 3300047319 Bacteria 1283
368 Ga0495676_0003137 3300047321 Bacteria 14947
369 Ga0495676_0008300 3300047321 Bacteria 9521
370 Ga0495676_0068239 3300047321 Bacteria 2748
371 Ga0495676_0075024 3300047321 Bacteria 2587
372 Ga0495676_0322748 3300047321 Bacteria 1037
373 Ga0495680_0035516 3300047322 Bacteria 4014
374 Ga0495680_0319260 3300047322 Bacteria 1087
375 Ga0495683_0000990 3300047323 Bacteria 19873
376 Ga0495683_0014050 3300047323 Bacteria 4171
377 Ga0495683_0060843 3300047323 Bacteria 1870
378 Ga0495687_041455 3300047443 Bacteria 2020
379 Ga0495687_059386 3300047443 Bacteria 1582
380 Ga0495687_156840 3300047443 Bacteria 771
381 Ga0495675_0008492 3300047444 Bacteria 6364
382 Ga0495675_0009702 3300047444 Bacteria 6001
383 Ga0495675_0116284 3300047444 Bacteria 1667
384 Ga0495675_0359540 3300047444 Bacteria 855
385 Ga0495679_000030 3300047446 Bacteria 180083
386 Ga0495679_005432 3300047446 Bacteria 5646
387 Ga0495679_082878 3300047446 Bacteria 908
388 Ga0495679_113302 3300047446 Bacteria 745
389 Ga0495681_0018795 3300047470 Bacteria 3793
390 Ga0495684_0277556 3300047471 Bacteria 1210
391 Ga0495686_0005992 3300047472 Bacteria 9452
392 Ga0495686_0295405 3300047472 Bacteria 896
393 Ga0495593_0005659 3300047673 Bacteria 7376
394 Ga0495593_0034814 3300047673 Bacteria 2737
395 Ga0495593_0053275 3300047673 Bacteria 2135
396 Ga0495593_0109080 3300047673 Bacteria 1414
397 Ga0495602_0030006 3300048088 Bacteria 5166
398 Ga0495602_0051819 3300048088 Bacteria 3651
399 Ga0495602_0078583 3300048088 Bacteria 2786
400 Ga0495614_0003466 3300048089 Bacteria 7055
401 Ga0495614_0061673 3300048089 Bacteria 1611
402 Ga0496100_0004365 3300048903 Bacteria 7489
403 Ga0496100_0066500 3300048903 Bacteria 2391
404 Ga0496100_0073049 3300048903 Bacteria 2294
405 Ga0496100_0125604 3300048903 Bacteria 1800
406 Ga0496100_0333182 3300048903 Bacteria 1143
407 Ga0496101_0000266 3300048904 Bacteria 36897
408 Ga0496101_0006414 3300048904 Bacteria 7567
409 Ga0496101_0022118 3300048904 Bacteria 4375
410 Ga0496101_0081449 3300048904 Bacteria 2394
411 Ga0496102_0000616 3300048905 Bacteria 36897
412 Ga0496102_0024652 3300048905 Bacteria 5349
413 Ga0496102_0070229 3300048905 Bacteria 3216
414 Ga0496102_0527564 3300048905 Bacteria 1103
415 Ga0496102_1552221 3300048905 Bacteria 581
416 Ga0496103_0009303 3300048906 Bacteria 5822
417 Ga0496103_0012904 3300048906 Bacteria 4954
418 Ga0496103_0085226 3300048906 Bacteria 1991
419 Ga0496103_0271007 3300048906 Bacteria 1092
420 Ga0496104_0047552 3300048907 Bacteria 4043
421 Ga0496104_0048376 3300048907 Bacteria 4009
422 Ga0496105_0047182 3300048908 Bacteria 3554
423 Ga0496105_0387200 3300048908 Bacteria 1112
424 Ga0496106_0112534 3300048909 Bacteria 2121
425 Ga0496107_0093766 3300048910 Bacteria 2196
426 Ga0496107_0103668 3300048910 Bacteria 2087
427 Ga0496108_0035615 3300048911 Bacteria 4138
428 Ga0496109_0064907 3300048912 Bacteria 3341
429 Ga0496109_0723392 3300048912 Bacteria 933
430 Ga0496110_0113350 3300048913 Bacteria 2438
431 Ga0496111_0013212 3300048914 Bacteria 5612
432 Ga0496112_0007103 3300048915 Bacteria 9901
433 Ga0496112_0509496 3300048915 Bacteria 1138
434 Ga0496113_0005411 3300048916 Bacteria 7958
435 Ga0496113_0012766 3300048916 Bacteria 5659
436 Ga0496113_0338165 3300048916 Bacteria 1207
437 Ga0496114_0000500 3300048917 Bacteria 28638
438 Ga0496114_0000601 3300048917 Bacteria 26597
439 Ga0496114_0258130 3300048917 Bacteria 1534
440 Ga0496114_0385440 3300048917 Bacteria 1241
441 Ga0496114_1147805 3300048917 Bacteria 662
442 Ga0496115_0033451 3300048918 Bacteria 4059
443 Ga0496115_0157475 3300048918 Bacteria 1876
444 Ga0496117_0001912 3300048920 Bacteria 27932
445 Ga0496117_0004118 3300048920 Bacteria 16290
446 Ga0496117_0081532 3300048920 Bacteria 2122
447 Ga0496118_0001357 3300048921 Bacteria 36897
448 Ga0496118_0003214 3300048921 Bacteria 20856
449 Ga0496118_0010328 3300048921 Bacteria 9259
450 Ga0496118_0078347 3300048921 Bacteria 2339
451 Ga0496119_0035981 3300048922 Bacteria 3237
452 Ga0496120_0044942 3300048923 Bacteria 2563
453 Ga0496121_0011987 3300048924 Bacteria 9531
454 Ga0496121_0019131 3300048924 Bacteria 6865
455 Ga0496121_0029689 3300048924 Bacteria 5044
456 Ga0496121_0185466 3300048924 Bacteria 1497
457 Ga0496121_0825334 3300048924 Bacteria 542
458 Ga0496122_0002240 3300048925 Bacteria 28103
459 Ga0496122_0412037 3300048925 Bacteria 682
460 Ga0496123_0005292 3300048926 Bacteria 13077
461 Ga0496123_0113976 3300048926 Bacteria 1538
462 Ga0496124_0006679 3300048927 Bacteria 12503
463 Ga0496125_0009819 3300048928 Bacteria 9753
464 Ga0496126_0000724 3300048929 Bacteria 59840
465 Ga0496126_0389370 3300048929 Bacteria 1133
466 Ga0495678_054988 3300049459 Bacteria 1521
467 Ga0495678_081293 3300049459 Bacteria 1163
468 Ga0495678_125931 3300049459 Bacteria 854
469 Ga0495682_0163501 3300049460 Bacteria 792
470 Ga0501043_0765748 3300049579 Bacteria 701
471 Ga0501249_000918 3300049679 Bacteria 6460
472 Ga0501035_0689719 3300049822 Bacteria 825
473 Ga0501044_0183269 3300049823 Bacteria 2060
474 nmdc:mga0k408_22704_c1 3300050493 Bacteria 3535
475 nmdc:mga0k408_6742_c1 3300050493 Bacteria 6127
476 nmdc:mga0k408_86370_c1 3300050493 Bacteria 1841
477 nmdc:mga07m45_72408_c2 3300050496 Bacteria 1063
478 Ga0500635_0003593 3300053080 Bacteria 3920
479 Ga0500566_0004937 3300053094 Bacteria 7946
480 Ga0500566_0015431 3300053094 Bacteria 4484
481 Ga0500652_007505 3300053131 Bacteria 3573
482 Ga0500564_064907 3300053138 Bacteria 1652
483 Ga0500639_223122 3300053163 Bacteria 784
484 Ga0500637_0008329 3300053178 Bacteria 5221
485 Ga0500645_000278 3300053730 Bacteria 36629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100916009 Ga0068868_1009160092 145
2 3300009098 Ga0105245_10191685 Ga0105245_101916852 145
3 3300013297 Ga0157378_10501611 Ga0157378_105016112 145
4 3300046535 Ga0495586_0706519 Ga0495586_0706519_125_565 145
5 3300005329 Ga0070683_100557408 Ga0070683_1005574082 146
6 3300005355 Ga0070671_100849326 Ga0070671_1008493261 146
7 3300005434 Ga0070709_10152043 Ga0070709_101520433 146
8 3300005436 Ga0070713_101332254 Ga0070713_1013322541 146
9 3300005439 Ga0070711_100305638 Ga0070711_1003056381 146
10 3300005563 Ga0068855_100110895 Ga0068855_1001108952 146
11 3300005614 Ga0068856_100023413 Ga0068856_1000234135 146
12 3300005618 Ga0068864_100446128 Ga0068864_1004461282 146
13 3300009101 Ga0105247_10185164 Ga0105247_101851641 146
14 3300009177 Ga0105248_11214594 Ga0105248_112145942 146
15 3300011119 Ga0105246_10929344 Ga0105246_109293441 146
16 3300014325 Ga0163163_10031766 Ga0163163_100317661 146
17 3300014497 Ga0182008_10012523 Ga0182008_100125232 146
18 3300025233 Ga0209437_100566 Ga0209437_10056614 146
19 3300025906 Ga0207699_10065852 Ga0207699_100658522 146
20 3300025928 Ga0207700_11266501 Ga0207700_112665012 146
21 3300025941 Ga0207711_10845134 Ga0207711_108451342 146
22 3300025944 Ga0207661_10637737 Ga0207661_106377372 146
23 3300025949 Ga0207667_10036683 Ga0207667_100366834 146
24 3300026078 Ga0207702_10016888 Ga0207702_100168882 146
25 3300026095 Ga0207676_10538784 Ga0207676_105387841 146
26 3300027666 Ga0209282_1190287 Ga0209282_11902872 146
27 3300031250 Ga0265331_10001202 Ga0265331_100012024 146
28 3300035695 Ga0373927_0238407 Ga0373927_0238407_588_1028 146
29 3300035725 Ga0373947_0036539 Ga0373947_0036539_1443_1883 146
30 3300037068 Ga0373925_0212612 Ga0373925_0212612_1054_1494 146
31 3300046455 Ga0495603_0265446 Ga0495603_0265446_235_675 146
32 3300046473 Ga0495582_0559135 Ga0495582_0559135_137_577 146
33 3300046517 Ga0495630_1110558 Ga0495630_1110558_59_499 146
34 3300046530 Ga0495654_0130219 Ga0495654_0130219_650_1090 146
35 3300046660 Ga0495625_0001753 Ga0495625_0001753_20983_21423 146
36 3300047315 Ga0495581_0105873 Ga0495581_0105873_741_1181 146
37 3300048903 Ga0496100_0333182 Ga0496100_0333182_294_734 146
38 3300048904 Ga0496101_0081449 Ga0496101_0081449_1475_1915 146
39 3300048907 Ga0496104_0048376 Ga0496104_0048376_1371_1811 146
40 3300048908 Ga0496105_0047182 Ga0496105_0047182_723_1163 146
41 3300048911 Ga0496108_0035615 Ga0496108_0035615_2491_2931 146
42 3300048912 Ga0496109_0064907 Ga0496109_0064907_1532_1972 146
43 3300048913 Ga0496110_0113350 Ga0496110_0113350_1218_1658 146
44 3300048914 Ga0496111_0013212 Ga0496111_0013212_2328_2768 146
45 3300048915 Ga0496112_0007103 Ga0496112_0007103_1525_1965 146
46 3300048916 Ga0496113_0005411 Ga0496113_0005411_5981_6421 146
47 3300048917 Ga0496114_0258130 Ga0496114_0258130_899_1339 146
48 3300048918 Ga0496115_0033451 Ga0496115_0033451_3322_3762 146
49 3300053131 Ga0500652_007505 Ga0500652_007505_2499_2945 146
50 iso_pu_bacteria 2954767861 2954771034 146
51 3300006844 Ga0075428_100494690 Ga0075428_1004946902 147
52 3300021377 Ga0213874_10132894 Ga0213874_101328942 147
53 3300021384 Ga0213876_10117555 Ga0213876_101175552 147
54 3300033180 Ga0307510_10329444 Ga0307510_103294442 147
55 3300037853 Ga0436364_1364485 Ga0436364_1364485_493_936 147
56 3300037853 Ga0436364_1384778 Ga0436364_1384778_250_693 147
57 3300039437 Ga0436365_0358191 Ga0436365_0358191_426_869 147
58 3300039450 Ga0436363_0726810 Ga0436363_0726810_215_658 147
59 3300046516 Ga0495628_0548942 Ga0495628_0548942_247_690 147
60 3300046543 Ga0495645_0008913 Ga0495645_0008913_4183_4626 147
61 3300046615 Ga0495656_0037690 Ga0495656_0037690_183_626 147
62 3300046660 Ga0495625_0377561 Ga0495625_0377561_320_763 147
63 3300048925 Ga0496122_0002240 Ga0496122_0002240_12468_12911 147
64 3300048926 Ga0496123_0005292 Ga0496123_0005292_8183_8626 147
65 3300048928 Ga0496125_0009819 Ga0496125_0009819_2425_2868 147
66 3300050496 nmdc:mga07m45_72408_c2 nmdc:mga07m45_72408_c2_374_817 147
67 3300053730 Ga0500645_000278 Ga0500645_000278_17060_17506 147
68 iso_pu_bacteria 2562617112 2563055868 147
69 iso_pu_bacteria 2711768613 2713481815 147
70 iso_pu_bacteria 2904483920 2904487050 147
71 iso_pu_bacteria 2919527303 2919528362 147
72 iso_pu_bacteria 2921643360 2921651906 147
73 iso_pu_bacteria 642555113 642615207 147
74 iso_pu_bacteria 8055301274 8055306758 147
75 3300005548 Ga0070665_100352222 Ga0070665_1003522222 148
76 3300028379 Ga0268266_10050150 Ga0268266_100501502 148
77 3300031548 Ga0307408_100129207 Ga0307408_1001292072 148
78 3300037471 Ga0395905_0000017 Ga0395905_0000017_29295_29756 148
79 3300041453 Ga0451797_0974209 Ga0451797_0974209_72_518 148
80 3300048924 Ga0496121_0019131 Ga0496121_0019131_3905_4351 148
81 3300003775 Ga0055524_1000080 Ga0055524_1000080108 149
82 3300003791 Ga0055530_10001678 Ga0055530_1000167813 149
83 3300003791 Ga0055530_10031027 Ga0055530_100310272 149
84 3300003792 Ga0055540_1000002 Ga0055540_1000002208 149
85 3300003794 Ga0055531_10007463 Ga0055531_100074636 149
86 3300006195 Ga0075366_10058444 Ga0075366_100584442 149
87 3300006946 Ga0079104_1000017 Ga0079104_1000017242 149
88 3300013306 Ga0163162_10036324 Ga0163162_100363241 149
89 3300013306 Ga0163162_10479944 Ga0163162_104799442 149
90 3300014326 Ga0157380_10278102 Ga0157380_102781022 149
91 3300014968 Ga0157379_10042225 Ga0157379_100422253 149
92 3300016635 Ga0183361_10020 Ga0183361_1002012 149
93 3300025298 Ga0209050_1000457 Ga0209050_100045738 149
94 3300025298 Ga0209050_1009810 Ga0209050_10098102 149
95 3300025299 Ga0209256_1000011 Ga0209256_1000011675 149
96 3300025303 Ga0209051_1000024 Ga0209051_1000024209 149
97 3300025304 Ga0209257_1000079 Ga0209257_1000079209 149
98 3300026035 Ga0207703_10304481 Ga0207703_103044812 149
99 3300027111 Ga0209281_1000042 Ga0209281_1000042107 149
100 3300028800 Ga0265338_10851353 Ga0265338_108513532 149
101 3300031251 Ga0265327_10000194 Ga0265327_1000019414 149
102 3300031456 Ga0307513_10016881 Ga0307513_100168813 149
103 3300031507 Ga0307509_10057194 Ga0307509_100571943 149
104 3300031711 Ga0265314_10031117 Ga0265314_100311173 149
105 3300031730 Ga0307516_10094109 Ga0307516_100941092 149
106 3300035112 Ga0373932_0104122 Ga0373932_0104122_366_815 149
107 3300035691 Ga0373931_0014287 Ga0373931_0014287_1717_2166 149
108 3300037853 Ga0436364_1322810 Ga0436364_1322810_79_528 149
109 3300041411 Ga0439466_0001559 Ga0439466_0001559_8019_8468 149
110 3300041413 Ga0439465_0032681 Ga0439465_0032681_20_469 149
111 3300041999 Ga0439433_0007252 Ga0439433_0007252_1135_1584 149
112 3300042004 Ga0439445_0121308 Ga0439445_0121308_40_489 149
113 3300042006 Ga0439432_003144 Ga0439432_003144_3637_4086 149
114 3300042007 Ga0439449_0011470 Ga0439449_0011470_60_509 149
115 3300042010 Ga0439452_003055 Ga0439452_003055_5290_5739 149
116 3300042014 Ga0439457_012788 Ga0439457_012788_842_1291 149
117 3300042122 Ga0450920_043358 Ga0450920_043358_230_679 149
118 3300042156 Ga0439446_0122701 Ga0439446_0122701_49_498 149
119 3300042185 Ga0450909_023112 Ga0450909_023112_261_710 149
120 3300042435 Ga0439434_0002734 Ga0439434_0002734_133_582 149
121 3300042531 Ga0450918_002606 Ga0450918_002606_376_825 149
122 3300046459 Ga0495629_0893389 Ga0495629_0893389_38_487 149
123 3300046517 Ga0495630_0315392 Ga0495630_0315392_507_956 149
124 3300046557 Ga0495622_0047628 Ga0495622_0047628_751_1200 149
125 3300046680 Ga0495646_0248873 Ga0495646_0248873_376_825 149
126 3300046683 Ga0495658_0532864 Ga0495658_0532864_206_655 149
127 3300046690 Ga0495624_0025650 Ga0495624_0025650_1361_1810 149
128 3300047319 Ga0495674_0015366 Ga0495674_0015366_582_1031 149
129 3300047673 Ga0495593_0109080 Ga0495593_0109080_803_1252 149
130 3300048917 Ga0496114_0000500 Ga0496114_0000500_10464_10913 149
131 3300049579 Ga0501043_0765748 Ga0501043_0765748_110_574 149
132 3300049822 Ga0501035_0689719 Ga0501035_0689719_132_596 149
133 3300049823 Ga0501044_0183269 Ga0501044_0183269_870_1334 149
134 3300050493 nmdc:mga0k408_86370_c1 nmdc:mga0k408_86370_c1_367_867 149
135 3300005327 Ga0070658_10134500 Ga0070658_101345002 150
136 3300005336 Ga0070680_101319167 Ga0070680_1013191671 150
137 3300005339 Ga0070660_100217038 Ga0070660_1002170381 150
138 3300005353 Ga0070669_100334305 Ga0070669_1003343051 150
139 3300005435 Ga0070714_101598456 Ga0070714_1015984561 150
140 3300025912 Ga0207707_10449600 Ga0207707_104496002 150
141 3300025913 Ga0207695_10024861 Ga0207695_100248612 150
142 3300025917 Ga0207660_10989142 Ga0207660_109891422 150
143 3300025919 Ga0207657_10198546 Ga0207657_101985461 150
144 3300025923 Ga0207681_10277111 Ga0207681_102771112 150
145 3300030742 Ga0316183_1085563 Ga0316183_10855631 150
146 3300030744 Ga0316181_1246800 Ga0316181_12468002 150
147 3300030745 Ga0316182_1295858 Ga0316182_12958582 150
148 3300042004 Ga0439445_0112678 Ga0439445_0112678_51_503 150
149 3300042007 Ga0439449_0000761 Ga0439449_0000761_5712_6215 150
150 3300046516 Ga0495628_0029202 Ga0495628_0029202_2489_2941 150
151 3300046529 Ga0495652_0196466 Ga0495652_0196466_44_496 150
152 3300046559 Ga0495667_0313585 Ga0495667_0313585_35_487 150
153 3300046680 Ga0495646_0374338 Ga0495646_0374338_57_509 150
154 3300046809 Ga0495600_0092717 Ga0495600_0092717_1452_1955 150
155 3300053094 Ga0500566_0015431 Ga0500566_0015431_3842_4294 150
156 3300002067 JGI24735J21928_10195698 JGI24735J21928_101956982 151
157 3300002705 JGI25156J39149_1000817 JGI25156J39149_10008178 151
158 3300003214 JGI25165J46597_1000281 JGI25165J46597_100028137 151
159 3300003756 Ga0055533_1000104 Ga0055533_100010480 151
160 3300003758 Ga0055532_1000003 Ga0055532_1000003376 151
161 3300003760 Ga0055527_1000006 Ga0055527_100000681 151
162 3300003761 Ga0055535_1000003 Ga0055535_1000003376 151
163 3300003762 Ga0055542_1000007 Ga0055542_1000007376 151
164 3300003763 Ga0055529_1000003 Ga0055529_100000381 151
165 3300005262 Ga0065165_1000957 Ga0065165_10009579 151
166 3300005333 Ga0070677_10154379 Ga0070677_101543792 151
167 3300005335 Ga0070666_10060360 Ga0070666_100603602 151
168 3300005337 Ga0070682_100868735 Ga0070682_1008687351 151
169 3300005338 Ga0068868_100531157 Ga0068868_1005311572 151
170 3300005347 Ga0070668_100799015 Ga0070668_1007990151 151
171 3300005367 Ga0070667_100326544 Ga0070667_1003265442 151
172 3300005459 Ga0068867_100156699 Ga0068867_1001566993 151
173 3300005536 Ga0070697_101048142 Ga0070697_1010481421 151
174 3300005718 Ga0068866_10198988 Ga0068866_101989882 151
175 3300005844 Ga0068862_100071855 Ga0068862_1000718552 151
176 3300005844 Ga0068862_100252952 Ga0068862_1002529522 151
177 3300005937 Ga0081455_10218044 Ga0081455_102180442 151
178 3300006195 Ga0075366_10002542 Ga0075366_100025427 151
179 3300009011 Ga0105251_10055251 Ga0105251_100552512 151
180 3300009036 Ga0105244_10000094 Ga0105244_100000947 151
181 3300009092 Ga0105250_10019990 Ga0105250_100199902 151
182 3300009093 Ga0105240_10092248 Ga0105240_100922482 151
183 3300009093 Ga0105240_10433561 Ga0105240_104335612 151
184 3300009094 Ga0111539_10515722 Ga0111539_105157222 151
185 3300009174 Ga0105241_11032962 Ga0105241_110329622 151
186 3300009177 Ga0105248_10643414 Ga0105248_106434142 151
187 3300009553 Ga0105249_10495047 Ga0105249_104950473 151
188 3300013105 Ga0157369_10093150 Ga0157369_100931502 151
189 3300013306 Ga0163162_10023889 Ga0163162_100238896 151
190 3300013306 Ga0163162_10105977 Ga0163162_101059772 151
191 3300013308 Ga0157375_10105631 Ga0157375_101056313 151
192 3300014326 Ga0157380_10308846 Ga0157380_103088462 151
193 3300017792 Ga0163161_10419863 Ga0163161_104198632 151
194 3300025226 Ga0209674_100025 Ga0209674_100025375 151
195 3300025228 Ga0209672_100002 Ga0209672_1000021267 151
196 3300025229 Ga0209147_100003 Ga0209147_1000031267 151
197 3300025231 Ga0207427_101164 Ga0207427_1011643 151
198 3300025242 Ga0209258_100005 Ga0209258_100005908 151
199 3300025254 Ga0209148_1000006 Ga0209148_10000061267 151
200 3300025256 Ga0209759_1000014 Ga0209759_100001480 151
201 3300025256 Ga0209759_1000097 Ga0209759_100009785 151
202 3300025261 Ga0209233_1000018 Ga0209233_100001879 151
203 3300025272 Ga0209455_1000003 Ga0209455_10000031267 151
204 3300025284 Ga0209130_1001878 Ga0209130_10018789 151
205 3300025302 Ga0207426_1000107 Ga0207426_1000107184 151
206 3300025728 Ga0207655_1000102 Ga0207655_100010237 151
207 3300025735 Ga0207713_1142506 Ga0207713_11425062 151
208 3300025899 Ga0207642_10574596 Ga0207642_105745961 151
209 3300025901 Ga0207688_10484916 Ga0207688_104849162 151
210 3300025903 Ga0207680_10243484 Ga0207680_102434842 151
211 3300025913 Ga0207695_10317728 Ga0207695_103177282 151
212 3300025941 Ga0207711_10653164 Ga0207711_106531642 151
213 3300025961 Ga0207712_10121160 Ga0207712_101211603 151
214 3300025986 Ga0207658_10332451 Ga0207658_103324512 151
215 3300026035 Ga0207703_10343426 Ga0207703_103434262 151
216 3300026075 Ga0207708_10567699 Ga0207708_105676991 151
217 3300026089 Ga0207648_10127274 Ga0207648_101272744 151
218 3300026118 Ga0207675_101086342 Ga0207675_1010863422 151
219 3300028380 Ga0268265_11089879 Ga0268265_110898792 151
220 3300028381 Ga0268264_11089372 Ga0268264_110893722 151
221 3300030731 Ga0316177_1220166 Ga0316177_12201664 151
222 3300030733 Ga0314311_1023036 Ga0314311_10230363 151
223 3300030734 Ga0316179_1110809 Ga0316179_11108093 151
224 3300030735 Ga0316178_1007908 Ga0316178_10079082 151
225 3300030736 Ga0316180_1019296 Ga0316180_10192965 151
226 3300030742 Ga0316183_1126188 Ga0316183_11261889 151
227 3300030744 Ga0316181_1028270 Ga0316181_10282707 151
228 3300031507 Ga0307509_10002259 Ga0307509_1000225920 151
229 3300031507 Ga0307509_10214908 Ga0307509_102149082 151
230 3300031548 Ga0307408_100086649 Ga0307408_1000866493 151
231 3300031548 Ga0307408_100539998 Ga0307408_1005399982 151
232 3300031616 Ga0307508_10221059 Ga0307508_102210592 151
233 3300031824 Ga0307413_10778313 Ga0307413_107783131 151
234 3300031852 Ga0307410_10229702 Ga0307410_102297022 151
235 3300031901 Ga0307406_10036472 Ga0307406_100364723 151
236 3300031901 Ga0307406_10645630 Ga0307406_106456302 151
237 3300031901 Ga0307406_10966247 Ga0307406_109662472 151
238 3300031911 Ga0307412_10146077 Ga0307412_101460772 151
239 3300032002 Ga0307416_100581190 Ga0307416_1005811902 151
240 3300032005 Ga0307411_10286149 Ga0307411_102861492 151
241 3300033179 Ga0307507_10177338 Ga0307507_101773383 151
242 3300035118 Ga0373954_0089012 Ga0373954_0089012_443_901 151
243 3300035121 Ga0373960_0397618 Ga0373960_0397618_56_520 151
244 3300042006 Ga0439432_018008 Ga0439432_018008_1125_1580 151
245 3300042007 Ga0439449_0062613 Ga0439449_0062613_613_1071 151
246 3300042133 Ga0450896_070670 Ga0450896_070670_53_520 151
247 3300046454 Ga0495592_0007194 Ga0495592_0007194_3437_3892 151
248 3300046454 Ga0495592_0081823 Ga0495592_0081823_72_527 151
249 3300046454 Ga0495592_0262110 Ga0495592_0262110_169_624 151
250 3300046455 Ga0495603_0008340 Ga0495603_0008340_1823_2281 151
251 3300046455 Ga0495603_0045547 Ga0495603_0045547_405_860 151
252 3300046455 Ga0495603_0562981 Ga0495603_0562981_155_610 151
253 3300046457 Ga0495590_0004527 Ga0495590_0004527_2942_3397 151
254 3300046457 Ga0495590_0032943 Ga0495590_0032943_332_787 151
255 3300046457 Ga0495590_0203122 Ga0495590_0203122_33_491 151
256 3300046458 Ga0495591_002431 Ga0495591_002431_107_562 151
257 3300046459 Ga0495629_0000033 Ga0495629_0000033_113153_113608 151
258 3300046459 Ga0495629_0002913 Ga0495629_0002913_139_597 151
259 3300046459 Ga0495629_0002962 Ga0495629_0002962_1710_2165 151
260 3300046459 Ga0495629_0041455 Ga0495629_0041455_921_1376 151
261 3300046460 Ga0495638_0002449 Ga0495638_0002449_2112_2570 151
262 3300046460 Ga0495638_0028742 Ga0495638_0028742_641_1096 151
263 3300046461 Ga0495641_0007361 Ga0495641_0007361_2032_2487 151
264 3300046461 Ga0495641_0133010 Ga0495641_0133010_597_1052 151
265 3300046462 Ga0495651_0036169 Ga0495651_0036169_2083_2538 151
266 3300046462 Ga0495651_0990959 Ga0495651_0990959_18_476 151
267 3300046463 Ga0495653_0002745 Ga0495653_0002745_6500_6955 151
268 3300046463 Ga0495653_0010676 Ga0495653_0010676_2482_2937 151
269 3300046463 Ga0495653_0028378 Ga0495653_0028378_1080_1625 151
270 3300046463 Ga0495653_0261390 Ga0495653_0261390_555_1010 151
271 3300046463 Ga0495653_0381763 Ga0495653_0381763_264_719 151
272 3300046471 Ga0495650_0000785 Ga0495650_0000785_6742_7200 151
273 3300046471 Ga0495650_0001794 Ga0495650_0001794_17435_17890 151
274 3300046471 Ga0495650_0032857 Ga0495650_0032857_414_959 151
275 3300046471 Ga0495650_0048218 Ga0495650_0048218_702_1160 151
276 3300046472 Ga0495580_0000064 Ga0495580_0000064_45030_45521 151
277 3300046472 Ga0495580_0002321 Ga0495580_0002321_12427_12885 151
278 3300046472 Ga0495580_0007956 Ga0495580_0007956_2708_3163 151
279 3300046472 Ga0495580_0013020 Ga0495580_0013020_4016_4471 151
280 3300046472 Ga0495580_0130360 Ga0495580_0130360_565_1023 151
281 3300046473 Ga0495582_0004182 Ga0495582_0004182_4777_5232 151
282 3300046473 Ga0495582_0015611 Ga0495582_0015611_3687_4142 151
283 3300046473 Ga0495582_0186268 Ga0495582_0186268_542_997 151
284 3300046474 Ga0495605_0001183 Ga0495605_0001183_6811_7269 151
285 3300046474 Ga0495605_0014805 Ga0495605_0014805_1991_2446 151
286 3300046474 Ga0495605_0150807 Ga0495605_0150807_555_1013 151
287 3300046475 Ga0495639_0019722 Ga0495639_0019722_1918_2376 151
288 3300046476 Ga0495662_0034968 Ga0495662_0034968_615_1160 151
289 3300046476 Ga0495662_0182116 Ga0495662_0182116_550_1008 151
290 3300046476 Ga0495662_0482073 Ga0495662_0482073_23_478 151
291 3300046477 Ga0495664_0005785 Ga0495664_0005785_4536_4991 151
292 3300046477 Ga0495664_0010364 Ga0495664_0010364_2819_3274 151
293 3300046477 Ga0495664_0233976 Ga0495664_0233976_636_1091 151
294 3300046477 Ga0495664_0263770 Ga0495664_0263770_531_986 151
295 3300046477 Ga0495664_0270192 Ga0495664_0270192_85_543 151
296 3300046492 Ga0495585_0075327 Ga0495585_0075327_129_587 151
297 3300046500 Ga0495596_0022045 Ga0495596_0022045_942_1397 151
298 3300046500 Ga0495596_0238388 Ga0495596_0238388_89_547 151
299 3300046501 Ga0495607_0190399 Ga0495607_0190399_342_800 151
300 3300046506 Ga0495583_0009947 Ga0495583_0009947_72_527 151
301 3300046506 Ga0495583_0015485 Ga0495583_0015485_3407_3865 151
302 3300046507 Ga0495606_0016896 Ga0495606_0016896_3881_4336 151
303 3300046507 Ga0495606_0132205 Ga0495606_0132205_519_974 151
304 3300046511 Ga0495608_0001973 Ga0495608_0001973_8781_9236 151
305 3300046511 Ga0495608_0023136 Ga0495608_0023136_1741_2196 151
306 3300046511 Ga0495608_0235485 Ga0495608_0235485_27_485 151
307 3300046513 Ga0495616_0021845 Ga0495616_0021845_2539_2997 151
308 3300046513 Ga0495616_0376688 Ga0495616_0376688_33_491 151
309 3300046514 Ga0495618_0019493 Ga0495618_0019493_1288_1743 151
310 3300046514 Ga0495618_0078422 Ga0495618_0078422_1435_1890 151
311 3300046514 Ga0495618_0103335 Ga0495618_0103335_439_894 151
312 3300046515 Ga0495620_0025697 Ga0495620_0025697_2263_2718 151
313 3300046516 Ga0495628_0013244 Ga0495628_0013244_5056_5511 151
314 3300046516 Ga0495628_0048566 Ga0495628_0048566_421_876 151
315 3300046516 Ga0495628_0218587 Ga0495628_0218587_505_960 151
316 3300046517 Ga0495630_0005756 Ga0495630_0005756_1258_1713 151
317 3300046517 Ga0495630_0033417 Ga0495630_0033417_3048_3503 151
318 3300046517 Ga0495630_0055291 Ga0495630_0055291_1460_1915 151
319 3300046522 Ga0495643_0373413 Ga0495643_0373413_162_617 151
320 3300046523 Ga0495644_0008851 Ga0495644_0008851_633_1091 151
321 3300046524 Ga0495648_0020295 Ga0495648_0020295_1418_1876 151
322 3300046524 Ga0495648_0040348 Ga0495648_0040348_290_745 151
323 3300046524 Ga0495648_0055017 Ga0495648_0055017_48_503 151
324 3300046526 Ga0495666_0000290 Ga0495666_0000290_11683_12138 151
325 3300046526 Ga0495666_0010977 Ga0495666_0010977_786_1241 151
326 3300046526 Ga0495666_0078448 Ga0495666_0078448_973_1428 151
327 3300046528 Ga0495642_0008003 Ga0495642_0008003_1255_1713 151
328 3300046528 Ga0495642_0015125 Ga0495642_0015125_2377_2835 151
329 3300046528 Ga0495642_0028690 Ga0495642_0028690_588_1043 151
330 3300046528 Ga0495642_0071106 Ga0495642_0071106_516_974 151
331 3300046528 Ga0495642_0255602 Ga0495642_0255602_38_493 151
332 3300046529 Ga0495652_0013882 Ga0495652_0013882_1801_2256 151
333 3300046529 Ga0495652_0059323 Ga0495652_0059323_2062_2517 151
334 3300046529 Ga0495652_0465102 Ga0495652_0465102_170_625 151
335 3300046530 Ga0495654_0035519 Ga0495654_0035519_557_1015 151
336 3300046530 Ga0495654_0134461 Ga0495654_0134461_121_579 151
337 3300046531 Ga0495665_0005619 Ga0495665_0005619_1713_2168 151
338 3300046531 Ga0495665_0121094 Ga0495665_0121094_365_820 151
339 3300046531 Ga0495665_0140103 Ga0495665_0140103_739_1197 151
340 3300046531 Ga0495665_0164280 Ga0495665_0164280_584_1039 151
341 3300046533 Ga0495640_0002924 Ga0495640_0002924_13032_13487 151
342 3300046536 Ga0495587_0018063 Ga0495587_0018063_219_674 151
343 3300046536 Ga0495587_0154950 Ga0495587_0154950_329_784 151
344 3300046542 Ga0495597_0179382 Ga0495597_0179382_41_499 151
345 3300046543 Ga0495645_0000208 Ga0495645_0000208_4751_5209 151
346 3300046543 Ga0495645_0019038 Ga0495645_0019038_2934_3389 151
347 3300046557 Ga0495622_0000083 Ga0495622_0000083_81981_82436 151
348 3300046557 Ga0495622_0005342 Ga0495622_0005342_5166_5624 151
349 3300046559 Ga0495667_0071096 Ga0495667_0071096_94_639 151
350 3300046615 Ga0495656_0125030 Ga0495656_0125030_168_626 151
351 3300046616 Ga0495668_0154900 Ga0495668_0154900_741_1199 151
352 3300046642 Ga0495634_0010313 Ga0495634_0010313_1128_1583 151
353 3300046642 Ga0495634_0020294 Ga0495634_0020294_4090_4545 151
354 3300046642 Ga0495634_0246087 Ga0495634_0246087_454_912 151
355 3300046648 Ga0495611_0035867 Ga0495611_0035867_1702_2157 151
356 3300046663 Ga0495635_0000843 Ga0495635_0000843_19039_19494 151
357 3300046665 Ga0495661_0007832 Ga0495661_0007832_1894_2349 151
358 3300046665 Ga0495661_0022431 Ga0495661_0022431_1968_2423 151
359 3300046674 Ga0495588_0078368 Ga0495588_0078368_144_602 151
360 3300046674 Ga0495588_0552358 Ga0495588_0552358_94_552 151
361 3300046675 Ga0495657_0007089 Ga0495657_0007089_2514_2969 151
362 3300046679 Ga0495623_0149630 Ga0495623_0149630_442_933 151
363 3300046679 Ga0495623_0252910 Ga0495623_0252910_318_776 151
364 3300046679 Ga0495623_0347567 Ga0495623_0347567_264_719 151
365 3300046680 Ga0495646_0039916 Ga0495646_0039916_197_652 151
366 3300046680 Ga0495646_0049138 Ga0495646_0049138_1433_1888 151
367 3300046680 Ga0495646_0079274 Ga0495646_0079274_1199_1654 151
368 3300046684 Ga0495669_0011884 Ga0495669_0011884_964_1422 151
369 3300046684 Ga0495669_0041729 Ga0495669_0041729_149_607 151
370 3300046689 Ga0495613_0013682 Ga0495613_0013682_822_1280 151
371 3300046689 Ga0495613_0013806 Ga0495613_0013806_5516_5971 151
372 3300046690 Ga0495624_0082916 Ga0495624_0082916_524_979 151
373 3300046690 Ga0495624_0244635 Ga0495624_0244635_299_754 151
374 3300046690 Ga0495624_0794364 Ga0495624_0794364_84_539 151
375 3300046691 Ga0495670_0003558 Ga0495670_0003558_4141_4599 151
376 3300046691 Ga0495670_0577929 Ga0495670_0577929_143_601 151
377 3300046692 Ga0495671_0014268 Ga0495671_0014268_2151_2606 151
378 3300046694 Ga0495649_0012813 Ga0495649_0012813_300_758 151
379 3300046694 Ga0495649_0017166 Ga0495649_0017166_901_1356 151
380 3300046794 Ga0495589_0017667 Ga0495589_0017667_2524_2982 151
381 3300046794 Ga0495589_0031608 Ga0495589_0031608_2049_2504 151
382 3300046794 Ga0495589_0062806 Ga0495589_0062806_1122_1580 151
383 3300046794 Ga0495589_0151639 Ga0495589_0151639_631_1086 151
384 3300046809 Ga0495600_0002998 Ga0495600_0002998_7777_8232 151
385 3300046809 Ga0495600_0097042 Ga0495600_0097042_1006_1464 151
386 3300046809 Ga0495600_0410814 Ga0495600_0410814_114_569 151
387 3300046810 Ga0495660_0041193 Ga0495660_0041193_362_820 151
388 3300046810 Ga0495660_0083802 Ga0495660_0083802_893_1348 151
389 3300046810 Ga0495660_0165989 Ga0495660_0165989_298_756 151
390 3300046810 Ga0495660_0176253 Ga0495660_0176253_483_938 151
391 3300046810 Ga0495660_0205646 Ga0495660_0205646_402_860 151
392 3300047315 Ga0495581_0000660 Ga0495581_0000660_16236_16781 151
393 3300047315 Ga0495581_0010491 Ga0495581_0010491_958_1416 151
394 3300047315 Ga0495581_0464436 Ga0495581_0464436_20_475 151
395 3300047317 Ga0495604_0027776 Ga0495604_0027776_3790_4281 151
396 3300047317 Ga0495604_0088171 Ga0495604_0088171_264_719 151
397 3300047317 Ga0495604_0117254 Ga0495604_0117254_334_789 151
398 3300047317 Ga0495604_0728169 Ga0495604_0728169_63_518 151
399 3300047319 Ga0495674_0016689 Ga0495674_0016689_3347_3805 151
400 3300047319 Ga0495674_0142563 Ga0495674_0142563_222_677 151
401 3300047319 Ga0495674_0311988 Ga0495674_0311988_91_549 151
402 3300047321 Ga0495676_0003137 Ga0495676_0003137_13659_14114 151
403 3300047321 Ga0495676_0008300 Ga0495676_0008300_6821_7276 151
404 3300047321 Ga0495676_0068239 Ga0495676_0068239_1721_2176 151
405 3300047321 Ga0495676_0075024 Ga0495676_0075024_868_1323 151
406 3300047321 Ga0495676_0322748 Ga0495676_0322748_42_500 151
407 3300047322 Ga0495680_0035516 Ga0495680_0035516_36_491 151
408 3300047322 Ga0495680_0319260 Ga0495680_0319260_553_1008 151
409 3300047323 Ga0495683_0000990 Ga0495683_0000990_13253_13708 151
410 3300047323 Ga0495683_0014050 Ga0495683_0014050_1556_2011 151
411 3300047323 Ga0495683_0060843 Ga0495683_0060843_956_1414 151
412 3300047443 Ga0495687_041455 Ga0495687_041455_515_973 151
413 3300047443 Ga0495687_059386 Ga0495687_059386_349_807 151
414 3300047443 Ga0495687_156840 Ga0495687_156840_53_508 151
415 3300047444 Ga0495675_0008492 Ga0495675_0008492_4967_5422 151
416 3300047444 Ga0495675_0009702 Ga0495675_0009702_4976_5431 151
417 3300047444 Ga0495675_0116284 Ga0495675_0116284_471_926 151
418 3300047444 Ga0495675_0359540 Ga0495675_0359540_68_526 151
419 3300047446 Ga0495679_000030 Ga0495679_000030_6095_6550 151
420 3300047446 Ga0495679_005432 Ga0495679_005432_631_1086 151
421 3300047446 Ga0495679_082878 Ga0495679_082878_27_485 151
422 3300047446 Ga0495679_113302 Ga0495679_113302_105_563 151
423 3300047470 Ga0495681_0018795 Ga0495681_0018795_1705_2163 151
424 3300047471 Ga0495684_0277556 Ga0495684_0277556_27_482 151
425 3300047472 Ga0495686_0005992 Ga0495686_0005992_2178_2633 151
426 3300047472 Ga0495686_0295405 Ga0495686_0295405_370_843 151
427 3300047673 Ga0495593_0005659 Ga0495593_0005659_553_1008 151
428 3300047673 Ga0495593_0034814 Ga0495593_0034814_1040_1498 151
429 3300047673 Ga0495593_0053275 Ga0495593_0053275_216_671 151
430 3300048088 Ga0495602_0030006 Ga0495602_0030006_3787_4242 151
431 3300048088 Ga0495602_0051819 Ga0495602_0051819_1537_1992 151
432 3300048088 Ga0495602_0078583 Ga0495602_0078583_334_789 151
433 3300048089 Ga0495614_0003466 Ga0495614_0003466_20_475 151
434 3300048089 Ga0495614_0061673 Ga0495614_0061673_819_1274 151
435 3300048903 Ga0496100_0004365 Ga0496100_0004365_4481_4939 151
436 3300048903 Ga0496100_0066500 Ga0496100_0066500_697_1155 151
437 3300048903 Ga0496100_0073049 Ga0496100_0073049_243_701 151
438 3300048903 Ga0496100_0125604 Ga0496100_0125604_955_1413 151
439 3300048904 Ga0496101_0000266 Ga0496101_0000266_4481_4939 151
440 3300048904 Ga0496101_0006414 Ga0496101_0006414_2015_2473 151
441 3300048904 Ga0496101_0022118 Ga0496101_0022118_998_1456 151
442 3300048905 Ga0496102_0000616 Ga0496102_0000616_4481_4939 151
443 3300048905 Ga0496102_0024652 Ga0496102_0024652_2338_2793 151
444 3300048905 Ga0496102_0070229 Ga0496102_0070229_1320_1778 151
445 3300048905 Ga0496102_0527564 Ga0496102_0527564_346_801 151
446 3300048905 Ga0496102_1552221 Ga0496102_1552221_75_533 151
447 3300048906 Ga0496103_0009303 Ga0496103_0009303_884_1342 151
448 3300048906 Ga0496103_0012904 Ga0496103_0012904_2412_2867 151
449 3300048906 Ga0496103_0085226 Ga0496103_0085226_168_623 151
450 3300048906 Ga0496103_0271007 Ga0496103_0271007_596_1054 151
451 3300048907 Ga0496104_0047552 Ga0496104_0047552_1069_1527 151
452 3300048908 Ga0496105_0387200 Ga0496105_0387200_463_921 151
453 3300048909 Ga0496106_0112534 Ga0496106_0112534_129_587 151
454 3300048910 Ga0496107_0093766 Ga0496107_0093766_630_1088 151
455 3300048910 Ga0496107_0103668 Ga0496107_0103668_17_475 151
456 3300048912 Ga0496109_0723392 Ga0496109_0723392_412_870 151
457 3300048915 Ga0496112_0509496 Ga0496112_0509496_74_532 151
458 3300048916 Ga0496113_0012766 Ga0496113_0012766_2660_3118 151
459 3300048916 Ga0496113_0338165 Ga0496113_0338165_11_469 151
460 3300048917 Ga0496114_0000601 Ga0496114_0000601_55_513 151
461 3300048917 Ga0496114_0385440 Ga0496114_0385440_117_575 151
462 3300048917 Ga0496114_1147805 Ga0496114_1147805_154_612 151
463 3300048918 Ga0496115_0157475 Ga0496115_0157475_356_814 151
464 3300048920 Ga0496117_0001912 Ga0496117_0001912_6183_6638 151
465 3300048920 Ga0496117_0004118 Ga0496117_0004118_13409_13867 151
466 3300048920 Ga0496117_0081532 Ga0496117_0081532_198_653 151
467 3300048921 Ga0496118_0001357 Ga0496118_0001357_4481_4939 151
468 3300048921 Ga0496118_0003214 Ga0496118_0003214_10210_10665 151
469 3300048921 Ga0496118_0010328 Ga0496118_0010328_7307_7762 151
470 3300048921 Ga0496118_0078347 Ga0496118_0078347_221_679 151
471 3300048922 Ga0496119_0035981 Ga0496119_0035981_2485_2943 151
472 3300048923 Ga0496120_0044942 Ga0496120_0044942_1202_1660 151
473 3300048924 Ga0496121_0011987 Ga0496121_0011987_98_553 151
474 3300048924 Ga0496121_0029689 Ga0496121_0029689_4531_4989 151
475 3300048924 Ga0496121_0185466 Ga0496121_0185466_317_775 151
476 3300048924 Ga0496121_0825334 Ga0496121_0825334_49_504 151
477 3300048925 Ga0496122_0412037 Ga0496122_0412037_205_663 151
478 3300048926 Ga0496123_0113976 Ga0496123_0113976_638_1096 151
479 3300048927 Ga0496124_0006679 Ga0496124_0006679_6361_6816 151
480 3300048929 Ga0496126_0000724 Ga0496126_0000724_43004_43459 151
481 3300048929 Ga0496126_0389370 Ga0496126_0389370_437_895 151
482 3300049459 Ga0495678_054988 Ga0495678_054988_704_1159 151
483 3300049459 Ga0495678_081293 Ga0495678_081293_634_1089 151
484 3300049459 Ga0495678_125931 Ga0495678_125931_295_753 151
485 3300049460 Ga0495682_0163501 Ga0495682_0163501_88_543 151
486 3300049679 Ga0501249_000918 Ga0501249_000918_4352_4810 151
487 3300050493 nmdc:mga0k408_22704_c1 nmdc:mga0k408_22704_c1_1928_2392 151
488 3300050493 nmdc:mga0k408_6742_c1 nmdc:mga0k408_6742_c1_1168_1629 151
489 3300053080 Ga0500635_0003593 Ga0500635_0003593_831_1289 151
490 3300053094 Ga0500566_0004937 Ga0500566_0004937_4805_5263 151
491 3300053138 Ga0500564_064907 Ga0500564_064907_1171_1629 151
492 3300053163 Ga0500639_223122 Ga0500639_223122_309_767 151
493 3300053178 Ga0500637_0008329 Ga0500637_0008329_3131_3610 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

4

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9848 4 142
4ckx-assembly1.cif.gz_A structure of the mycobacterium tuberculosis type ii dehydroquinase n12s mutant (crystal form 2) 0.9844 4 142
4kiu-assembly2.cif.gz_M design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] 0.9837 4 142
4kiw-assembly2.cif.gz_Q design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] 0.9832 4 142
3n7a-assembly2.cif.gz_X crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 2 0.9829 4 142
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9837 4 142 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9682 5 145 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9623 4 142 3.40.50.9100
4ckwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9493 4 142 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9447 4 140 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A2V2AE28-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9982 1 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A5E7STK5-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.998 1 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A841BYA1-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9914 4 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A8LY09-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9913 4 142 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A6N7FYN1-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9909 4 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Feature Viewer

pLDDT pTM Quality
94.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map