F454342

General Info

Members Datasets Scaffolds Average Seq Length
492 302 984 150

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_245267_c1|nmdc:mga0n895_245267_c1_87_629
Length 180
Sequence VLCASHPGTFQEAETQTTSAFAKTKDQEEIIMPKEQENKAIVGRWFTHFWGKTCNLGIVDEIAAPDMLLQYSLHEPRRGRDDIKSFMTDFRKAFPDLNFWGTADLLAEGDYVVGRWEGGGTHTGPAFADFLVGSLPAATGRKMHFTGTTVLKLVDGKIVEEVGLDDGVTALTQLGLLKKA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
242 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
254 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
255 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
256 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
257 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
258 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
259 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
260 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
261 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
262 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
263 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
264 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
265 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
266 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
267 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
268 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
269 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
270 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
271 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
272 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
273 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
274 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
275 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
276 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
277 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
278 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
279 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
280 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
281 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
282 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
283 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
284 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
285 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
286 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
287 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
288 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
289 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
290 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
291 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
292 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
293 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
294 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
295 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
296 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
297 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
298 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
299 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
300 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
301 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
302 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.23
Metatranscriptomes 0.81
Isolates 9.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.88
Nodule 9.35
Rhizoplane 0.81
Rhizosphere 79.07
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_245267_c1 3300050512 Bacteria 1818
2 JGI25406J46586_10074601 3300003203 Bacteria 1055
3 rootH1_10237187 3300003323 Bacteria 4121
4 Ga0070683_100172754 3300005329 Bacteria 2051
5 Ga0070670_100056881 3300005331 Bacteria 3358
6 Ga0068869_100863522 3300005334 Bacteria 781
7 Ga0068869_101117282 3300005334 Bacteria 690
8 Ga0070666_10219935 3300005335 Bacteria 1339
9 Ga0070666_10874445 3300005335 Bacteria 664
10 Ga0070680_100092925 3300005336 Bacteria 2499
11 Ga0070680_100161056 3300005336 Bacteria 1886
12 Ga0068868_100639795 3300005338 Bacteria 946
13 Ga0070660_100049739 3300005339 Bacteria 3223
14 Ga0070660_100603253 3300005339 Bacteria 918
15 Ga0070687_100575313 3300005343 Bacteria 770
16 Ga0070661_100027992 3300005344 Bacteria 4062
17 Ga0070668_101627642 3300005347 Bacteria 592
18 Ga0070673_100626630 3300005364 Bacteria 983
19 Ga0070659_100020623 3300005366 Bacteria 5010
20 Ga0070667_100092528 3300005367 Bacteria 2602
21 Ga0070667_100415997 3300005367 Bacteria 1225
22 Ga0070709_10008142 3300005434 Bacteria 5754
23 Ga0070709_10158107 3300005434 Bacteria 1573
24 Ga0070709_10347627 3300005434 Bacteria 1095
25 Ga0070714_100017088 3300005435 Bacteria 5873
26 Ga0070714_100289105 3300005435 Bacteria 1525
27 Ga0070714_100686071 3300005435 Bacteria 988
28 Ga0070714_100756677 3300005435 Bacteria 939
29 Ga0070713_100018144 3300005436 Bacteria 5347
30 Ga0070713_100170436 3300005436 Bacteria 1950
31 Ga0070713_100629741 3300005436 Bacteria 1020
32 Ga0070713_101108421 3300005436 Bacteria 765
33 Ga0070710_10006461 3300005437 Bacteria 5634
34 Ga0070710_10082104 3300005437 Unclassified 1884
35 Ga0070710_10596908 3300005437 Bacteria 768
36 Ga0070711_100018637 3300005439 Bacteria 4435
37 Ga0070711_100073248 3300005439 Unclassified 2419
38 Ga0070705_100517751 3300005440 Bacteria 909
39 Ga0070705_100831626 3300005440 Bacteria 737
40 Ga0070700_100488333 3300005441 Bacteria 945
41 Ga0070694_100704587 3300005444 Bacteria 821
42 Ga0070694_100789224 3300005444 Bacteria 778
43 Ga0070694_101646513 3300005444 Bacteria 545
44 Ga0070708_100013127 3300005445 Bacteria 6778
45 Ga0070708_100027107 3300005445 Bacteria 4912
46 Ga0070708_100191581 3300005445 Bacteria 1912
47 Ga0070708_100300748 3300005445 Unclassified 1511
48 Ga0070681_10171105 3300005458 Bacteria 2094
49 Ga0070681_10453218 3300005458 Bacteria 1195
50 Ga0070706_100095842 3300005467 Bacteria 2754
51 Ga0070706_100318990 3300005467 Unclassified 1449
52 Ga0070706_100355701 3300005467 Bacteria 1365
53 Ga0070706_100577136 3300005467 Bacteria 1045
54 Ga0070707_100002406 3300005468 Bacteria 17853
55 Ga0070707_100037408 3300005468 Bacteria 4631
56 Ga0070707_101064479 3300005468 Bacteria 774
57 Ga0070698_100087328 3300005471 Bacteria 3105
58 Ga0070698_100096312 3300005471 Unclassified 2936
59 Ga0070698_100230026 3300005471 Bacteria 1787
60 Ga0070698_100874040 3300005471 Bacteria 844
61 Ga0070699_100630085 3300005518 Unclassified 978
62 Ga0070679_100022805 3300005530 Bacteria 6122
63 Ga0070679_100065928 3300005530 Bacteria 3609
64 Ga0070684_100001255 3300005535 Bacteria 18199
65 Ga0070684_100088240 3300005535 Bacteria 2755
66 Ga0070684_100531185 3300005535 Bacteria 1091
67 Ga0070697_100101643 3300005536 Unclassified 2388
68 Ga0070697_100464652 3300005536 Bacteria 1103
69 Ga0070697_100521016 3300005536 Bacteria 1041
70 Ga0070697_101179277 3300005536 Bacteria 682
71 Ga0068853_100367983 3300005539 Bacteria 1341
72 Ga0070672_100870589 3300005543 Bacteria 795
73 Ga0070686_100755919 3300005544 Bacteria 780
74 Ga0070665_100002495 3300005548 Bacteria 20246
75 Ga0070665_100842849 3300005548 Bacteria 930
76 Ga0070704_100420774 3300005549 Bacteria 1144
77 Ga0068855_100079516 3300005563 Bacteria 3802
78 Ga0070664_100004777 3300005564 Bacteria 10856
79 Ga0068857_100047881 3300005577 Bacteria 3796
80 Ga0068854_100040904 3300005578 Bacteria 3272
81 Ga0068854_101367835 3300005578 Bacteria 639
82 Ga0068856_100252939 3300005614 Bacteria 1777
83 Ga0070702_100953197 3300005615 Bacteria 676
84 Ga0068852_100002155 3300005616 Bacteria 13524
85 Ga0068864_100112251 3300005618 Bacteria 2429
86 Ga0068864_100694304 3300005618 Bacteria 994
87 Ga0068866_10578098 3300005718 Bacteria 755
88 Ga0068861_100444359 3300005719 Bacteria 1160
89 Ga0068861_101795390 3300005719 Bacteria 608
90 Ga0068858_100056034 3300005842 Bacteria 3644
91 Ga0068858_100211151 3300005842 Bacteria 1837
92 Ga0068860_100850249 3300005843 Bacteria 927
93 Ga0081455_10002453 3300005937 Bacteria 22084
94 Ga0081455_10705800 3300005937 Bacteria 642
95 Ga0081540_1001022 3300005983 Bacteria 25093
96 Ga0081540_1030840 3300005983 Bacteria 2961
97 Ga0081539_10014227 3300005985 Bacteria 5907
98 Ga0070717_10235271 3300006028 Bacteria 1614
99 Ga0070717_10441596 3300006028 Bacteria 1172
100 Ga0075365_10062753 3300006038 Bacteria 2486
101 Ga0075365_10090884 3300006038 Bacteria 2079
102 Ga0075432_10038135 3300006058 Bacteria 1674
103 Ga0075432_10042543 3300006058 Unclassified 1589
104 Ga0070715_10230732 3300006163 Bacteria 957
105 Ga0070715_10320092 3300006163 Bacteria 837
106 Ga0070716_100053299 3300006173 Bacteria 2306
107 Ga0070716_100105202 3300006173 Bacteria 1738
108 Ga0070716_100709306 3300006173 Bacteria 769
109 Ga0070712_100013671 3300006175 Bacteria 5193
110 Ga0070712_100132960 3300006175 Bacteria 1888
111 Ga0070712_100396578 3300006175 Bacteria 1139
112 Ga0075362_10606529 3300006177 Bacteria 566
113 Ga0075427_10002500 3300006194 Bacteria 2471
114 Ga0075366_10415808 3300006195 Bacteria 828
115 Ga0075428_100046033 3300006844 Bacteria 4793
116 Ga0075428_100060598 3300006844 Bacteria 4144
117 Ga0075428_100125972 3300006844 Bacteria 2788
118 Ga0075428_100147109 3300006844 Bacteria 2561
119 Ga0075428_100220264 3300006844 Bacteria 2049
120 Ga0075430_100001535 3300006846 Bacteria 18851
121 Ga0075430_100056122 3300006846 Bacteria 3311
122 Ga0075430_100583202 3300006846 Bacteria 922
123 Ga0075431_100027833 3300006847 Bacteria 5801
124 Ga0075431_100053969 3300006847 Bacteria 4144
125 Ga0075431_100079957 3300006847 Bacteria 3375
126 Ga0075431_100655102 3300006847 Bacteria 1030
127 Ga0075431_100763764 3300006847 Unclassified 941
128 Ga0075431_101174357 3300006847 Bacteria 731
129 Ga0075433_10067947 3300006852 Bacteria 3128
130 Ga0075433_10137989 3300006852 Bacteria 2167
131 Ga0075433_10140597 3300006852 Bacteria 2146
132 Ga0075433_10457795 3300006852 Bacteria 1124
133 Ga0075433_11080601 3300006852 Bacteria 698
134 Ga0075434_100024388 3300006871 Bacteria 5913
135 Ga0075434_100098021 3300006871 Unclassified 2936
136 Ga0075434_100108391 3300006871 Bacteria 2788
137 Ga0075434_100122241 3300006871 Bacteria 2619
138 Ga0075434_100236380 3300006871 Bacteria 1847
139 Ga0075434_101010188 3300006871 Bacteria 846
140 Ga0075429_100005455 3300006880 Bacteria 10954
141 Ga0075429_100048955 3300006880 Bacteria 3675
142 Ga0075429_100201112 3300006880 Unclassified 1745
143 Ga0075429_100223045 3300006880 Bacteria 1651
144 Ga0068865_101221584 3300006881 Bacteria 666
145 Ga0075436_100072883 3300006914 Bacteria 2376
146 Ga0075436_100148172 3300006914 Bacteria 1650
147 Ga0075436_100228781 3300006914 Bacteria 1321
148 Ga0075435_100030288 3300007076 Bacteria 4253
149 Ga0075435_100047900 3300007076 Bacteria 3432
150 Ga0075435_100384603 3300007076 Bacteria 1206
151 Ga0075435_100724779 3300007076 Bacteria 865
152 Ga0105240_10013947 3300009093 Bacteria 11002
153 Ga0105240_10022868 3300009093 Bacteria 8282
154 Ga0105240_10179353 3300009093 Bacteria 2501
155 Ga0105240_10426053 3300009093 Bacteria 1490
156 Ga0105240_10467550 3300009093 Bacteria 1408
157 Ga0111539_10054940 3300009094 Bacteria 4735
158 Ga0111539_10092136 3300009094 Bacteria 3561
159 Ga0111539_10282742 3300009094 Bacteria 1931
160 Ga0105245_10033048 3300009098 Bacteria 4582
161 Ga0105245_10477420 3300009098 Bacteria 1259
162 Ga0114129_10000552 3300009147 Bacteria 45946
163 Ga0114129_10026728 3300009147 Bacteria 8175
164 Ga0114129_10212568 3300009147 Bacteria 2614
165 Ga0114129_10273763 3300009147 Bacteria 2258
166 Ga0114129_10553913 3300009147 Bacteria 1495
167 Ga0105243_10205027 3300009148 Bacteria 1732
168 Ga0105243_10782940 3300009148 Bacteria 938
169 Ga0105241_10072529 3300009174 Bacteria 2676
170 Ga0105241_10497453 3300009174 Bacteria 1086
171 Ga0105242_11096153 3300009176 Bacteria 810
172 Ga0105237_10050897 3300009545 Bacteria 4162
173 Ga0105237_10150336 3300009545 Bacteria 2325
174 Ga0105237_11123679 3300009545 Bacteria 792
175 Ga0105238_10000290 3300009551 Bacteria 55810
176 Ga0105238_10028602 3300009551 Bacteria 5678
177 Ga0105238_10248331 3300009551 Bacteria 1757
178 Ga0105249_11486648 3300009553 Bacteria 750
179 Ga0099796_10001374 3300010159 Bacteria 4858
180 Ga0105239_10179180 3300010375 Bacteria 2371
181 Ga0105239_11957426 3300010375 Bacteria 680
182 Ga0105239_12297600 3300010375 Bacteria 628
183 Ga0105246_10375022 3300011119 Bacteria 1174
184 Ga0105246_11632986 3300011119 Bacteria 610
185 Ga0157373_10024941 3300013100 Bacteria 4329
186 Ga0157371_10288654 3300013102 Bacteria 1186
187 Ga0157370_10296202 3300013104 Bacteria 1494
188 Ga0157369_10644625 3300013105 Bacteria 1092
189 Ga0157369_11565717 3300013105 Bacteria 670
190 Ga0157374_10096308 3300013296 Bacteria 2831
191 Ga0157374_11640545 3300013296 Bacteria 667
192 Ga0157378_11137451 3300013297 Bacteria 819
193 Ga0157378_11666677 3300013297 Bacteria 684
194 Ga0163162_10013992 3300013306 Bacteria 7843
195 Ga0163162_10129868 3300013306 Bacteria 2628
196 Ga0157372_10069030 3300013307 Bacteria 3975
197 Ga0157375_10113814 3300013308 Bacteria 2807
198 Ga0163163_10358929 3300014325 Bacteria 1514
199 Ga0163163_10547386 3300014325 Bacteria 1220
200 Ga0157377_10972026 3300014745 Bacteria 641
201 Ga0157379_10177787 3300014968 Bacteria 1922
202 Ga0157379_11138498 3300014968 Unclassified 748
203 Ga0182007_10071002 3300015262 Bacteria 1141
204 Ga0206356_10018697 3300020070 Bacteria 530
205 Ga0206354_10514694 3300020081 Bacteria 807
206 Ga0206353_11317323 3300020082 Bacteria 888
207 Ga0213873_10006755 3300021358 Bacteria 2270
208 Ga0213876_10000497 3300021384 Bacteria 30729
209 Ga0213876_10001055 3300021384 Bacteria 17806
210 Ga0213876_10059584 3300021384 Bacteria 2015
211 Ga0209758_1040274 3300025297 Bacteria 1765
212 Ga0207656_10212888 3300025321 Bacteria 937
213 Ga0207692_10010795 3300025898 Bacteria 3865
214 Ga0207692_10144748 3300025898 Unclassified 1355
215 Ga0207692_10504791 3300025898 Bacteria 768
216 Ga0207685_10010370 3300025905 Plasmid 2749
217 Ga0207685_10028352 3300025905 Bacteria 1971
218 Ga0207699_10001454 3300025906 Bacteria 11247
219 Ga0207699_10118638 3300025906 Bacteria 1707
220 Ga0207699_10387561 3300025906 Bacteria 993
221 Ga0207699_10668834 3300025906 Bacteria 759
222 Ga0207684_10282160 3300025910 Bacteria 1432
223 Ga0207684_10284013 3300025910 Unclassified 1427
224 Ga0207684_10298849 3300025910 Bacteria 1388
225 Ga0207684_10686019 3300025910 Bacteria 871
226 Ga0207654_10287076 3300025911 Bacteria 1114
227 Ga0207707_10120137 3300025912 Bacteria 2297
228 Ga0207707_10427770 3300025912 Bacteria 1134
229 Ga0207695_10111837 3300025913 Bacteria 2710
230 Ga0207695_10194392 3300025913 Bacteria 1945
231 Ga0207695_10676935 3300025913 Bacteria 912
232 Ga0207671_10114092 3300025914 Bacteria 2059
233 Ga0207671_10144495 3300025914 Bacteria 1834
234 Ga0207693_10012199 3300025915 Bacteria 6942
235 Ga0207693_10188891 3300025915 Bacteria 1622
236 Ga0207663_10298141 3300025916 Bacteria 1203
237 Ga0207660_10371997 3300025917 Bacteria 1148
238 Ga0207657_10033713 3300025919 Bacteria 4613
239 Ga0207649_10042029 3300025920 Bacteria 2786
240 Ga0207652_10110385 3300025921 Bacteria 2439
241 Ga0207652_10340241 3300025921 Bacteria 1354
242 Ga0207646_10175957 3300025922 Bacteria 1933
243 Ga0207646_10182341 3300025922 Bacteria 1896
244 Ga0207694_10004279 3300025924 Bacteria 11175
245 Ga0207694_10033065 3300025924 Bacteria 3961
246 Ga0207694_10887535 3300025924 Bacteria 754
247 Ga0207650_10041734 3300025925 Bacteria 3363
248 Ga0207687_10289153 3300025927 Bacteria 1317
249 Ga0207700_10137344 3300025928 Unclassified 2004
250 Ga0207700_10143813 3300025928 Bacteria 1963
251 Ga0207700_10265046 3300025928 Bacteria 1472
252 Ga0207700_10436110 3300025928 Bacteria 1153
253 Ga0207700_10780384 3300025928 Bacteria 854
254 Ga0207664_10014439 3300025929 Bacteria 5703
255 Ga0207664_10106243 3300025929 Bacteria 2327
256 Ga0207664_10656158 3300025929 Unclassified 943
257 Ga0207690_10101681 3300025932 Bacteria 2054
258 Ga0207690_10109094 3300025932 Bacteria 1990
259 Ga0207686_10299517 3300025934 Bacteria 1194
260 Ga0207709_10104490 3300025935 Bacteria 1880
261 Ga0207670_10618601 3300025936 Bacteria 891
262 Ga0207665_10069570 3300025939 Bacteria 2401
263 Ga0207665_10206476 3300025939 Bacteria 1433
264 Ga0207665_10253596 3300025939 Bacteria 1301
265 Ga0207689_11023581 3300025942 Bacteria 697
266 Ga0207661_10035647 3300025944 Bacteria 3879
267 Ga0207667_10049616 3300025949 Bacteria 4432
268 Ga0207651_10147291 3300025960 Bacteria 1828
269 Ga0207712_10924672 3300025961 Bacteria 772
270 Ga0207668_10637453 3300025972 Bacteria 932
271 Ga0207640_10248982 3300025981 Bacteria 1378
272 Ga0207640_10344831 3300025981 Bacteria 1194
273 Ga0207658_10225977 3300025986 Bacteria 1577
274 Ga0207703_10144171 3300026035 Bacteria 2070
275 Ga0207703_10448608 3300026035 Bacteria 1205
276 Ga0207703_10838783 3300026035 Bacteria 879
277 Ga0207703_11455623 3300026035 Bacteria 659
278 Ga0207639_10378611 3300026041 Bacteria 1270
279 Ga0207708_11072134 3300026075 Bacteria 702
280 Ga0207702_10026314 3300026078 Bacteria 4830
281 Ga0207641_11291091 3300026088 Bacteria 730
282 Ga0207676_10155484 3300026095 Bacteria 1975
283 Ga0207674_10000379 3300026116 Bacteria 57925
284 Ga0207698_10041710 3300026142 Bacteria 3422
285 Ga0207698_11959225 3300026142 Bacteria 600
286 Ga0207428_10047626 3300027907 Bacteria 3442
287 Ga0207428_10579192 3300027907 Bacteria 810
288 Ga0268266_10001667 3300028379 Bacteria 25593
289 Ga0307515_10126723 3300028794 Bacteria 2845
290 Ga0265760_10225109 3300031090 Bacteria 641
291 Ga0265339_10022907 3300031249 Bacteria 3613
292 Ga0265331_10044052 3300031250 Bacteria 2159
293 Ga0307513_10215456 3300031456 Bacteria 1747
294 Ga0307513_10392477 3300031456 Bacteria 1124
295 Ga0307509_10000008 3300031507 Bacteria 354271
296 Ga0307508_10000013 3300031616 Bacteria 242867
297 Ga0307508_10701870 3300031616 Bacteria 621
298 Ga0265314_10631084 3300031711 Bacteria 548
299 Ga0265342_10031990 3300031712 Bacteria 3247
300 Ga0307406_10044801 3300031901 Bacteria 2774
301 Ga0307406_10305525 3300031901 Bacteria 1224
302 Ga0307510_10000233 3300033180 Bacteria 49994
303 Ga0307510_10336680 3300033180 Bacteria 962
304 Ga0307510_10339055 3300033180 Bacteria 956
305 Ga0373926_0282593 3300035083 Bacteria 646
306 Ga0373944_0019077 3300035089 Bacteria 1965
307 Ga0373941_0084099 3300035115 Bacteria 1080
308 Ga0373945_0072971 3300035116 Bacteria 1302
309 Ga0373946_0027474 3300035171 Bacteria 2251
310 Ga0373927_0025832 3300035695 Bacteria 3839
311 Ga0373927_0108398 3300035695 Bacteria 1809
312 Ga0373927_0169743 3300035695 Bacteria 1430
313 Ga0373933_0619617 3300035724 Bacteria 711
314 Ga0373947_0078472 3300035725 Bacteria 2038
315 Ga0373947_0460982 3300035725 Bacteria 861
316 Ga0373937_0316900 3300036401 Bacteria 1475
317 Ga0373925_0125637 3300037068 Bacteria 1995
318 Ga0373925_0751016 3300037068 Bacteria 804
319 Ga0436364_0217096 3300037853 Bacteria 1702
320 Ga0436364_0329269 3300037853 Bacteria 891
321 Ga0436364_0722957 3300037853 Bacteria 3704
322 Ga0436365_0107859 3300039437 Bacteria 44837
323 Ga0436365_1743460 3300039437 Bacteria 12010
324 Ga0436360_0128863 3300039438 Bacteria 1783
325 Ga0436360_0649097 3300039438 Bacteria 646
326 Ga0436361_0740385 3300039447 Bacteria 767
327 Ga0436361_1161752 3300039447 Bacteria 1478
328 Ga0436363_0450881 3300039450 Bacteria 516
329 Ga0436362_0409405 3300039453 Bacteria 7366
330 Ga0436362_1278581 3300039453 Bacteria 3872
331 Ga0495629_0014099 3300046459 Bacteria 5758
332 Ga0495641_0018365 3300046461 Bacteria 3611
333 Ga0495641_0034970 3300046461 Bacteria 2372
334 Ga0495651_0404040 3300046462 Bacteria 891
335 Ga0495651_0757987 3300046462 Bacteria 601
336 Ga0495653_0215471 3300046463 Bacteria 1294
337 Ga0495650_0000027 3300046471 Bacteria 475071
338 Ga0495650_0089789 3300046471 Bacteria 1171
339 Ga0495580_0150073 3300046472 Bacteria 1615
340 Ga0495580_0319270 3300046472 Bacteria 1056
341 Ga0495580_0350893 3300046472 Bacteria 999
342 Ga0495582_0026783 3300046473 Bacteria 3160
343 Ga0495639_0003029 3300046475 Bacteria 7315
344 Ga0495664_0119022 3300046477 Bacteria 1597
345 Ga0495594_0020793 3300046499 Bacteria 3498
346 Ga0495594_0168620 3300046499 Bacteria 1245
347 Ga0495607_0175713 3300046501 Bacteria 1078
348 Ga0495610_0034554 3300046512 Bacteria 2603
349 Ga0495630_0059602 3300046517 Bacteria 2864
350 Ga0495630_0778257 3300046517 Bacteria 731
351 Ga0495652_0069644 3300046529 Bacteria 2944
352 Ga0495665_0041197 3300046531 Bacteria 2458
353 Ga0495622_0167134 3300046557 Bacteria 990
354 Ga0495622_0196877 3300046557 Bacteria 899
355 Ga0495622_0275087 3300046557 Bacteria 737
356 Ga0495633_0362356 3300046558 Bacteria 656
357 Ga0495667_0647540 3300046559 Bacteria 657
358 Ga0495656_0031535 3300046615 Bacteria 2151
359 Ga0495656_0047113 3300046615 Bacteria 1827
360 Ga0495634_0206086 3300046642 Bacteria 1219
361 Ga0495625_0015062 3300046660 Bacteria 6141
362 Ga0495635_0072689 3300046663 Bacteria 2356
363 Ga0495659_0080154 3300046664 Bacteria 1238
364 Ga0495659_0169271 3300046664 Bacteria 885
365 Ga0495588_0099737 3300046674 Bacteria 1526
366 Ga0495623_0495759 3300046679 Bacteria 645
367 Ga0495646_0152071 3300046680 Bacteria 1287
368 Ga0495647_0146873 3300046681 Bacteria 1009
369 Ga0495647_0361848 3300046681 Bacteria 662
370 Ga0495669_0165697 3300046684 Bacteria 1050
371 Ga0495669_0274700 3300046684 Bacteria 810
372 Ga0495613_0127284 3300046689 Bacteria 1826
373 Ga0495613_0262706 3300046689 Bacteria 1202
374 Ga0495613_0600246 3300046689 Bacteria 733
375 Ga0495624_0003899 3300046690 Bacteria 10990
376 Ga0495670_0464379 3300046691 Bacteria 686
377 Ga0495671_0046655 3300046692 Bacteria 2166
378 Ga0495649_0299329 3300046694 Bacteria 819
379 Ga0495581_0122186 3300047315 Bacteria 1515
380 Ga0495674_0006832 3300047319 Bacteria 10927
381 Ga0495676_0640364 3300047321 Bacteria 690
382 Ga0495680_0031868 3300047322 Bacteria 4285
383 Ga0495675_0485552 3300047444 Bacteria 711
384 Ga0495593_0039783 3300047673 Bacteria 2533
385 Ga0495602_0112910 3300048088 Bacteria 2204
386 Ga0495614_0273681 3300048089 Bacteria 776
387 Ga0496102_1856997 3300048905 Bacteria 519
388 Ga0496108_1177349 3300048911 Bacteria 649
389 Ga0496110_0018054 3300048913 Bacteria 5908
390 Ga0496112_1111182 3300048915 Bacteria 708
391 Ga0496117_0060266 3300048920 Bacteria 2617
392 Ga0496117_0073616 3300048920 Bacteria 2278
393 Ga0496118_0070792 3300048921 Bacteria 2515
394 Ga0496121_0033775 3300048924 Bacteria 4621
395 Ga0496125_0156873 3300048928 Bacteria 1553
396 Ga0496126_0006281 3300048929 Bacteria 13266
397 Ga0496126_0061201 3300048929 Bacteria 3382
398 Ga0496126_0273395 3300048929 Bacteria 1401
399 nmdc:mga03683_551436_c1 3300050489 Bacteria 561
400 nmdc:mga0yw44_46098_c1 3300050492 Bacteria 2616
401 nmdc:mga05p37_144494_c1 3300050507 Bacteria 2914
402 nmdc:mga05p37_27042_c1 3300050507 Bacteria 6983
403 nmdc:mga09592_2343_c1 3300050508 Bacteria 15286
404 nmdc:mga09592_54530_c1 3300050508 Bacteria 3378
405 nmdc:mga0qj67_269521_c1 3300050509 Bacteria 1381
406 nmdc:mga06r32_29701_c1 3300050510 Bacteria 5127
407 nmdc:mga06r32_748534_c1 3300050510 Bacteria 940
408 nmdc:mga06r32_81236_c1 3300050510 Bacteria 3157
409 nmdc:mga08y16_1263002_c1 3300050511 Bacteria 707
410 nmdc:mga08y16_75912_c1 3300050511 Bacteria 3503
411 nmdc:mga0n895_100863_c1 3300050512 Bacteria 2896
412 nmdc:mga0n895_54000_c1 3300050512 Bacteria 3950
413 nmdc:mga0rr50_162121_c1 3300050513 Bacteria 1815
414 nmdc:mga0rr50_207276_c1 3300050513 Bacteria 1614
415 nmdc:mga0rr50_402278_c1 3300050513 Bacteria 1157
416 nmdc:mga0rr50_444492_c1 3300050513 Bacteria 1099
417 nmdc:mga08x19_150810_c1 3300050514 Bacteria 1574
418 nmdc:mga08x19_196987_c1 3300050514 Bacteria 1380
419 nmdc:mga0a205_173105_c1 3300050515 Bacteria 2055
420 nmdc:mga0a205_207232_c1 3300050515 Bacteria 1850
421 nmdc:mga0a205_4282_c1 3300050515 Bacteria 12809
422 nmdc:mga0a205_602895_c1 3300050515 Bacteria 951
423 Ga0495601_0029671 3300053077 Bacteria 3394
424 Ga0495595_0058617 3300053084 Bacteria 1798
425 Ga0495619_0049623 3300053085 Bacteria 2768
426 Ga0495619_1100196 3300053085 Bacteria 529
427 Ga0500566_0187952 3300053094 Bacteria 1054
428 Ga0500555_001670 3300053103 Bacteria 6687
429 Ga0500556_0022899 3300053104 Bacteria 2034
430 Ga0500597_062409 3300053120 Bacteria 1602
431 Ga0500614_015265 3300053123 Bacteria 1711
432 Ga0500652_308451 3300053131 Bacteria 610
433 Ga0500655_076536 3300053133 Bacteria 686
434 Ga0500658_0052531 3300053134 Bacteria 1669
435 Ga0500559_0000588 3300053136 Bacteria 24803
436 Ga0500568_0029499 3300053139 Bacteria 2276
437 Ga0500577_0049752 3300053142 Bacteria 1569
438 Ga0500622_0001154 3300053156 Bacteria 21943
439 Ga0500622_0135011 3300053156 Bacteria 1182
440 Ga0500633_0158898 3300053160 Bacteria 848
441 Ga0500636_0077631 3300053177 Bacteria 1918
442 Ga0500637_0255324 3300053178 Bacteria 976
443 Ga0500609_006548 3300053731 Bacteria 1587
444 2509368024 2509276018 Bacteria 6910194
445 2511193864 2510917030 Bacteria 7460662
446 2524466662 2524023210 Bacteria 9029266
447 2644156889 2643221627 Bacteria 6761570
448 2688598254 2687453392 Bacteria 6880454
449 2856334371 2856328259 Bacteria 6528202
450 2856339229 2856334872 Bacteria 7037011
451 2857372072 2857367948 Bacteria 6965560
452 2869252559 2869249662 Bacteria 6868783
453 2869266847 2869264136 Bacteria 6880765
454 2869271589 2869271264 Bacteria 6908218
455 2871466543 2871459585 Bacteria 6866887
456 2874137317 2874131515 Bacteria 6820270
457 2874163529 2874162495 Bacteria 6174670
458 2876403534 2876399893 Bacteria 6927900
459 2876408517 2876406927 Bacteria 6191900
460 2878780635 2878774303 Bacteria 6108671
461 2878786726 2878781027 Bacteria 6834456
462 2879103728 2879099564 Bacteria 10442239
463 2906369099 2906363423 Bacteria 6856682
464 2906371036 2906370794 Bacteria 6881062
465 2906395887 2906393657 Bacteria 6790866
466 2906413738 2906408224 Bacteria 6162342
467 2922155528 2922151315 Bacteria 6902399
468 2922173787 2922172374 Bacteria 6167644
469 2922181795 2922178524 Bacteria 6025201
470 2924749912 2924748358 Bacteria 6154725
471 2958125724 2958122699 Bacteria 7280457
472 2958138303 2958137437 Bacteria 6050276
473 2958160951 2958158011 Bacteria 6058449
474 2965031948 2965025482 Bacteria 6532201
475 2965037798 2965032056 Bacteria 6887443
476 2965042105 2965040258 Bacteria 6855979
477 2965052346 2965047637 Bacteria 6623551
478 2965090927 2965089291 Bacteria 6866420
479 2965104678 2965102966 Bacteria 6800987
480 2965117277 2965110997 Bacteria 6693150
481 2970550065 2970547951 Bacteria 6931819
482 2977874671 2977872689 Bacteria 7270173
483 2977919838 2977915119 Bacteria 6829656
484 2977937754 2977935797 Bacteria 6252826
485 2977954657 2977950692 Bacteria 6893264
486 2977962197 2977957713 Bacteria 6877875
487 2987649189 2987645492 Bacteria 6117018
488 3004203017 3004195979 Bacteria 6776956
489 3004242235 3004239961 Bacteria 6892290
490 649872789 649633066 Bacteria 6690028
491 8004304023 8004300914 Bacteria 6132239
492 8004698085 8004695233 Bacteria 6731676
493 nmdc:mga0n895_245267_c1
494 JGI25406J46586_10074601
495 rootH1_10237187
496 Ga0070683_100172754
497 Ga0070670_100056881
498 Ga0068869_100863522
499 Ga0068869_101117282
500 Ga0070666_10219935
501 Ga0070666_10874445
502 Ga0070680_100092925
503 Ga0070680_100161056
504 Ga0068868_100639795
505 Ga0070660_100049739
506 Ga0070660_100603253
507 Ga0070687_100575313
508 Ga0070661_100027992
509 Ga0070668_101627642
510 Ga0070673_100626630
511 Ga0070659_100020623
512 Ga0070667_100092528
513 Ga0070667_100415997
514 Ga0070709_10008142
515 Ga0070709_10158107
516 Ga0070709_10347627
517 Ga0070714_100017088
518 Ga0070714_100289105
519 Ga0070714_100686071
520 Ga0070714_100756677
521 Ga0070713_100018144
522 Ga0070713_100170436
523 Ga0070713_100629741
524 Ga0070713_101108421
525 Ga0070710_10006461
526 Ga0070710_10082104
527 Ga0070710_10596908
528 Ga0070711_100018637
529 Ga0070711_100073248
530 Ga0070705_100517751
531 Ga0070705_100831626
532 Ga0070700_100488333
533 Ga0070694_100704587
534 Ga0070694_100789224
535 Ga0070694_101646513
536 Ga0070708_100013127
537 Ga0070708_100027107
538 Ga0070708_100191581
539 Ga0070708_100300748
540 Ga0070681_10171105
541 Ga0070681_10453218
542 Ga0070706_100095842
543 Ga0070706_100318990
544 Ga0070706_100355701
545 Ga0070706_100577136
546 Ga0070707_100002406
547 Ga0070707_100037408
548 Ga0070707_101064479
549 Ga0070698_100087328
550 Ga0070698_100096312
551 Ga0070698_100230026
552 Ga0070698_100874040
553 Ga0070699_100630085
554 Ga0070679_100022805
555 Ga0070679_100065928
556 Ga0070684_100001255
557 Ga0070684_100088240
558 Ga0070684_100531185
559 Ga0070697_100101643
560 Ga0070697_100464652
561 Ga0070697_100521016
562 Ga0070697_101179277
563 Ga0068853_100367983
564 Ga0070672_100870589
565 Ga0070686_100755919
566 Ga0070665_100002495
567 Ga0070665_100842849
568 Ga0070704_100420774
569 Ga0068855_100079516
570 Ga0070664_100004777
571 Ga0068857_100047881
572 Ga0068854_100040904
573 Ga0068854_101367835
574 Ga0068856_100252939
575 Ga0070702_100953197
576 Ga0068852_100002155
577 Ga0068864_100112251
578 Ga0068864_100694304
579 Ga0068866_10578098
580 Ga0068861_100444359
581 Ga0068861_101795390
582 Ga0068858_100056034
583 Ga0068858_100211151
584 Ga0068860_100850249
585 Ga0081455_10002453
586 Ga0081455_10705800
587 Ga0081540_1001022
588 Ga0081540_1030840
589 Ga0081539_10014227
590 Ga0070717_10235271
591 Ga0070717_10441596
592 Ga0075365_10062753
593 Ga0075365_10090884
594 Ga0075432_10038135
595 Ga0075432_10042543
596 Ga0070715_10230732
597 Ga0070715_10320092
598 Ga0070716_100053299
599 Ga0070716_100105202
600 Ga0070716_100709306
601 Ga0070712_100013671
602 Ga0070712_100132960
603 Ga0070712_100396578
604 Ga0075362_10606529
605 Ga0075427_10002500
606 Ga0075366_10415808
607 Ga0075428_100046033
608 Ga0075428_100060598
609 Ga0075428_100125972
610 Ga0075428_100147109
611 Ga0075428_100220264
612 Ga0075430_100001535
613 Ga0075430_100056122
614 Ga0075430_100583202
615 Ga0075431_100027833
616 Ga0075431_100053969
617 Ga0075431_100079957
618 Ga0075431_100655102
619 Ga0075431_100763764
620 Ga0075431_101174357
621 Ga0075433_10067947
622 Ga0075433_10137989
623 Ga0075433_10140597
624 Ga0075433_10457795
625 Ga0075433_11080601
626 Ga0075434_100024388
627 Ga0075434_100098021
628 Ga0075434_100108391
629 Ga0075434_100122241
630 Ga0075434_100236380
631 Ga0075434_101010188
632 Ga0075429_100005455
633 Ga0075429_100048955
634 Ga0075429_100201112
635 Ga0075429_100223045
636 Ga0068865_101221584
637 Ga0075436_100072883
638 Ga0075436_100148172
639 Ga0075436_100228781
640 Ga0075435_100030288
641 Ga0075435_100047900
642 Ga0075435_100384603
643 Ga0075435_100724779
644 Ga0105240_10013947
645 Ga0105240_10022868
646 Ga0105240_10179353
647 Ga0105240_10426053
648 Ga0105240_10467550
649 Ga0111539_10054940
650 Ga0111539_10092136
651 Ga0111539_10282742
652 Ga0105245_10033048
653 Ga0105245_10477420
654 Ga0114129_10000552
655 Ga0114129_10026728
656 Ga0114129_10212568
657 Ga0114129_10273763
658 Ga0114129_10553913
659 Ga0105243_10205027
660 Ga0105243_10782940
661 Ga0105241_10072529
662 Ga0105241_10497453
663 Ga0105242_11096153
664 Ga0105237_10050897
665 Ga0105237_10150336
666 Ga0105237_11123679
667 Ga0105238_10000290
668 Ga0105238_10028602
669 Ga0105238_10248331
670 Ga0105249_11486648
671 Ga0099796_10001374
672 Ga0105239_10179180
673 Ga0105239_11957426
674 Ga0105239_12297600
675 Ga0105246_10375022
676 Ga0105246_11632986
677 Ga0157373_10024941
678 Ga0157371_10288654
679 Ga0157370_10296202
680 Ga0157369_10644625
681 Ga0157369_11565717
682 Ga0157374_10096308
683 Ga0157374_11640545
684 Ga0157378_11137451
685 Ga0157378_11666677
686 Ga0163162_10013992
687 Ga0163162_10129868
688 Ga0157372_10069030
689 Ga0157375_10113814
690 Ga0163163_10358929
691 Ga0163163_10547386
692 Ga0157377_10972026
693 Ga0157379_10177787
694 Ga0157379_11138498
695 Ga0182007_10071002
696 Ga0206356_10018697
697 Ga0206354_10514694
698 Ga0206353_11317323
699 Ga0213873_10006755
700 Ga0213876_10000497
701 Ga0213876_10001055
702 Ga0213876_10059584
703 Ga0209758_1040274
704 Ga0207656_10212888
705 Ga0207692_10010795
706 Ga0207692_10144748
707 Ga0207692_10504791
708 Ga0207685_10010370
709 Ga0207685_10028352
710 Ga0207699_10001454
711 Ga0207699_10118638
712 Ga0207699_10387561
713 Ga0207699_10668834
714 Ga0207684_10282160
715 Ga0207684_10284013
716 Ga0207684_10298849
717 Ga0207684_10686019
718 Ga0207654_10287076
719 Ga0207707_10120137
720 Ga0207707_10427770
721 Ga0207695_10111837
722 Ga0207695_10194392
723 Ga0207695_10676935
724 Ga0207671_10114092
725 Ga0207671_10144495
726 Ga0207693_10012199
727 Ga0207693_10188891
728 Ga0207663_10298141
729 Ga0207660_10371997
730 Ga0207657_10033713
731 Ga0207649_10042029
732 Ga0207652_10110385
733 Ga0207652_10340241
734 Ga0207646_10175957
735 Ga0207646_10182341
736 Ga0207694_10004279
737 Ga0207694_10033065
738 Ga0207694_10887535
739 Ga0207650_10041734
740 Ga0207687_10289153
741 Ga0207700_10137344
742 Ga0207700_10143813
743 Ga0207700_10265046
744 Ga0207700_10436110
745 Ga0207700_10780384
746 Ga0207664_10014439
747 Ga0207664_10106243
748 Ga0207664_10656158
749 Ga0207690_10101681
750 Ga0207690_10109094
751 Ga0207686_10299517
752 Ga0207709_10104490
753 Ga0207670_10618601
754 Ga0207665_10069570
755 Ga0207665_10206476
756 Ga0207665_10253596
757 Ga0207689_11023581
758 Ga0207661_10035647
759 Ga0207667_10049616
760 Ga0207651_10147291
761 Ga0207712_10924672
762 Ga0207668_10637453
763 Ga0207640_10248982
764 Ga0207640_10344831
765 Ga0207658_10225977
766 Ga0207703_10144171
767 Ga0207703_10448608
768 Ga0207703_10838783
769 Ga0207703_11455623
770 Ga0207639_10378611
771 Ga0207708_11072134
772 Ga0207702_10026314
773 Ga0207641_11291091
774 Ga0207676_10155484
775 Ga0207674_10000379
776 Ga0207698_10041710
777 Ga0207698_11959225
778 Ga0207428_10047626
779 Ga0207428_10579192
780 Ga0268266_10001667
781 Ga0307515_10126723
782 Ga0265760_10225109
783 Ga0265339_10022907
784 Ga0265331_10044052
785 Ga0307513_10215456
786 Ga0307513_10392477
787 Ga0307509_10000008
788 Ga0307508_10000013
789 Ga0307508_10701870
790 Ga0265314_10631084
791 Ga0265342_10031990
792 Ga0307406_10044801
793 Ga0307406_10305525
794 Ga0307510_10000233
795 Ga0307510_10336680
796 Ga0307510_10339055
797 Ga0373926_0282593
798 Ga0373944_0019077
799 Ga0373941_0084099
800 Ga0373945_0072971
801 Ga0373946_0027474
802 Ga0373927_0025832
803 Ga0373927_0108398
804 Ga0373927_0169743
805 Ga0373933_0619617
806 Ga0373947_0078472
807 Ga0373947_0460982
808 Ga0373937_0316900
809 Ga0373925_0125637
810 Ga0373925_0751016
811 Ga0436364_0217096
812 Ga0436364_0329269
813 Ga0436364_0722957
814 Ga0436365_0107859
815 Ga0436365_1743460
816 Ga0436360_0128863
817 Ga0436360_0649097
818 Ga0436361_0740385
819 Ga0436361_1161752
820 Ga0436363_0450881
821 Ga0436362_0409405
822 Ga0436362_1278581
823 Ga0495629_0014099
824 Ga0495641_0018365
825 Ga0495641_0034970
826 Ga0495651_0404040
827 Ga0495651_0757987
828 Ga0495653_0215471
829 Ga0495650_0000027
830 Ga0495650_0089789
831 Ga0495580_0150073
832 Ga0495580_0319270
833 Ga0495580_0350893
834 Ga0495582_0026783
835 Ga0495639_0003029
836 Ga0495664_0119022
837 Ga0495594_0020793
838 Ga0495594_0168620
839 Ga0495607_0175713
840 Ga0495610_0034554
841 Ga0495630_0059602
842 Ga0495630_0778257
843 Ga0495652_0069644
844 Ga0495665_0041197
845 Ga0495622_0167134
846 Ga0495622_0196877
847 Ga0495622_0275087
848 Ga0495633_0362356
849 Ga0495667_0647540
850 Ga0495656_0031535
851 Ga0495656_0047113
852 Ga0495634_0206086
853 Ga0495625_0015062
854 Ga0495635_0072689
855 Ga0495659_0080154
856 Ga0495659_0169271
857 Ga0495588_0099737
858 Ga0495623_0495759
859 Ga0495646_0152071
860 Ga0495647_0146873
861 Ga0495647_0361848
862 Ga0495669_0165697
863 Ga0495669_0274700
864 Ga0495613_0127284
865 Ga0495613_0262706
866 Ga0495613_0600246
867 Ga0495624_0003899
868 Ga0495670_0464379
869 Ga0495671_0046655
870 Ga0495649_0299329
871 Ga0495581_0122186
872 Ga0495674_0006832
873 Ga0495676_0640364
874 Ga0495680_0031868
875 Ga0495675_0485552
876 Ga0495593_0039783
877 Ga0495602_0112910
878 Ga0495614_0273681
879 Ga0496102_1856997
880 Ga0496108_1177349
881 Ga0496110_0018054
882 Ga0496112_1111182
883 Ga0496117_0060266
884 Ga0496117_0073616
885 Ga0496118_0070792
886 Ga0496121_0033775
887 Ga0496125_0156873
888 Ga0496126_0006281
889 Ga0496126_0061201
890 Ga0496126_0273395
891 nmdc:mga03683_551436_c1
892 nmdc:mga0yw44_46098_c1
893 nmdc:mga05p37_144494_c1
894 nmdc:mga05p37_27042_c1
895 nmdc:mga09592_2343_c1
896 nmdc:mga09592_54530_c1
897 nmdc:mga0qj67_269521_c1
898 nmdc:mga06r32_29701_c1
899 nmdc:mga06r32_748534_c1
900 nmdc:mga06r32_81236_c1
901 nmdc:mga08y16_1263002_c1
902 nmdc:mga08y16_75912_c1
903 nmdc:mga0n895_100863_c1
904 nmdc:mga0n895_54000_c1
905 nmdc:mga0rr50_162121_c1
906 nmdc:mga0rr50_207276_c1
907 nmdc:mga0rr50_402278_c1
908 nmdc:mga0rr50_444492_c1
909 nmdc:mga08x19_150810_c1
910 nmdc:mga08x19_196987_c1
911 nmdc:mga0a205_173105_c1
912 nmdc:mga0a205_207232_c1
913 nmdc:mga0a205_4282_c1
914 nmdc:mga0a205_602895_c1
915 Ga0495601_0029671
916 Ga0495595_0058617
917 Ga0495619_0049623
918 Ga0495619_1100196
919 Ga0500566_0187952
920 Ga0500555_001670
921 Ga0500556_0022899
922 Ga0500597_062409
923 Ga0500614_015265
924 Ga0500652_308451
925 Ga0500655_076536
926 Ga0500658_0052531
927 Ga0500559_0000588
928 Ga0500568_0029499
929 Ga0500577_0049752
930 Ga0500622_0001154
931 Ga0500622_0135011
932 Ga0500633_0158898
933 Ga0500636_0077631
934 Ga0500637_0255324
935 Ga0500609_006548
936 2509368024
937 2511193864
938 2524466662
939 2644156889
940 2688598254
941 2856334371
942 2856339229
943 2857372072
944 2869252559
945 2869266847
946 2869271589
947 2871466543
948 2874137317
949 2874163529
950 2876403534
951 2876408517
952 2878780635
953 2878786726
954 2879103728
955 2906369099
956 2906371036
957 2906395887
958 2906413738
959 2922155528
960 2922173787
961 2922181795
962 2924749912
963 2958125724
964 2958138303
965 2958160951
966 2965031948
967 2965037798
968 2965042105
969 2965052346
970 2965090927
971 2965104678
972 2965117277
973 2970550065
974 2977874671
975 2977919838
976 2977937754
977 2977954657
978 2977962197
979 2987649189
980 3004203017
981 3004242235
982 649872789
983 8004304023
984 8004698085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

40

174

0.95

PF12680

SnoaL_2

SnoaL-like domain

42

161

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8876 2 133
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.8863 4 133
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8847 1 133
3nbr-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound 0.8827 2 133
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.8784 1 133
ID Description Score Start End Superfamily
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8717 1 133 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.868 9 133 3.10.450.50
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8661 2 142 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8546 1 142 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8465 4 134 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3S1ZT91-F1-model_v4 deleted 0.9911 1 90
AF-A0A3S1ZT91-F1-model_v4 deleted 0.9803 1 90
AF-A0A435M9M6-F1-model_v4 deleted 0.9481 1 121
AF-A0A2V9TAI3-F1-model_v4 Ester cyclase 0.9429 1 134 GO:0030638
AF-A0A435M9M6-F1-model_v4 deleted 0.9407 1 121

Map