F454185

General Info

Members Datasets Scaffolds Average Seq Length
491 260 982 149

Family's Representative Sequence

Representative Sequence 3300053154|Ga0500619_000010|Ga0500619_000010_3504_4025
Length 173
Sequence MGSIVVSKRAGPVPIFSTHQGKEFTMTARTVRLHRVLRTPPEKVYRAFLEADAMAKWLPPYGFTCTVQHLDPVVGGTFKMSFRNFSTGSSHSFGGEYLELRPNELIRYTDKFDDPHLPGVLQVTVNLKPVICGTELSVVQEGIPEAIPLEMCYLGWQESLAQLATLVEPDIPG

Samples

Sample ID Description Type Environment
1 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
249 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 2.24
Rhizosphere 94.7
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500619_000010 3300053154 Bacteria 61024
2 JGI24743J22301_10078661 3300001991 Bacteria 694
3 JGI24034J26672_10058844 3300002239 Bacteria 671
4 Ga0055540_1028700 3300003792 Bacteria 1312
5 Ga0065712_10031961 3300005290 Bacteria 1244
6 Ga0065712_10036699 3300005290 Bacteria 1311
7 Ga0070658_10057949 3300005327 Bacteria 3151
8 Ga0070658_10756413 3300005327 Bacteria 844
9 Ga0070676_10136489 3300005328 Bacteria 1557
10 Ga0070676_10321119 3300005328 Bacteria 1056
11 Ga0070676_11071691 3300005328 Bacteria 608
12 Ga0070683_100077767 3300005329 Bacteria 3103
13 Ga0070690_100000548 3300005330 Bacteria 18819
14 Ga0070690_100001949 3300005330 Bacteria 10977
15 Ga0070670_100002208 3300005331 Bacteria 15994
16 Ga0070670_100067969 3300005331 Bacteria 3058
17 Ga0070670_100077825 3300005331 Bacteria 2849
18 Ga0070670_100795606 3300005331 Bacteria 854
19 Ga0070677_10010968 3300005333 Bacteria 3113
20 Ga0070677_10028033 3300005333 Bacteria 2125
21 Ga0068869_100019215 3300005334 Bacteria 4664
22 Ga0068869_100171168 3300005334 Bacteria 1697
23 Ga0070666_10004293 3300005335 Bacteria 8674
24 Ga0070666_10009965 3300005335 Bacteria 5930
25 Ga0070666_10174882 3300005335 Bacteria 1505
26 Ga0070680_100004810 3300005336 Bacteria 10166
27 Ga0070682_100305414 3300005337 Bacteria 1169
28 Ga0068868_100002266 3300005338 Bacteria 13296
29 Ga0068868_100056192 3300005338 Bacteria 3107
30 Ga0068868_100106421 3300005338 Bacteria 2275
31 Ga0070689_100009195 3300005340 Bacteria 6994
32 Ga0070691_10045398 3300005341 Bacteria 2085
33 Ga0070687_100055499 3300005343 Bacteria 2069
34 Ga0070668_100004918 3300005347 Bacteria 9900
35 Ga0070669_100003908 3300005353 Bacteria 10784
36 Ga0070669_100229042 3300005353 Bacteria 1472
37 Ga0070675_100029782 3300005354 Bacteria 4404
38 Ga0070675_100057390 3300005354 Bacteria 3209
39 Ga0070671_100001832 3300005355 Bacteria 16175
40 Ga0070671_100146994 3300005355 Bacteria 1990
41 Ga0070674_100006090 3300005356 Bacteria 7014
42 Ga0070674_100038583 3300005356 Bacteria 3220
43 Ga0070673_100001966 3300005364 Bacteria 12395
44 Ga0070673_100116155 3300005364 Bacteria 2226
45 Ga0070673_100996358 3300005364 Bacteria 780
46 Ga0070688_100000601 3300005365 Bacteria 18010
47 Ga0070659_100034511 3300005366 Bacteria 3935
48 Ga0070659_101045711 3300005366 Bacteria 718
49 Ga0070659_101161716 3300005366 Bacteria 682
50 Ga0070667_100001219 3300005367 Bacteria 23401
51 Ga0070667_100001825 3300005367 Bacteria 18988
52 Ga0070667_100023894 3300005367 Bacteria 5075
53 Ga0070667_100128951 3300005367 Bacteria 2206
54 Ga0070709_10074942 3300005434 Bacteria 2194
55 Ga0070713_100009179 3300005436 Bacteria 7060
56 Ga0070710_10032480 3300005437 Bacteria 2828
57 Ga0070701_10048660 3300005438 Bacteria 2189
58 Ga0070701_10070062 3300005438 Bacteria 1873
59 Ga0070711_100003520 3300005439 Bacteria 9137
60 Ga0070705_100024664 3300005440 Bacteria 3250
61 Ga0070705_100480082 3300005440 Bacteria 939
62 Ga0070708_100355554 3300005445 Bacteria 1380
63 Ga0070663_100057091 3300005455 Bacteria 2799
64 Ga0070663_100110169 3300005455 Bacteria 2068
65 Ga0070663_100380797 3300005455 Bacteria 1149
66 Ga0070678_100002121 3300005456 Bacteria 10755
67 Ga0070678_100049934 3300005456 Bacteria 3022
68 Ga0070678_100052691 3300005456 Bacteria 2956
69 Ga0070678_100403129 3300005456 Bacteria 1189
70 Ga0070678_100459805 3300005456 Bacteria 1116
71 Ga0070662_100024228 3300005457 Bacteria 4179
72 Ga0070662_100974005 3300005457 Bacteria 725
73 Ga0070662_101458448 3300005457 Bacteria 590
74 Ga0070681_10102646 3300005458 Bacteria 2805
75 Ga0068867_100017304 3300005459 Bacteria 5119
76 Ga0068867_100049744 3300005459 Bacteria 3086
77 Ga0068867_100114778 3300005459 Bacteria 2074
78 Ga0070685_10001796 3300005466 Bacteria 11190
79 Ga0070707_101293475 3300005468 Bacteria 695
80 Ga0070698_100808569 3300005471 Bacteria 881
81 Ga0070679_100047331 3300005530 Bacteria 4287
82 Ga0070679_100081385 3300005530 Bacteria 3227
83 Ga0070684_100377682 3300005535 Bacteria 1305
84 Ga0068853_100108485 3300005539 Bacteria 2463
85 Ga0068853_100108821 3300005539 Unclassified 2459
86 Ga0068853_100290593 3300005539 Bacteria 1509
87 Ga0070672_100002092 3300005543 Bacteria 12581
88 Ga0070672_100008531 3300005543 Bacteria 7019
89 Ga0070672_100507157 3300005543 Bacteria 1044
90 Ga0070686_100003638 3300005544 Bacteria 8459
91 Ga0070686_100092817 3300005544 Bacteria 2022
92 Ga0070695_100820674 3300005545 Bacteria 746
93 Ga0070693_100000538 3300005547 Bacteria 16991
94 Ga0070693_100050167 3300005547 Bacteria 2384
95 Ga0070665_100028215 3300005548 Bacteria 5652
96 Ga0070665_100105225 3300005548 Bacteria 2824
97 Ga0070665_101215042 3300005548 Bacteria 764
98 Ga0070665_102173522 3300005548 Bacteria 559
99 Ga0070665_102220908 3300005548 Bacteria 552
100 Ga0070704_100654920 3300005549 Bacteria 927
101 Ga0068855_100087965 3300005563 Bacteria 3589
102 Ga0070664_100104284 3300005564 Bacteria 2469
103 Ga0070664_100181175 3300005564 Bacteria 1872
104 Ga0070664_100215349 3300005564 Bacteria 1717
105 Ga0070664_101286588 3300005564 Bacteria 690
106 Ga0068857_100102100 3300005577 Bacteria 2574
107 Ga0068857_100291458 3300005577 Bacteria 1503
108 Ga0068854_100036071 3300005578 Bacteria 3464
109 Ga0068854_100080661 3300005578 Bacteria 2401
110 Ga0068854_100148948 3300005578 Bacteria 1803
111 Ga0068856_100070609 3300005614 Bacteria 3455
112 Ga0068856_100102820 3300005614 Bacteria 2850
113 Ga0070702_100008911 3300005615 Bacteria 4883
114 Ga0068852_100002793 3300005616 Bacteria 12096
115 Ga0068852_100160310 3300005616 Bacteria 2100
116 Ga0068852_100233586 3300005616 Bacteria 1754
117 Ga0068852_100784964 3300005616 Unclassified 966
118 Ga0068859_100008514 3300005617 Bacteria 10379
119 Ga0068859_100035605 3300005617 Bacteria 4995
120 Ga0068864_100001994 3300005618 Bacteria 16807
121 Ga0068864_100011999 3300005618 Bacteria 7155
122 Ga0068864_100038992 3300005618 Bacteria 4059
123 Ga0068864_100489209 3300005618 Bacteria 1182
124 Ga0068866_10001202 3300005718 Bacteria 11288
125 Ga0068866_10001280 3300005718 Bacteria 10900
126 Ga0068861_100004404 3300005719 Bacteria 9437
127 Ga0068851_10002702 3300005834 Bacteria 7818
128 Ga0068851_10028873 3300005834 Bacteria 2742
129 Ga0068851_10051016 3300005834 Bacteria 2102
130 Ga0068851_10064804 3300005834 Bacteria 1878
131 Ga0068870_10156354 3300005840 Bacteria 1348
132 Ga0068863_100002751 3300005841 Bacteria 17409
133 Ga0068863_100018978 3300005841 Bacteria 6581
134 Ga0068863_100055086 3300005841 Bacteria 3767
135 Ga0068863_100115387 3300005841 Bacteria 2559
136 Ga0068863_101087012 3300005841 Bacteria 804
137 Ga0068858_100003941 3300005842 Bacteria 14655
138 Ga0068858_100170949 3300005842 Bacteria 2049
139 Ga0068858_100645863 3300005842 Bacteria 1028
140 Ga0068860_100001009 3300005843 Bacteria 31175
141 Ga0068860_100042329 3300005843 Bacteria 4351
142 Ga0081540_1006577 3300005983 Bacteria 8435
143 Ga0070717_10609021 3300006028 Bacteria 991
144 Ga0075432_10479052 3300006058 Bacteria 551
145 Ga0070715_10002943 3300006163 Bacteria 5320
146 Ga0070716_100029398 3300006173 Bacteria 2971
147 Ga0070712_100002245 3300006175 Bacteria 11887
148 Ga0070712_100642884 3300006175 Bacteria 901
149 Ga0075362_10637500 3300006177 Bacteria 553
150 Ga0075366_10003236 3300006195 Bacteria 8558
151 Ga0097621_100070812 3300006237 Bacteria 2880
152 Ga0097621_100120450 3300006237 Bacteria 2225
153 Ga0097621_100300959 3300006237 Bacteria 1416
154 Ga0068871_100006308 3300006358 Bacteria 8379
155 Ga0068871_100007741 3300006358 Bacteria 7693
156 Ga0068871_100099072 3300006358 Bacteria 2439
157 Ga0075434_100214740 3300006871 Bacteria 1943
158 Ga0068865_100037359 3300006881 Bacteria 3279
159 Ga0068865_100375782 3300006881 Bacteria 1158
160 Ga0068865_100712789 3300006881 Bacteria 858
161 Ga0068865_100872883 3300006881 Bacteria 781
162 Ga0097620_100008514 3300006931 Bacteria 10379
163 Ga0097620_100035606 3300006931 Bacteria 4995
164 Ga0105240_10114867 3300009093 Bacteria 3252
165 Ga0105245_10001706 3300009098 Bacteria 20010
166 Ga0105245_10003767 3300009098 Bacteria 13499
167 Ga0105247_10004801 3300009101 Bacteria 8609
168 Ga0105243_10072663 3300009148 Bacteria 2785
169 Ga0105241_10001496 3300009174 Bacteria 17925
170 Ga0105241_10013191 3300009174 Bacteria 6061
171 Ga0105241_10057041 3300009174 Bacteria 2995
172 Ga0105242_10002065 3300009176 Bacteria 15835
173 Ga0105242_10007143 3300009176 Bacteria 8621
174 Ga0105248_10025372 3300009177 Bacteria 6590
175 Ga0105248_10570022 3300009177 Bacteria 1277
176 Ga0105248_10682102 3300009177 Bacteria 1159
177 Ga0105237_10000736 3300009545 Bacteria 45152
178 Ga0105237_10115450 3300009545 Bacteria 2678
179 Ga0105238_10000822 3300009551 Bacteria 32108
180 Ga0105238_10137823 3300009551 Bacteria 2418
181 Ga0105238_12201039 3300009551 Bacteria 586
182 Ga0105249_10091926 3300009553 Bacteria 2840
183 Ga0105249_10163927 3300009553 Bacteria 2150
184 Ga0105249_10599248 3300009553 Unclassified 1156
185 Ga0105239_10001794 3300010375 Bacteria 28177
186 Ga0105239_10348782 3300010375 Bacteria 1671
187 Ga0105246_10020886 3300011119 Bacteria 4205
188 Ga0105246_11274217 3300011119 Bacteria 680
189 Ga0105246_11352347 3300011119 Bacteria 662
190 Ga0157373_10014666 3300013100 Bacteria 5745
191 Ga0157371_10334254 3300013102 Unclassified 1101
192 Ga0157371_10378931 3300013102 Bacteria 1033
193 Ga0157369_10499358 3300013105 Bacteria 1259
194 Ga0157369_11987535 3300013105 Bacteria 590
195 Ga0157374_10001248 3300013296 Bacteria 21702
196 Ga0157374_10049346 3300013296 Bacteria 3910
197 Ga0157374_10485945 3300013296 Bacteria 1238
198 Ga0157378_10007282 3300013297 Bacteria 9662
199 Ga0157378_10154267 3300013297 Bacteria 2142
200 Ga0157378_11844933 3300013297 Bacteria 653
201 Ga0163162_10007202 3300013306 Bacteria 10804
202 Ga0163162_10008183 3300013306 Bacteria 10203
203 Ga0163162_10008388 3300013306 Bacteria 10077
204 Ga0163162_10413243 3300013306 Bacteria 1482
205 Ga0157372_10108334 3300013307 Unclassified 3179
206 Ga0157372_10164514 3300013307 Bacteria 2565
207 Ga0157372_10265289 3300013307 Bacteria 1994
208 Ga0157372_10366318 3300013307 Bacteria 1679
209 Ga0157375_10001870 3300013308 Bacteria 18132
210 Ga0157375_10002326 3300013308 Bacteria 16416
211 Ga0157375_10004183 3300013308 Bacteria 12524
212 Ga0157375_10019740 3300013308 Bacteria 6138
213 Ga0157375_10779530 3300013308 Bacteria 1106
214 Ga0163163_10023035 3300014325 Bacteria 5906
215 Ga0163163_10519942 3300014325 Bacteria 1252
216 Ga0163163_11252483 3300014325 Bacteria 804
217 Ga0157380_10003785 3300014326 Bacteria 10402
218 Ga0157380_10703221 3300014326 Bacteria 1016
219 Ga0157380_11628407 3300014326 Bacteria 702
220 Ga0182008_10001309 3300014497 Bacteria 17012
221 Ga0157377_10030642 3300014745 Bacteria 2916
222 Ga0157379_10005140 3300014968 Bacteria 11230
223 Ga0157379_10089816 3300014968 Bacteria 2756
224 Ga0157379_11472963 3300014968 Bacteria 661
225 Ga0157379_11588577 3300014968 Bacteria 638
226 Ga0157376_10003390 3300014969 Bacteria 10969
227 Ga0157376_10006275 3300014969 Bacteria 8388
228 Ga0157376_10009675 3300014969 Bacteria 7015
229 Ga0157376_10428383 3300014969 Bacteria 1285
230 Ga0163161_10258879 3300017792 Bacteria 1358
231 Ga0163161_10526833 3300017792 Bacteria 966
232 Ga0213876_10248215 3300021384 Bacteria 946
233 Ga0209051_1034479 3300025303 Bacteria 1896
234 Ga0207697_10050139 3300025315 Bacteria 1723
235 Ga0207697_10380128 3300025315 Bacteria 627
236 Ga0207656_10027870 3300025321 Bacteria 2314
237 Ga0207656_10179186 3300025321 Bacteria 1016
238 Ga0207656_10566250 3300025321 Bacteria 579
239 Ga0207682_10025862 3300025893 Bacteria 2329
240 Ga0207682_10537971 3300025893 Bacteria 552
241 Ga0207692_10076575 3300025898 Bacteria 1777
242 Ga0207642_10127378 3300025899 Bacteria 1323
243 Ga0207642_10552898 3300025899 Bacteria 711
244 Ga0207710_10028827 3300025900 Bacteria 2411
245 Ga0207680_10000417 3300025903 Bacteria 20251
246 Ga0207680_10005435 3300025903 Bacteria 6089
247 Ga0207680_10172350 3300025903 Bacteria 1458
248 Ga0207680_10173517 3300025903 Bacteria 1454
249 Ga0207647_10117030 3300025904 Bacteria 1573
250 Ga0207685_10054075 3300025905 Bacteria 1562
251 Ga0207699_10095998 3300025906 Bacteria 1871
252 Ga0207645_10188520 3300025907 Bacteria 1355
253 Ga0207645_10272937 3300025907 Bacteria 1122
254 Ga0207643_10095992 3300025908 Bacteria 1733
255 Ga0207705_10217461 3300025909 Bacteria 1450
256 Ga0207654_10010392 3300025911 Bacteria 4738
257 Ga0207654_10075141 3300025911 Bacteria 2018
258 Ga0207654_10144682 3300025911 Bacteria 1520
259 Ga0207707_10257557 3300025912 Bacteria 1514
260 Ga0207707_10486428 3300025912 Bacteria 1054
261 Ga0207695_10153679 3300025913 Bacteria 2238
262 Ga0207671_10004801 3300025914 Bacteria 12732
263 Ga0207693_10002539 3300025915 Bacteria 15871
264 Ga0207663_10177189 3300025916 Bacteria 1519
265 Ga0207660_10478293 3300025917 Unclassified 1009
266 Ga0207662_10105242 3300025918 Bacteria 1753
267 Ga0207657_10028650 3300025919 Bacteria 5076
268 Ga0207657_10935920 3300025919 Bacteria 667
269 Ga0207649_10036387 3300025920 Bacteria 2964
270 Ga0207652_10018978 3300025921 Bacteria 5648
271 Ga0207652_10103377 3300025921 Bacteria 2519
272 Ga0207681_10002914 3300025923 Bacteria 10800
273 Ga0207681_10671898 3300025923 Bacteria 860
274 Ga0207681_11692282 3300025923 Bacteria 529
275 Ga0207694_10350633 3300025924 Bacteria 1222
276 Ga0207694_11270193 3300025924 Bacteria 623
277 Ga0207694_11820439 3300025924 Bacteria 511
278 Ga0207650_10018410 3300025925 Bacteria 4902
279 Ga0207650_10047467 3300025925 Bacteria 3164
280 Ga0207650_10067616 3300025925 Bacteria 2681
281 Ga0207650_10102140 3300025925 Bacteria 2209
282 Ga0207650_10203145 3300025925 Bacteria 1588
283 Ga0207650_10207749 3300025925 Bacteria 1571
284 Ga0207650_10221405 3300025925 Bacteria 1523
285 Ga0207650_10621599 3300025925 Bacteria 909
286 Ga0207659_10006202 3300025926 Bacteria 7313
287 Ga0207659_10393884 3300025926 Bacteria 1157
288 Ga0207659_11764787 3300025926 Bacteria 526
289 Ga0207687_10000151 3300025927 Bacteria 46396
290 Ga0207687_10063929 3300025927 Bacteria 2607
291 Ga0207700_10043971 3300025928 Bacteria 3284
292 Ga0207644_10003559 3300025931 Bacteria 10080
293 Ga0207644_10048020 3300025931 Bacteria 3049
294 Ga0207644_10284537 3300025931 Bacteria 1328
295 Ga0207644_10411343 3300025931 Bacteria 1107
296 Ga0207690_10376467 3300025932 Bacteria 1127
297 Ga0207706_10001418 3300025933 Bacteria 23979
298 Ga0207706_10006798 3300025933 Bacteria 10575
299 Ga0207686_10220105 3300025934 Bacteria 1370
300 Ga0207670_10081866 3300025936 Bacteria 2261
301 Ga0207670_10202700 3300025936 Bacteria 1508
302 Ga0207669_10005463 3300025937 Bacteria 5705
303 Ga0207669_10020646 3300025937 Bacteria 3459
304 Ga0207669_10180016 3300025937 Bacteria 1514
305 Ga0207704_10005032 3300025938 Bacteria 6080
306 Ga0207704_10044386 3300025938 Bacteria 2633
307 Ga0207704_10407704 3300025938 Bacteria 1074
308 Ga0207665_10070221 3300025939 Bacteria 2389
309 Ga0207665_11606188 3300025939 Bacteria 515
310 Ga0207691_10006709 3300025940 Bacteria 11103
311 Ga0207691_10063401 3300025940 Bacteria 3352
312 Ga0207691_10065422 3300025940 Bacteria 3291
313 Ga0207691_10071732 3300025940 Bacteria 3125
314 Ga0207691_10123918 3300025940 Bacteria 2288
315 Ga0207691_10146205 3300025940 Bacteria 2081
316 Ga0207711_10000206 3300025941 Bacteria 62928
317 Ga0207711_10734482 3300025941 Bacteria 920
318 Ga0207689_10005303 3300025942 Bacteria 11549
319 Ga0207689_10028936 3300025942 Bacteria 4631
320 Ga0207689_10308364 3300025942 Bacteria 1312
321 Ga0207689_11764047 3300025942 Bacteria 512
322 Ga0207679_10067242 3300025945 Bacteria 2688
323 Ga0207679_10077436 3300025945 Bacteria 2530
324 Ga0207679_10182818 3300025945 Bacteria 1736
325 Ga0207679_10262787 3300025945 Bacteria 1473
326 Ga0207667_10449672 3300025949 Unclassified 1309
327 Ga0207651_10018285 3300025960 Bacteria 4165
328 Ga0207651_11374046 3300025960 Bacteria 635
329 Ga0207712_10040692 3300025961 Bacteria 3192
330 Ga0207712_10981135 3300025961 Unclassified 749
331 Ga0207668_10010914 3300025972 Bacteria 5506
332 Ga0207640_10167260 3300025981 Bacteria 1634
333 Ga0207640_11512329 3300025981 Bacteria 603
334 Ga0207658_10001151 3300025986 Bacteria 21193
335 Ga0207658_10007245 3300025986 Bacteria 7564
336 Ga0207658_10047899 3300025986 Bacteria 3131
337 Ga0207658_10085114 3300025986 Bacteria 2435
338 Ga0207658_10349264 3300025986 Bacteria 1287
339 Ga0207658_11864939 3300025986 Bacteria 548
340 Ga0207677_10000980 3300026023 Bacteria 15778
341 Ga0207677_10105320 3300026023 Bacteria 2087
342 Ga0207703_10004456 3300026035 Bacteria 11501
343 Ga0207703_10125604 3300026035 Bacteria 2208
344 Ga0207639_10039035 3300026041 Unclassified 3535
345 Ga0207639_10072930 3300026041 Bacteria 2690
346 Ga0207639_10206357 3300026041 Bacteria 1689
347 Ga0207639_10247403 3300026041 Bacteria 1553
348 Ga0207639_10275870 3300026041 Bacteria 1477
349 Ga0207678_10121345 3300026067 Bacteria 2230
350 Ga0207678_10524095 3300026067 Bacteria 1034
351 Ga0207708_10007281 3300026075 Bacteria 8182
352 Ga0207702_10076682 3300026078 Bacteria 2890
353 Ga0207702_10188519 3300026078 Bacteria 1904
354 Ga0207641_10006009 3300026088 Bacteria 10289
355 Ga0207648_10006286 3300026089 Bacteria 11823
356 Ga0207648_10060175 3300026089 Bacteria 3312
357 Ga0207648_10066610 3300026089 Bacteria 3141
358 Ga0207676_10000384 3300026095 Bacteria 37732
359 Ga0207676_10086072 3300026095 Bacteria 2566
360 Ga0207676_10391759 3300026095 Bacteria 1296
361 Ga0207676_11356877 3300026095 Bacteria 706
362 Ga0207674_10299138 3300026116 Bacteria 1558
363 Ga0207675_100006513 3300026118 Bacteria 11050
364 Ga0207683_10000775 3300026121 Bacteria 29112
365 Ga0207683_10008204 3300026121 Bacteria 8937
366 Ga0207683_10078454 3300026121 Bacteria 2926
367 Ga0207683_10084490 3300026121 Bacteria 2822
368 Ga0207683_10672853 3300026121 Bacteria 959
369 Ga0207698_10080991 3300026142 Bacteria 2618
370 Ga0207698_10198654 3300026142 Bacteria 1794
371 Ga0207698_10397402 3300026142 Bacteria 1316
372 Ga0207698_11804002 3300026142 Unclassified 627
373 Ga0209974_10010884 3300027876 Bacteria 3062
374 Ga0207428_10905821 3300027907 Bacteria 623
375 Ga0268266_10029603 3300028379 Bacteria 4654
376 Ga0268266_10086128 3300028379 Bacteria 2746
377 Ga0268266_10116120 3300028379 Bacteria 2377
378 Ga0268265_10616822 3300028380 Bacteria 1039
379 Ga0268264_10000781 3300028381 Bacteria 34982
380 Ga0268264_10008174 3300028381 Bacteria 8686
381 Ga0268264_10025429 3300028381 Bacteria 4837
382 Ga0268264_10479455 3300028381 Bacteria 1210
383 Ga0307515_10272735 3300028794 Bacteria 1410
384 Ga0265327_10013010 3300031251 Bacteria 5563
385 Ga0307513_10009879 3300031456 Bacteria 12041
386 Ga0307405_10066201 3300031731 Bacteria 2303
387 Ga0307413_10266648 3300031824 Bacteria 1280
388 Ga0307410_10133596 3300031852 Bacteria 1826
389 Ga0307410_10204996 3300031852 Bacteria 1508
390 Ga0307406_10356303 3300031901 Bacteria 1145
391 Ga0307407_10154102 3300031903 Bacteria 1497
392 Ga0307412_10437915 3300031911 Bacteria 1074
393 Ga0307409_100046811 3300031995 Bacteria 3277
394 Ga0307416_100009449 3300032002 Bacteria 6384
395 Ga0307416_100111775 3300032002 Bacteria 2410
396 Ga0373926_0045933 3300035083 Bacteria 1566
397 Ga0373934_0060180 3300035086 Bacteria 1512
398 Ga0373944_0007732 3300035089 Bacteria 2887
399 Ga0373923_0012014 3300035111 Bacteria 3191
400 Ga0373936_0083600 3300035113 Bacteria 1331
401 Ga0373945_0009623 3300035116 Bacteria 3169
402 Ga0373953_0012355 3300035117 Bacteria 3022
403 Ga0373953_0170720 3300035117 Bacteria 936
404 Ga0373954_0004049 3300035118 Bacteria 6271
405 Ga0373956_0538596 3300035119 Bacteria 557
406 Ga0373943_0008800 3300035170 Bacteria 4525
407 Ga0373943_0054276 3300035170 Bacteria 1982
408 Ga0373946_0019346 3300035171 Bacteria 2624
409 Ga0373955_0005212 3300035172 Bacteria 5824
410 Ga0373955_0059728 3300035172 Bacteria 2101
411 Ga0373924_0018837 3300035410 Bacteria 2667
412 Ga0373935_0054060 3300035692 Bacteria 2555
413 Ga0373927_0105066 3300035695 Bacteria 1839
414 Ga0373933_0074753 3300035724 Bacteria 2067
415 Ga0373933_0159629 3300035724 Bacteria 1431
416 Ga0373947_0052375 3300035725 Bacteria 2458
417 Ga0373937_0011587 3300036401 Bacteria 7741
418 Ga0373937_0027902 3300036401 Bacteria 5108
419 Ga0373925_0024509 3300037068 Bacteria 4405
420 Ga0373925_0062677 3300037068 Bacteria 2796
421 Ga0373925_0276253 3300037068 Bacteria 1352
422 Ga0373925_1598361 3300037068 Bacteria 533
423 Ga0395905_0006832 3300037471 Bacteria 11418
424 Ga0451798_0787906 3300041458 Bacteria 1373
425 Ga0451802_0198034 3300041460 Bacteria 671
426 Ga0451804_0299958 3300041463 Bacteria 520
427 Ga0451849_0194658 3300041505 Bacteria 1153
428 Ga0451577_0233689 3300042876 Bacteria 1663
429 Ga0451577_0633379 3300042876 Bacteria 970
430 Ga0451577_1378842 3300042876 Bacteria 626
431 Ga0453684_0000326 3300044712 Bacteria 200766
432 Ga0453684_0021648 3300044712 Bacteria 9591
433 Ga0453684_0832480 3300044712 Bacteria 993
434 Ga0451576_0025308 3300045051 Bacteria 6395
435 Ga0495592_0569356 3300046454 Bacteria 694
436 Ga0495580_0066136 3300046472 Bacteria 2531
437 Ga0495664_0664032 3300046477 Bacteria 617
438 Ga0495608_0120737 3300046511 Bacteria 1681
439 Ga0495628_0306841 3300046516 Bacteria 1174
440 Ga0495640_0668440 3300046533 Bacteria 624
441 Ga0495586_0195220 3300046535 Bacteria 1147
442 Ga0495587_0014040 3300046536 Bacteria 5030
443 Ga0495621_0024758 3300046539 Bacteria 2008
444 Ga0495621_0037020 3300046539 Bacteria 1696
445 Ga0495645_0042341 3300046543 Bacteria 3320
446 Ga0495645_0432485 3300046543 Bacteria 833
447 Ga0495645_0527282 3300046543 Bacteria 735
448 Ga0495667_0260514 3300046559 Bacteria 1103
449 Ga0495635_0340309 3300046663 Bacteria 1002
450 Ga0495635_0563879 3300046663 Bacteria 746
451 Ga0495659_0025095 3300046664 Bacteria 2038
452 Ga0495623_0127134 3300046679 Bacteria 1530
453 Ga0495658_0009696 3300046683 Bacteria 4802
454 Ga0495658_0300937 3300046683 Bacteria 1014
455 Ga0495604_0535647 3300047317 Bacteria 756
456 Ga0495674_0100111 3300047319 Bacteria 2467
457 Ga0495680_0068691 3300047322 Bacteria 2706
458 Ga0495684_0029556 3300047471 Bacteria 4207
459 Ga0495684_0131411 3300047471 Bacteria 1880
460 Ga0495602_0663252 3300048088 Bacteria 711
461 Ga0496100_0416712 3300048903 Bacteria 1025
462 Ga0496101_0061567 3300048904 Bacteria 2726
463 Ga0496104_0095915 3300048907 Bacteria 2837
464 Ga0496105_0010706 3300048908 Bacteria 7217
465 Ga0496106_0786044 3300048909 Bacteria 755
466 Ga0496107_0482067 3300048910 Bacteria 920
467 Ga0496109_0047354 3300048912 Bacteria 3909
468 Ga0496112_0002492 3300048915 Bacteria 14861
469 Ga0496121_0005035 3300048924 Bacteria 17277
470 Ga0496124_0000125 3300048927 Bacteria 159942
471 Ga0496125_0011959 3300048928 Bacteria 8644
472 Ga0501033_0223067 3300049570 Bacteria 1341
473 Ga0501034_0364714 3300049571 Bacteria 1371
474 Ga0501034_0510516 3300049571 Bacteria 1115
475 Ga0501238_010908 3300049671 Bacteria 1217
476 Ga0501266_037993 3300049763 Bacteria 708
477 nmdc:mga0k408_430939_c1 3300050493 Bacteria 784
478 nmdc:mga0qj67_66406_c1 3300050509 Bacteria 2873
479 nmdc:mga08y16_1836581_c1 3300050511 Bacteria 558
480 nmdc:mga0n895_192933_c1 3300050512 Bacteria 2068
481 nmdc:mga0n895_2053077_c1 3300050512 Bacteria 529
482 nmdc:mga0a205_127644_c1 3300050515 Bacteria 2443
483 Ga0495601_0026640 3300053077 Bacteria 3571
484 Ga0495601_0144088 3300053077 Bacteria 1555
485 Ga0495601_0564319 3300053077 Bacteria 732
486 Ga0495612_0058487 3300053078 Bacteria 1593
487 Ga0495595_0372436 3300053084 Bacteria 722
488 Ga0495619_0047274 3300053085 Bacteria 2833
489 Ga0495619_0162515 3300053085 Bacteria 1543
490 Ga0500590_031583 3300053148 Bacteria 2746
491 8006987141 8006984368 Bacteria 9651211
492 Ga0500619_000010
493 JGI24743J22301_10078661
494 JGI24034J26672_10058844
495 Ga0055540_1028700
496 Ga0065712_10031961
497 Ga0065712_10036699
498 Ga0070658_10057949
499 Ga0070658_10756413
500 Ga0070676_10136489
501 Ga0070676_10321119
502 Ga0070676_11071691
503 Ga0070683_100077767
504 Ga0070690_100000548
505 Ga0070690_100001949
506 Ga0070670_100002208
507 Ga0070670_100067969
508 Ga0070670_100077825
509 Ga0070670_100795606
510 Ga0070677_10010968
511 Ga0070677_10028033
512 Ga0068869_100019215
513 Ga0068869_100171168
514 Ga0070666_10004293
515 Ga0070666_10009965
516 Ga0070666_10174882
517 Ga0070680_100004810
518 Ga0070682_100305414
519 Ga0068868_100002266
520 Ga0068868_100056192
521 Ga0068868_100106421
522 Ga0070689_100009195
523 Ga0070691_10045398
524 Ga0070687_100055499
525 Ga0070668_100004918
526 Ga0070669_100003908
527 Ga0070669_100229042
528 Ga0070675_100029782
529 Ga0070675_100057390
530 Ga0070671_100001832
531 Ga0070671_100146994
532 Ga0070674_100006090
533 Ga0070674_100038583
534 Ga0070673_100001966
535 Ga0070673_100116155
536 Ga0070673_100996358
537 Ga0070688_100000601
538 Ga0070659_100034511
539 Ga0070659_101045711
540 Ga0070659_101161716
541 Ga0070667_100001219
542 Ga0070667_100001825
543 Ga0070667_100023894
544 Ga0070667_100128951
545 Ga0070709_10074942
546 Ga0070713_100009179
547 Ga0070710_10032480
548 Ga0070701_10048660
549 Ga0070701_10070062
550 Ga0070711_100003520
551 Ga0070705_100024664
552 Ga0070705_100480082
553 Ga0070708_100355554
554 Ga0070663_100057091
555 Ga0070663_100110169
556 Ga0070663_100380797
557 Ga0070678_100002121
558 Ga0070678_100049934
559 Ga0070678_100052691
560 Ga0070678_100403129
561 Ga0070678_100459805
562 Ga0070662_100024228
563 Ga0070662_100974005
564 Ga0070662_101458448
565 Ga0070681_10102646
566 Ga0068867_100017304
567 Ga0068867_100049744
568 Ga0068867_100114778
569 Ga0070685_10001796
570 Ga0070707_101293475
571 Ga0070698_100808569
572 Ga0070679_100047331
573 Ga0070679_100081385
574 Ga0070684_100377682
575 Ga0068853_100108485
576 Ga0068853_100108821
577 Ga0068853_100290593
578 Ga0070672_100002092
579 Ga0070672_100008531
580 Ga0070672_100507157
581 Ga0070686_100003638
582 Ga0070686_100092817
583 Ga0070695_100820674
584 Ga0070693_100000538
585 Ga0070693_100050167
586 Ga0070665_100028215
587 Ga0070665_100105225
588 Ga0070665_101215042
589 Ga0070665_102173522
590 Ga0070665_102220908
591 Ga0070704_100654920
592 Ga0068855_100087965
593 Ga0070664_100104284
594 Ga0070664_100181175
595 Ga0070664_100215349
596 Ga0070664_101286588
597 Ga0068857_100102100
598 Ga0068857_100291458
599 Ga0068854_100036071
600 Ga0068854_100080661
601 Ga0068854_100148948
602 Ga0068856_100070609
603 Ga0068856_100102820
604 Ga0070702_100008911
605 Ga0068852_100002793
606 Ga0068852_100160310
607 Ga0068852_100233586
608 Ga0068852_100784964
609 Ga0068859_100008514
610 Ga0068859_100035605
611 Ga0068864_100001994
612 Ga0068864_100011999
613 Ga0068864_100038992
614 Ga0068864_100489209
615 Ga0068866_10001202
616 Ga0068866_10001280
617 Ga0068861_100004404
618 Ga0068851_10002702
619 Ga0068851_10028873
620 Ga0068851_10051016
621 Ga0068851_10064804
622 Ga0068870_10156354
623 Ga0068863_100002751
624 Ga0068863_100018978
625 Ga0068863_100055086
626 Ga0068863_100115387
627 Ga0068863_101087012
628 Ga0068858_100003941
629 Ga0068858_100170949
630 Ga0068858_100645863
631 Ga0068860_100001009
632 Ga0068860_100042329
633 Ga0081540_1006577
634 Ga0070717_10609021
635 Ga0075432_10479052
636 Ga0070715_10002943
637 Ga0070716_100029398
638 Ga0070712_100002245
639 Ga0070712_100642884
640 Ga0075362_10637500
641 Ga0075366_10003236
642 Ga0097621_100070812
643 Ga0097621_100120450
644 Ga0097621_100300959
645 Ga0068871_100006308
646 Ga0068871_100007741
647 Ga0068871_100099072
648 Ga0075434_100214740
649 Ga0068865_100037359
650 Ga0068865_100375782
651 Ga0068865_100712789
652 Ga0068865_100872883
653 Ga0097620_100008514
654 Ga0097620_100035606
655 Ga0105240_10114867
656 Ga0105245_10001706
657 Ga0105245_10003767
658 Ga0105247_10004801
659 Ga0105243_10072663
660 Ga0105241_10001496
661 Ga0105241_10013191
662 Ga0105241_10057041
663 Ga0105242_10002065
664 Ga0105242_10007143
665 Ga0105248_10025372
666 Ga0105248_10570022
667 Ga0105248_10682102
668 Ga0105237_10000736
669 Ga0105237_10115450
670 Ga0105238_10000822
671 Ga0105238_10137823
672 Ga0105238_12201039
673 Ga0105249_10091926
674 Ga0105249_10163927
675 Ga0105249_10599248
676 Ga0105239_10001794
677 Ga0105239_10348782
678 Ga0105246_10020886
679 Ga0105246_11274217
680 Ga0105246_11352347
681 Ga0157373_10014666
682 Ga0157371_10334254
683 Ga0157371_10378931
684 Ga0157369_10499358
685 Ga0157369_11987535
686 Ga0157374_10001248
687 Ga0157374_10049346
688 Ga0157374_10485945
689 Ga0157378_10007282
690 Ga0157378_10154267
691 Ga0157378_11844933
692 Ga0163162_10007202
693 Ga0163162_10008183
694 Ga0163162_10008388
695 Ga0163162_10413243
696 Ga0157372_10108334
697 Ga0157372_10164514
698 Ga0157372_10265289
699 Ga0157372_10366318
700 Ga0157375_10001870
701 Ga0157375_10002326
702 Ga0157375_10004183
703 Ga0157375_10019740
704 Ga0157375_10779530
705 Ga0163163_10023035
706 Ga0163163_10519942
707 Ga0163163_11252483
708 Ga0157380_10003785
709 Ga0157380_10703221
710 Ga0157380_11628407
711 Ga0182008_10001309
712 Ga0157377_10030642
713 Ga0157379_10005140
714 Ga0157379_10089816
715 Ga0157379_11472963
716 Ga0157379_11588577
717 Ga0157376_10003390
718 Ga0157376_10006275
719 Ga0157376_10009675
720 Ga0157376_10428383
721 Ga0163161_10258879
722 Ga0163161_10526833
723 Ga0213876_10248215
724 Ga0209051_1034479
725 Ga0207697_10050139
726 Ga0207697_10380128
727 Ga0207656_10027870
728 Ga0207656_10179186
729 Ga0207656_10566250
730 Ga0207682_10025862
731 Ga0207682_10537971
732 Ga0207692_10076575
733 Ga0207642_10127378
734 Ga0207642_10552898
735 Ga0207710_10028827
736 Ga0207680_10000417
737 Ga0207680_10005435
738 Ga0207680_10172350
739 Ga0207680_10173517
740 Ga0207647_10117030
741 Ga0207685_10054075
742 Ga0207699_10095998
743 Ga0207645_10188520
744 Ga0207645_10272937
745 Ga0207643_10095992
746 Ga0207705_10217461
747 Ga0207654_10010392
748 Ga0207654_10075141
749 Ga0207654_10144682
750 Ga0207707_10257557
751 Ga0207707_10486428
752 Ga0207695_10153679
753 Ga0207671_10004801
754 Ga0207693_10002539
755 Ga0207663_10177189
756 Ga0207660_10478293
757 Ga0207662_10105242
758 Ga0207657_10028650
759 Ga0207657_10935920
760 Ga0207649_10036387
761 Ga0207652_10018978
762 Ga0207652_10103377
763 Ga0207681_10002914
764 Ga0207681_10671898
765 Ga0207681_11692282
766 Ga0207694_10350633
767 Ga0207694_11270193
768 Ga0207694_11820439
769 Ga0207650_10018410
770 Ga0207650_10047467
771 Ga0207650_10067616
772 Ga0207650_10102140
773 Ga0207650_10203145
774 Ga0207650_10207749
775 Ga0207650_10221405
776 Ga0207650_10621599
777 Ga0207659_10006202
778 Ga0207659_10393884
779 Ga0207659_11764787
780 Ga0207687_10000151
781 Ga0207687_10063929
782 Ga0207700_10043971
783 Ga0207644_10003559
784 Ga0207644_10048020
785 Ga0207644_10284537
786 Ga0207644_10411343
787 Ga0207690_10376467
788 Ga0207706_10001418
789 Ga0207706_10006798
790 Ga0207686_10220105
791 Ga0207670_10081866
792 Ga0207670_10202700
793 Ga0207669_10005463
794 Ga0207669_10020646
795 Ga0207669_10180016
796 Ga0207704_10005032
797 Ga0207704_10044386
798 Ga0207704_10407704
799 Ga0207665_10070221
800 Ga0207665_11606188
801 Ga0207691_10006709
802 Ga0207691_10063401
803 Ga0207691_10065422
804 Ga0207691_10071732
805 Ga0207691_10123918
806 Ga0207691_10146205
807 Ga0207711_10000206
808 Ga0207711_10734482
809 Ga0207689_10005303
810 Ga0207689_10028936
811 Ga0207689_10308364
812 Ga0207689_11764047
813 Ga0207679_10067242
814 Ga0207679_10077436
815 Ga0207679_10182818
816 Ga0207679_10262787
817 Ga0207667_10449672
818 Ga0207651_10018285
819 Ga0207651_11374046
820 Ga0207712_10040692
821 Ga0207712_10981135
822 Ga0207668_10010914
823 Ga0207640_10167260
824 Ga0207640_11512329
825 Ga0207658_10001151
826 Ga0207658_10007245
827 Ga0207658_10047899
828 Ga0207658_10085114
829 Ga0207658_10349264
830 Ga0207658_11864939
831 Ga0207677_10000980
832 Ga0207677_10105320
833 Ga0207703_10004456
834 Ga0207703_10125604
835 Ga0207639_10039035
836 Ga0207639_10072930
837 Ga0207639_10206357
838 Ga0207639_10247403
839 Ga0207639_10275870
840 Ga0207678_10121345
841 Ga0207678_10524095
842 Ga0207708_10007281
843 Ga0207702_10076682
844 Ga0207702_10188519
845 Ga0207641_10006009
846 Ga0207648_10006286
847 Ga0207648_10060175
848 Ga0207648_10066610
849 Ga0207676_10000384
850 Ga0207676_10086072
851 Ga0207676_10391759
852 Ga0207676_11356877
853 Ga0207674_10299138
854 Ga0207675_100006513
855 Ga0207683_10000775
856 Ga0207683_10008204
857 Ga0207683_10078454
858 Ga0207683_10084490
859 Ga0207683_10672853
860 Ga0207698_10080991
861 Ga0207698_10198654
862 Ga0207698_10397402
863 Ga0207698_11804002
864 Ga0209974_10010884
865 Ga0207428_10905821
866 Ga0268266_10029603
867 Ga0268266_10086128
868 Ga0268266_10116120
869 Ga0268265_10616822
870 Ga0268264_10000781
871 Ga0268264_10008174
872 Ga0268264_10025429
873 Ga0268264_10479455
874 Ga0307515_10272735
875 Ga0265327_10013010
876 Ga0307513_10009879
877 Ga0307405_10066201
878 Ga0307413_10266648
879 Ga0307410_10133596
880 Ga0307410_10204996
881 Ga0307406_10356303
882 Ga0307407_10154102
883 Ga0307412_10437915
884 Ga0307409_100046811
885 Ga0307416_100009449
886 Ga0307416_100111775
887 Ga0373926_0045933
888 Ga0373934_0060180
889 Ga0373944_0007732
890 Ga0373923_0012014
891 Ga0373936_0083600
892 Ga0373945_0009623
893 Ga0373953_0012355
894 Ga0373953_0170720
895 Ga0373954_0004049
896 Ga0373956_0538596
897 Ga0373943_0008800
898 Ga0373943_0054276
899 Ga0373946_0019346
900 Ga0373955_0005212
901 Ga0373955_0059728
902 Ga0373924_0018837
903 Ga0373935_0054060
904 Ga0373927_0105066
905 Ga0373933_0074753
906 Ga0373933_0159629
907 Ga0373947_0052375
908 Ga0373937_0011587
909 Ga0373937_0027902
910 Ga0373925_0024509
911 Ga0373925_0062677
912 Ga0373925_0276253
913 Ga0373925_1598361
914 Ga0395905_0006832
915 Ga0451798_0787906
916 Ga0451802_0198034
917 Ga0451804_0299958
918 Ga0451849_0194658
919 Ga0451577_0233689
920 Ga0451577_0633379
921 Ga0451577_1378842
922 Ga0453684_0000326
923 Ga0453684_0021648
924 Ga0453684_0832480
925 Ga0451576_0025308
926 Ga0495592_0569356
927 Ga0495580_0066136
928 Ga0495664_0664032
929 Ga0495608_0120737
930 Ga0495628_0306841
931 Ga0495640_0668440
932 Ga0495586_0195220
933 Ga0495587_0014040
934 Ga0495621_0024758
935 Ga0495621_0037020
936 Ga0495645_0042341
937 Ga0495645_0432485
938 Ga0495645_0527282
939 Ga0495667_0260514
940 Ga0495635_0340309
941 Ga0495635_0563879
942 Ga0495659_0025095
943 Ga0495623_0127134
944 Ga0495658_0009696
945 Ga0495658_0300937
946 Ga0495604_0535647
947 Ga0495674_0100111
948 Ga0495680_0068691
949 Ga0495684_0029556
950 Ga0495684_0131411
951 Ga0495602_0663252
952 Ga0496100_0416712
953 Ga0496101_0061567
954 Ga0496104_0095915
955 Ga0496105_0010706
956 Ga0496106_0786044
957 Ga0496107_0482067
958 Ga0496109_0047354
959 Ga0496112_0002492
960 Ga0496121_0005035
961 Ga0496124_0000125
962 Ga0496125_0011959
963 Ga0501033_0223067
964 Ga0501034_0364714
965 Ga0501034_0510516
966 Ga0501238_010908
967 Ga0501266_037993
968 nmdc:mga0k408_430939_c1
969 nmdc:mga0qj67_66406_c1
970 nmdc:mga08y16_1836581_c1
971 nmdc:mga0n895_192933_c1
972 nmdc:mga0n895_2053077_c1
973 nmdc:mga0a205_127644_c1
974 Ga0495601_0026640
975 Ga0495601_0144088
976 Ga0495601_0564319
977 Ga0495612_0058487
978 Ga0495595_0372436
979 Ga0495619_0047274
980 Ga0495619_0162515
981 Ga0500590_031583
982 8006987141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

38

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9925 5 145
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.992 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9906 5 145
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9716 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9712 5 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9922 5 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9706 5 145 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.896 2 143 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8657 5 141 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8606 5 142 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y4WXE4-F1-model_v4 SRPBCC family protein 0.9996 5 147
AF-A0A1P8JZT5-F1-model_v4 Polyketide cyclase 0.9991 5 147
AF-A0A1E4NDH9-F1-model_v4 Polyketide cyclase 0.999 1 148
AF-A0A7V9MUU5-F1-model_v4 SRPBCC family protein 0.999 5 148
AF-A0A023XIA1-F1-model_v4 deleted 0.9985 5 148

Map