F454162

General Info

Members Datasets Scaffolds Average Seq Length
491 341 982 125

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0090142|Ga0495663_0090142_368_751
Length 127
Sequence MTGHRLVVWYNTRCPVCDAGIDWQRNKLLQAVRAGYISFKDINEQPDALASYGASLDDVRRRLHATDETTGRLIVGADVAIATWRITPGERWLASLFGNRLMLPVTRLVYDRFADLLFAWNRRKGRW

Samples

Sample ID Description Type Environment
1 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
165 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
166 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
235 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
236 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
237 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
238 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
241 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
242 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
243 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
248 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
249 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
250 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
253 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
254 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
257 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
260 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
261 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
262 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
263 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
264 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
265 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
266 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
267 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
268 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
269 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
270 2791355199
271 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
272 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
273 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
274 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
275 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
276 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
277 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
278 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
279 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
280 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
281 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
282 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
283 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
284 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
285 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
286 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
287 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
288 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
289 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
290 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
291 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
292 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
293 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
294 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
295 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
296 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
297 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
298 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
299 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
300 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
301 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
302 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
303 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
304 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
305 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
306 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
307 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
308 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
309 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
310 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
311 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
312 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
313 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
314 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
315 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
316 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
317 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
318 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
319 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
320 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
321 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
322 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
323 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
324 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
325 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
326 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
327 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
328 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
329 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
330 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
331 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
332 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
333 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
334 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
335 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
336 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
337 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
338 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
339 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
340 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
341 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.06
Metatranscriptomes 0.41
Isolates 16.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.07
Nodule 14.46
Rhizoplane 2.24
Rhizosphere 48.88
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495663_0090142 3300046525 Bacteria 999
2 JGI25153J46596_10000650 3300003215 Bacteria 21224
3 JGI25160J50197_1003414 3300003354 Bacteria 7113
4 JGI25404J52841_10001177 3300003659 Bacteria 4464
5 JGI25404J52841_10032831 3300003659 Bacteria 1106
6 JGI25404J52841_10040666 3300003659 Bacteria 984
7 JGI25404J52841_10118586 3300003659 Bacteria 557
8 Ga0055542_1005931 3300003762 Bacteria 2677
9 Ga0055529_1021133 3300003763 Bacteria 809
10 Ga0055543_1003288 3300004625 Bacteria 4858
11 Ga0065165_1002612 3300005262 Bacteria 14728
12 Ga0065165_1052930 3300005262 Bacteria 1144
13 Ga0068869_100539496 3300005334 Bacteria 978
14 Ga0070666_10665163 3300005335 Bacteria 762
15 Ga0068868_100040311 3300005338 Bacteria 3635
16 Ga0070660_101232094 3300005339 Bacteria 635
17 Ga0070692_10922650 3300005345 Bacteria 605
18 Ga0070668_100108248 3300005347 Bacteria 2210
19 Ga0070668_101089912 3300005347 Bacteria 720
20 Ga0070669_100933324 3300005353 Bacteria 742
21 Ga0070671_100530555 3300005355 Bacteria 1014
22 Ga0070673_101978852 3300005364 Bacteria 553
23 Ga0070709_10004853 3300005434 Bacteria 7273
24 Ga0070709_11677013 3300005434 Bacteria 518
25 Ga0070714_100016984 3300005435 Bacteria 5889
26 Ga0070714_102001981 3300005435 Bacteria 565
27 Ga0070713_100037832 3300005436 Bacteria 3904
28 Ga0070713_100374388 3300005436 Bacteria 1325
29 Ga0070710_10005305 3300005437 Bacteria 6113
30 Ga0070711_100040649 3300005439 Bacteria 3137
31 Ga0070711_101098703 3300005439 Bacteria 685
32 Ga0070700_101288481 3300005441 Bacteria 614
33 Ga0070708_101243768 3300005445 Bacteria 696
34 Ga0070662_101325980 3300005457 Bacteria 619
35 Ga0068867_100942504 3300005459 Bacteria 779
36 Ga0070707_100960480 3300005468 Bacteria 820
37 Ga0070698_100073757 3300005471 Bacteria 3418
38 Ga0070698_100395809 3300005471 Bacteria 1314
39 Ga0070679_100788728 3300005530 Bacteria 893
40 Ga0070684_100451754 3300005535 Bacteria 1188
41 Ga0070697_102040165 3300005536 Bacteria 513
42 Ga0070672_101345099 3300005543 Unclassified 638
43 Ga0070686_100421548 3300005544 Bacteria 1020
44 Ga0070695_100959065 3300005545 Bacteria 694
45 Ga0070696_100425018 3300005546 Bacteria 1044
46 Ga0070665_101635941 3300005548 Bacteria 652
47 Ga0068856_101351775 3300005614 Unclassified 727
48 Ga0070702_100241172 3300005615 Bacteria 1220
49 Ga0070702_100307612 3300005615 Bacteria 1099
50 Ga0068859_100093957 3300005617 Bacteria 3050
51 Ga0068866_10475543 3300005718 Bacteria 822
52 Ga0068861_100354910 3300005719 Bacteria 1287
53 Ga0068861_100632958 3300005719 Unclassified 986
54 Ga0068861_100664035 3300005719 Bacteria 964
55 Ga0068861_100727106 3300005719 Bacteria 925
56 Ga0068863_100498060 3300005841 Bacteria 1199
57 Ga0068858_101462580 3300005842 Bacteria 674
58 Ga0068860_100470553 3300005843 Bacteria 1251
59 Ga0068862_100941101 3300005844 Bacteria 851
60 Ga0081455_10013901 3300005937 Bacteria 7912
61 Ga0081455_10070045 3300005937 Bacteria 2913
62 Ga0081540_1001547 3300005983 Bacteria 19711
63 Ga0081540_1001775 3300005983 Bacteria 18107
64 Ga0081540_1004293 3300005983 Bacteria 10919
65 Ga0081540_1009840 3300005983 Bacteria 6539
66 Ga0081540_1016269 3300005983 Bacteria 4662
67 Ga0081540_1016497 3300005983 Bacteria 4618
68 Ga0081540_1019159 3300005983 Bacteria 4171
69 Ga0081540_1020259 3300005983 Bacteria 4009
70 Ga0081540_1021491 3300005983 Bacteria 3840
71 Ga0081540_1032014 3300005983 Bacteria 2878
72 Ga0081540_1034822 3300005983 Bacteria 2708
73 Ga0081540_1044609 3300005983 Bacteria 2261
74 Ga0081540_1090983 3300005983 Bacteria 1342
75 Ga0081540_1122584 3300005983 Bacteria 1076
76 Ga0081539_10079898 3300005985 Bacteria 1722
77 Ga0070717_10592288 3300006028 Bacteria 1006
78 Ga0075365_10040034 3300006038 Bacteria 3055
79 Ga0075365_10067236 3300006038 Bacteria 2405
80 Ga0075365_10120384 3300006038 Bacteria 1810
81 Ga0075365_10197606 3300006038 Bacteria 1408
82 Ga0075365_10230357 3300006038 Bacteria 1300
83 Ga0075365_10263336 3300006038 Bacteria 1212
84 Ga0075368_10004782 3300006042 Bacteria 4612
85 Ga0075368_10014349 3300006042 Bacteria 2924
86 Ga0075368_10152589 3300006042 Bacteria 965
87 Ga0075363_100011676 3300006048 Bacteria 4214
88 Ga0075363_100014273 3300006048 Bacteria 3876
89 Ga0075364_10075980 3300006051 Bacteria 2216
90 Ga0075364_10106931 3300006051 Bacteria 1864
91 Ga0075364_10789447 3300006051 Bacteria 647
92 Ga0075364_10807272 3300006051 Bacteria 639
93 Ga0070715_10037616 3300006163 Bacteria 2004
94 Ga0070716_100012392 3300006173 Bacteria 4322
95 Ga0070712_100087140 3300006175 Bacteria 2277
96 Ga0070712_100092046 3300006175 Bacteria 2223
97 Ga0075362_10107845 3300006177 Bacteria 1308
98 Ga0075362_10133034 3300006177 Unclassified 1184
99 Ga0075362_10274101 3300006177 Bacteria 833
100 Ga0075362_10705487 3300006177 Bacteria 526
101 Ga0075367_10008337 3300006178 Bacteria 5369
102 Ga0075367_10008564 3300006178 Bacteria 5305
103 Ga0075367_10173603 3300006178 Bacteria 1343
104 Ga0075367_10208275 3300006178 Bacteria 1222
105 Ga0075367_10420090 3300006178 Bacteria 846
106 Ga0075369_10021437 3300006186 Bacteria 2656
107 Ga0075369_10152094 3300006186 Bacteria 1058
108 Ga0075369_10195165 3300006186 Bacteria 934
109 Ga0075369_10266015 3300006186 Bacteria 797
110 Ga0075366_10092476 3300006195 Bacteria 1812
111 Ga0075366_10122481 3300006195 Bacteria 1567
112 Ga0075366_10396366 3300006195 Bacteria 849
113 Ga0097621_100086348 3300006237 Unclassified 2619
114 Ga0075370_10155602 3300006353 Bacteria 1340
115 Ga0075370_10269029 3300006353 Bacteria 1011
116 Ga0075370_10363082 3300006353 Bacteria 866
117 Ga0068871_100159264 3300006358 Bacteria 1930
118 Ga0075428_100008629 3300006844 Bacteria 11302
119 Ga0075431_100026840 3300006847 Bacteria 5906
120 Ga0075429_101731191 3300006880 Bacteria 543
121 Ga0068865_100756620 3300006881 Bacteria 835
122 Ga0068865_100775511 3300006881 Unclassified 825
123 Ga0068865_101589025 3300006881 Bacteria 587
124 Ga0097620_100093954 3300006931 Bacteria 3050
125 Ga0105240_10521374 3300009093 Bacteria 1319
126 Ga0111539_10436622 3300009094 Bacteria 1525
127 Ga0105245_10011273 3300009098 Bacteria 7784
128 Ga0105245_10746483 3300009098 Bacteria 1014
129 Ga0105247_10572345 3300009101 Bacteria 834
130 Ga0114129_10145709 3300009147 Bacteria 3244
131 Ga0114129_10323311 3300009147 Bacteria 2050
132 Ga0114129_12023855 3300009147 Bacteria 696
133 Ga0105243_10419865 3300009148 Bacteria 1247
134 Ga0105243_10712456 3300009148 Bacteria 980
135 Ga0105237_10068275 3300009545 Bacteria 3549
136 Ga0105237_10126655 3300009545 Bacteria 2548
137 Ga0105238_10308494 3300009551 Bacteria 1567
138 Ga0105249_10838288 3300009553 Bacteria 985
139 Ga0099796_10115678 3300010159 Bacteria 1025
140 Ga0105239_10277642 3300010375 Bacteria 1886
141 Ga0105239_10339549 3300010375 Bacteria 1695
142 Ga0105239_10434872 3300010375 Bacteria 1487
143 Ga0157378_10194058 3300013297 Bacteria 1917
144 Ga0163162_10876870 3300013306 Bacteria 1012
145 Ga0157375_12157755 3300013308 Unclassified 663
146 Ga0157375_12720663 3300013308 Bacteria 591
147 Ga0163163_12466386 3300014325 Bacteria 578
148 Ga0157380_10333605 3300014326 Bacteria 1411
149 Ga0157380_11360741 3300014326 Bacteria 759
150 Ga0157379_10901927 3300014968 Bacteria 839
151 Ga0214544_1027977 3300021320 Bacteria 2262
152 Ga0214542_1026457 3300021321 Bacteria 2831
153 Ga0214545_1025145 3300021324 Bacteria 3513
154 Ga0214543_1024854 3300021327 Bacteria 3597
155 Ga0213872_10123855 3300021361 Bacteria 1142
156 Ga0213871_10002050 3300021441 Bacteria 3611
157 Ga0209148_1000333 3300025254 Bacteria 64490
158 Ga0209233_1017409 3300025261 Bacteria 1959
159 Ga0209233_1033412 3300025261 Bacteria 1181
160 Ga0209455_1001261 3300025272 Bacteria 11871
161 Ga0209564_1015663 3300025295 Bacteria 3068
162 Ga0209758_1000074 3300025297 Bacteria 275577
163 Ga0209758_1000109 3300025297 Bacteria 214759
164 Ga0209758_1005697 3300025297 Bacteria 9410
165 Ga0209758_1005871 3300025297 Bacteria 9162
166 Ga0209758_1033851 3300025297 Bacteria 2044
167 Ga0209758_1116989 3300025297 Bacteria 726
168 Ga0209256_1005669 3300025299 Bacteria 7031
169 Ga0207426_1002302 3300025302 Bacteria 12561
170 Ga0207426_1043071 3300025302 Bacteria 1389
171 Ga0207426_1074160 3300025302 Bacteria 940
172 Ga0207426_1109507 3300025302 Bacteria 698
173 Ga0209257_1001604 3300025304 Bacteria 25883
174 Ga0207692_10013363 3300025898 Bacteria 3560
175 Ga0207685_10087909 3300025905 Bacteria 1301
176 Ga0207699_10025436 3300025906 Bacteria 3250
177 Ga0207699_10033253 3300025906 Bacteria 2913
178 Ga0207645_11003044 3300025907 Bacteria 565
179 Ga0207684_10192411 3300025910 Bacteria 1760
180 Ga0207671_10195887 3300025914 Bacteria 1577
181 Ga0207671_10197592 3300025914 Bacteria 1570
182 Ga0207693_10107815 3300025915 Bacteria 2185
183 Ga0207693_10974136 3300025915 Bacteria 648
184 Ga0207663_10158815 3300025916 Bacteria 1593
185 Ga0207662_10963761 3300025918 Bacteria 605
186 Ga0207657_10937732 3300025919 Bacteria 666
187 Ga0207646_10065943 3300025922 Bacteria 3232
188 Ga0207687_10017727 3300025927 Bacteria 4693
189 Ga0207700_10029482 3300025928 Bacteria 3873
190 Ga0207700_10060213 3300025928 Bacteria 2875
191 Ga0207700_10221913 3300025928 Bacteria 1603
192 Ga0207664_10118826 3300025929 Bacteria 2209
193 Ga0207664_10411700 3300025929 Bacteria 1203
194 Ga0207706_10357987 3300025933 Bacteria 1268
195 Ga0207686_11121371 3300025934 Bacteria 642
196 Ga0207709_10674566 3300025935 Bacteria 825
197 Ga0207709_11541558 3300025935 Bacteria 552
198 Ga0207670_11113030 3300025936 Bacteria 667
199 Ga0207704_10589500 3300025938 Unclassified 909
200 Ga0207704_11182048 3300025938 Bacteria 652
201 Ga0207665_10014723 3300025939 Bacteria 5144
202 Ga0207689_10335883 3300025942 Bacteria 1255
203 Ga0207651_10525421 3300025960 Bacteria 1026
204 Ga0207658_10346136 3300025986 Bacteria 1293
205 Ga0207677_10650771 3300026023 Bacteria 930
206 Ga0207677_10669161 3300026023 Bacteria 918
207 Ga0207703_10042729 3300026035 Bacteria 3636
208 Ga0207703_10304537 3300026035 Bacteria 1454
209 Ga0207703_10921474 3300026035 Bacteria 837
210 Ga0207703_11949489 3300026035 Bacteria 564
211 Ga0207639_10297165 3300026041 Bacteria 1426
212 Ga0207678_11414491 3300026067 Bacteria 615
213 Ga0207708_11439916 3300026075 Bacteria 605
214 Ga0207702_10469307 3300026078 Unclassified 1223
215 Ga0207675_100050673 3300026118 Bacteria 3874
216 Ga0207675_100438575 3300026118 Bacteria 1292
217 Ga0207683_10094037 3300026121 Bacteria 2671
218 Ga0209179_1040569 3300027512 Bacteria 979
219 Ga0209813_10001872 3300027866 Bacteria 4750
220 Ga0268266_11018367 3300028379 Bacteria 801
221 Ga0268265_10894763 3300028380 Bacteria 871
222 Ga0307515_10022977 3300028794 Bacteria 10964
223 Ga0307515_10575693 3300028794 Bacteria 736
224 Ga0307511_10167587 3300030521 Bacteria 1216
225 Ga0307512_10274543 3300030522 Bacteria 813
226 Ga0265763_1013541 3300030763 Bacteria 791
227 Ga0307509_10161098 3300031507 Bacteria 2141
228 Ga0307509_10286140 3300031507 Bacteria 1406
229 Ga0307509_10415509 3300031507 Bacteria 1047
230 Ga0307408_101048074 3300031548 Bacteria 754
231 Ga0307405_11894632 3300031731 Bacteria 532
232 Ga0307406_10103348 3300031901 Bacteria 1946
233 Ga0307412_10903343 3300031911 Bacteria 774
234 Ga0307412_11407075 3300031911 Bacteria 631
235 Ga0307409_101401925 3300031995 Bacteria 725
236 Ga0307415_100343711 3300032126 Bacteria 1253
237 Ga0307507_10029194 3300033179 Bacteria 5854
238 Ga0307510_10169793 3300033180 Bacteria 1762
239 Ga0307510_10401460 3300033180 Bacteria 814
240 Ga0307510_10490332 3300033180 Bacteria 671
241 Ga0373949_0190854 3300035090 Bacteria 611
242 Ga0373951_0221139 3300035091 Bacteria 559
243 Ga0373943_0508841 3300035170 Bacteria 704
244 Ga0373946_0185714 3300035171 Bacteria 989
245 Ga0373931_0379806 3300035691 Bacteria 890
246 Ga0373931_0695870 3300035691 Bacteria 671
247 Ga0373927_0088415 3300035695 Bacteria 2011
248 Ga0373947_0029772 3300035725 Bacteria 3205
249 Ga0372808_026346 3300036459 Bacteria 835
250 Ga0373925_0105936 3300037068 Bacteria 2167
251 Ga0395905_0778120 3300037471 Bacteria 860
252 Ga0436365_1082098 3300039437 Bacteria 806
253 Ga0436360_0639185 3300039438 Bacteria 5975
254 Ga0436360_0895299 3300039438 Bacteria 788
255 Ga0436361_0013825 3300039447 Bacteria 1404
256 Ga0436361_0376036 3300039447 Bacteria 718
257 Ga0436363_1271563 3300039450 Bacteria 874
258 Ga0436363_1431306 3300039450 Bacteria 2308
259 Ga0436362_0240197 3300039453 Bacteria 544
260 Ga0451789_0234065 3300041443 Bacteria 537
261 Ga0451797_1549951 3300041453 Bacteria 585
262 Ga0451804_0845905 3300041463 Bacteria 577
263 Ga0451833_1103218 3300041491 Bacteria 730
264 Ga0466968_0195636 3300044735 Bacteria 945
265 Ga0466960_0519100 3300044901 Bacteria 700
266 Ga0466959_1134252 3300045049 Bacteria 520
267 Ga0466967_1224477 3300045976 Bacteria 748
268 Ga0495638_0030995 3300046460 Bacteria 3438
269 Ga0495641_0226008 3300046461 Bacteria 840
270 Ga0495641_0365808 3300046461 Bacteria 653
271 Ga0495650_0067071 3300046471 Bacteria 1419
272 Ga0495605_0264669 3300046474 Bacteria 733
273 Ga0495639_0108897 3300046475 Bacteria 1313
274 Ga0495596_0214018 3300046500 Bacteria 748
275 Ga0495583_0436410 3300046506 Bacteria 513
276 Ga0495606_0004129 3300046507 Bacteria 14748
277 Ga0495610_0179661 3300046512 Bacteria 881
278 Ga0495610_0360832 3300046512 Bacteria 545
279 Ga0495616_0089595 3300046513 Bacteria 1459
280 Ga0495628_0900518 3300046516 Bacteria 614
281 Ga0495631_0285544 3300046518 Bacteria 702
282 Ga0495632_0014504 3300046519 Bacteria 4453
283 Ga0495632_0249640 3300046519 Bacteria 796
284 Ga0495643_0106226 3300046522 Bacteria 1433
285 Ga0495643_0217122 3300046522 Bacteria 909
286 Ga0495643_0372528 3300046522 Bacteria 635
287 Ga0495644_0109939 3300046523 Bacteria 1045
288 Ga0495648_0005296 3300046524 Bacteria 10763
289 Ga0495648_0277342 3300046524 Bacteria 796
290 Ga0495642_0456337 3300046528 Bacteria 565
291 Ga0495598_0005681 3300046537 Bacteria 2781
292 Ga0495609_0430940 3300046538 Bacteria 525
293 Ga0495622_0062246 3300046557 Bacteria 1727
294 Ga0495622_0339939 3300046557 Bacteria 650
295 Ga0495633_0114718 3300046558 Bacteria 1249
296 Ga0495656_0025123 3300046615 Bacteria 2359
297 Ga0495656_0498831 3300046615 Bacteria 645
298 Ga0495668_0352179 3300046616 Bacteria 808
299 Ga0495625_0031132 3300046660 Bacteria 3971
300 Ga0495625_0503967 3300046660 Bacteria 740
301 Ga0495625_0546433 3300046660 Bacteria 702
302 Ga0495649_0187057 3300046694 Bacteria 1079
303 Ga0495589_0274165 3300046794 Bacteria 785
304 Ga0495660_0080518 3300046810 Bacteria 1709
305 Ga0495581_0288778 3300047315 Bacteria 959
306 Ga0495674_1488520 3300047319 Bacteria 501
307 Ga0495672_0008801 3300047320 Bacteria 7392
308 Ga0495672_0161193 3300047320 Bacteria 1153
309 Ga0495672_0336526 3300047320 Bacteria 705
310 Ga0495679_061568 3300047446 Bacteria 1099
311 Ga0495673_0273661 3300047469 Bacteria 611
312 Ga0495684_0716534 3300047471 Unclassified 662
313 Ga0495686_0170809 3300047472 Bacteria 1265
314 Ga0495626_0265027 3300048091 Bacteria 686
315 Ga0496100_1607984 3300048903 Bacteria 514
316 Ga0496104_0097881 3300048907 Bacteria 2808
317 Ga0496104_1493195 3300048907 Bacteria 579
318 Ga0496106_0984688 3300048909 Bacteria 664
319 Ga0496110_1288171 3300048913 Bacteria 640
320 Ga0496112_0000054 3300048915 Bacteria 79516
321 Ga0496112_1396456 3300048915 Bacteria 615
322 Ga0496115_0369955 3300048918 Bacteria 1167
323 Ga0496116_0337448 3300048919 Bacteria 697
324 Ga0496118_0264638 3300048921 Bacteria 968
325 Ga0496121_0123607 3300048924 Bacteria 1950
326 Ga0496121_0150167 3300048924 Bacteria 1715
327 Ga0496121_0171477 3300048924 Bacteria 1575
328 Ga0496125_0039186 3300048928 Bacteria 4085
329 Ga0496125_0251093 3300048928 Bacteria 1116
330 Ga0496126_0003769 3300048929 Bacteria 18829
331 Ga0496126_0146520 3300048929 Bacteria 2027
332 Ga0496126_0316600 3300048929 Bacteria 1284
333 Ga0496126_0963376 3300048929 Bacteria 643
334 Ga0501034_0624902 3300049571 Bacteria 981
335 nmdc:mga03683_13803_c1 3300050489 Bacteria 2978
336 nmdc:mga03683_241897_c1 3300050489 Bacteria 837
337 nmdc:mga03683_381502_c1 3300050489 Bacteria 671
338 nmdc:mga03n38_13756_c1 3300050490 Bacteria 3083
339 nmdc:mga03n38_59829_c1 3300050490 Bacteria 1730
340 nmdc:mga03n38_7943_c1 3300050490 Bacteria 3778
341 nmdc:mga00v17_109270_c1 3300050491 Bacteria 1753
342 nmdc:mga00v17_180417_c1 3300050491 Bacteria 1362
343 nmdc:mga00v17_46603_c1 3300050491 Bacteria 2623
344 nmdc:mga00v17_757093_c1 3300050491 Bacteria 621
345 nmdc:mga0yw44_16840_c1 3300050492 Bacteria 3960
346 nmdc:mga0yw44_258786_c1 3300050492 Bacteria 1159
347 nmdc:mga0yw44_700527_c1 3300050492 Bacteria 688
348 nmdc:mga0yw44_73194_c1 3300050492 Bacteria 2131
349 nmdc:mga0yw44_737558_c1 3300050492 Bacteria 669
350 nmdc:mga0yw44_821847_c1 3300050492 Bacteria 631
351 nmdc:mga06z11_10159_c1 3300050494 Bacteria 3996
352 nmdc:mga06z11_144468_c1 3300050494 Bacteria 1347
353 nmdc:mga06z11_338943_c1 3300050494 Bacteria 899
354 nmdc:mga06z11_44946_c1 3300050494 Bacteria 2230
355 nmdc:mga06z11_5049_c1 3300050494 Bacteria 5251
356 nmdc:mga06z11_70938_c1 3300050494 Bacteria 1843
357 nmdc:mga04h51_2181_c1 3300050495 Bacteria 4592
358 nmdc:mga07m45_142608_c1 3300050496 Bacteria 1388
359 nmdc:mga07m45_465000_c1 3300050496 Bacteria 733
360 nmdc:mga07m45_67210_c1 3300050496 Bacteria 2037
361 nmdc:mga06r32_625299_c1 3300050510 Bacteria 1046
362 nmdc:mga06r32_73969_c1 3300050510 Bacteria 3302
363 nmdc:mga08y16_1740474_c1 3300050511 Bacteria 578
364 nmdc:mga0n895_1547467_c1 3300050512 Bacteria 628
365 nmdc:mga0rr50_233558_c1 3300050513 Bacteria 1522
366 nmdc:mga0sz30_298178_c1 3300050516 Bacteria 719
367 nmdc:mga0sz30_309384_c1 3300050516 Bacteria 705
368 Ga0495655_0067924 3300053083 Bacteria 989
369 Ga0500647_0041221 3300053091 Bacteria 2215
370 Ga0500647_0351904 3300053091 Unclassified 613
371 Ga0500583_0082234 3300053092 Bacteria 1557
372 Ga0500583_0092902 3300053092 Bacteria 1470
373 Ga0500651_0176694 3300053093 Bacteria 1270
374 Ga0500651_0662692 3300053093 Bacteria 561
375 Ga0500566_0368089 3300053094 Bacteria 653
376 Ga0500650_0315205 3300053098 Bacteria 690
377 Ga0500650_0330555 3300053098 Bacteria 670
378 Ga0500555_108607 3300053103 Bacteria 700
379 Ga0500557_254953 3300053105 Bacteria 547
380 Ga0500562_090330 3300053108 Bacteria 831
381 Ga0500595_110358 3300053119 Bacteria 783
382 Ga0500597_202575 3300053120 Bacteria 833
383 Ga0500597_271298 3300053120 Bacteria 687
384 Ga0500607_106214 3300053121 Bacteria 1385
385 Ga0500614_013434 3300053123 Bacteria 1799
386 Ga0500642_0007562 3300053130 Bacteria 3660
387 Ga0500642_0074235 3300053130 Bacteria 1552
388 Ga0500652_119390 3300053131 Bacteria 1102
389 Ga0500658_0089987 3300053134 Bacteria 1326
390 Ga0500559_0028319 3300053136 Bacteria 2393
391 Ga0500559_0031590 3300053136 Bacteria 2272
392 Ga0500573_0082894 3300053140 Bacteria 1820
393 Ga0500589_333470 3300053147 Bacteria 526
394 Ga0500590_355180 3300053148 Bacteria 522
395 Ga0500603_157174 3300053150 Bacteria 708
396 Ga0500603_315351 3300053150 Bacteria 508
397 Ga0500604_0013734 3300053151 Bacteria 2197
398 Ga0500604_0318598 3300053151 Bacteria 540
399 Ga0500619_003690 3300053154 Bacteria 3178
400 Ga0500620_000162 3300053155 Bacteria 13386
401 Ga0500620_004527 3300053155 Bacteria 3117
402 Ga0500634_0218049 3300053161 Bacteria 822
403 Ga0500636_0051749 3300053177 Bacteria 2414
404 Ga0500636_0177963 3300053177 Bacteria 1144
405 Ga0500636_0311327 3300053177 Bacteria 770
406 Ga0500637_0250545 3300053178 Bacteria 988
407 Ga0500625_016313 3300053729 Bacteria 3457
408 Ga0500645_055524 3300053730 Bacteria 1150
409 Ga0500661_004541 3300055283 Bacteria 2595
410 2509373592 2509276018 Bacteria 6910194
411 2510313991 2510065059 Bacteria 6847884
412 2511396733 2511231028 Bacteria 8046582
413 2514034761 2513237164 Bacteria 7563725
414 2524464709 2524023210 Bacteria 9029266
415 2617349563 2617270735 Bacteria 9163226
416 2617376754 2617270741 Bacteria 8201522
417 2643987976 2643221595 Bacteria 6565519
418 2644158146 2643221627 Bacteria 6761570
419 2688597648 2687453392 Bacteria 6880454
420 2793077509
421 2824685224 2824679649 Bacteria 8248951
422 2824738758 2824732956 Bacteria 7810675
423 2824749757 2824746037 Bacteria 7911610
424 2838130506 2838122688 Bacteria 8803140
425 2841942187 2841941048 Bacteria 8688029
426 2841955353 2841949485 Bacteria 8680857
427 2841971290 2841966195 Bacteria 8673214
428 2841981582 2841974524 Bacteria 8931498
429 2841987110 2841983080 Bacteria 8395090
430 2844008116 2844002411 Bacteria 7168230
431 2856333546 2856328259 Bacteria 6528202
432 2856337951 2856334872 Bacteria 7037011
433 2857368964 2857367948 Bacteria 6965560
434 2869254375 2869249662 Bacteria 6868783
435 2869270541 2869264136 Bacteria 6880765
436 2869272930 2869271264 Bacteria 6908218
437 2871437956 2871435913 Bacteria 6880295
438 2871466124 2871459585 Bacteria 6866887
439 2874116241 2874109183 Bacteria 6517025
440 2874165372 2874162495 Bacteria 6174670
441 2876370991 2876369609 Bacteria 6807521
442 2876402908 2876399893 Bacteria 6927900
443 2876407495 2876406927 Bacteria 6191900
444 2878777488 2878774303 Bacteria 6108671
445 2881150934 2881147464 Bacteria 7779814
446 2885308693 2885305155 Bacteria 7348390
447 2885312533 2885312484 Bacteria 6415165
448 2885340510 2885334103 Bacteria 7216818
449 2885391602 2885383462 Bacteria 9473874
450 2903734228 2903727486 Bacteria 8281579
451 2906364720 2906363423 Bacteria 6856682
452 2906377203 2906370794 Bacteria 6881062
453 2906390173 2906386501 Bacteria 5977019
454 2906412529 2906408224 Bacteria 6162342
455 2908758023 2908756301 Bacteria 8864324
456 2908782649 2908775508 Bacteria 8092255
457 2922175845 2922172374 Bacteria 6167644
458 2924713320 2924710171 Bacteria 6752351
459 2924752697 2924748358 Bacteria 6154725
460 2924769165 2924762789 Bacteria 6561353
461 2937828887 2937822353 Bacteria 7290551
462 2937871201 2937868953 Bacteria 6639878
463 2958128024 2958122699 Bacteria 7280457
464 2958161718 2958158011 Bacteria 6058449
465 2961141547 2961136820 Bacteria 6775228
466 2965025839 2965025482 Bacteria 6532201
467 2965036806 2965032056 Bacteria 6887443
468 2965042845 2965040258 Bacteria 6855979
469 2965050363 2965047637 Bacteria 6623551
470 2965091676 2965089291 Bacteria 6866420
471 2965108537 2965102966 Bacteria 6800987
472 2968140759 2968138860 Bacteria 6605449
473 2970493413 2970489779 Bacteria 6517260
474 2970511197 2970510686 Bacteria 7006402
475 2970551532 2970547951 Bacteria 6931819
476 2970619580 2970619444 Bacteria 6986144
477 2977865433 2977864932 Bacteria 7534097
478 2977878024 2977872689 Bacteria 7270173
479 2977939078 2977935797 Bacteria 6252826
480 2977954710 2977950692 Bacteria 6893264
481 2977959360 2977957713 Bacteria 6877875
482 2987645663 2987645492 Bacteria 6117018
483 2987673016 2987666974 Bacteria 6509233
484 2996388541 2996386984 Bacteria 6978667
485 3004232851 3004232784 Bacteria 6662140
486 3004244343 3004239961 Bacteria 6892290
487 3005716800 3005710791 Bacteria 7622528
488 649872192 649633066 Bacteria 6690028
489 8004306916 8004300914 Bacteria 6132239
490 8004362908 8004361976 Bacteria 6858373
491 8056695518 8056689827 Bacteria 6712655
492 Ga0495663_0090142
493 JGI25153J46596_10000650
494 JGI25160J50197_1003414
495 JGI25404J52841_10001177
496 JGI25404J52841_10032831
497 JGI25404J52841_10040666
498 JGI25404J52841_10118586
499 Ga0055542_1005931
500 Ga0055529_1021133
501 Ga0055543_1003288
502 Ga0065165_1002612
503 Ga0065165_1052930
504 Ga0068869_100539496
505 Ga0070666_10665163
506 Ga0068868_100040311
507 Ga0070660_101232094
508 Ga0070692_10922650
509 Ga0070668_100108248
510 Ga0070668_101089912
511 Ga0070669_100933324
512 Ga0070671_100530555
513 Ga0070673_101978852
514 Ga0070709_10004853
515 Ga0070709_11677013
516 Ga0070714_100016984
517 Ga0070714_102001981
518 Ga0070713_100037832
519 Ga0070713_100374388
520 Ga0070710_10005305
521 Ga0070711_100040649
522 Ga0070711_101098703
523 Ga0070700_101288481
524 Ga0070708_101243768
525 Ga0070662_101325980
526 Ga0068867_100942504
527 Ga0070707_100960480
528 Ga0070698_100073757
529 Ga0070698_100395809
530 Ga0070679_100788728
531 Ga0070684_100451754
532 Ga0070697_102040165
533 Ga0070672_101345099
534 Ga0070686_100421548
535 Ga0070695_100959065
536 Ga0070696_100425018
537 Ga0070665_101635941
538 Ga0068856_101351775
539 Ga0070702_100241172
540 Ga0070702_100307612
541 Ga0068859_100093957
542 Ga0068866_10475543
543 Ga0068861_100354910
544 Ga0068861_100632958
545 Ga0068861_100664035
546 Ga0068861_100727106
547 Ga0068863_100498060
548 Ga0068858_101462580
549 Ga0068860_100470553
550 Ga0068862_100941101
551 Ga0081455_10013901
552 Ga0081455_10070045
553 Ga0081540_1001547
554 Ga0081540_1001775
555 Ga0081540_1004293
556 Ga0081540_1009840
557 Ga0081540_1016269
558 Ga0081540_1016497
559 Ga0081540_1019159
560 Ga0081540_1020259
561 Ga0081540_1021491
562 Ga0081540_1032014
563 Ga0081540_1034822
564 Ga0081540_1044609
565 Ga0081540_1090983
566 Ga0081540_1122584
567 Ga0081539_10079898
568 Ga0070717_10592288
569 Ga0075365_10040034
570 Ga0075365_10067236
571 Ga0075365_10120384
572 Ga0075365_10197606
573 Ga0075365_10230357
574 Ga0075365_10263336
575 Ga0075368_10004782
576 Ga0075368_10014349
577 Ga0075368_10152589
578 Ga0075363_100011676
579 Ga0075363_100014273
580 Ga0075364_10075980
581 Ga0075364_10106931
582 Ga0075364_10789447
583 Ga0075364_10807272
584 Ga0070715_10037616
585 Ga0070716_100012392
586 Ga0070712_100087140
587 Ga0070712_100092046
588 Ga0075362_10107845
589 Ga0075362_10133034
590 Ga0075362_10274101
591 Ga0075362_10705487
592 Ga0075367_10008337
593 Ga0075367_10008564
594 Ga0075367_10173603
595 Ga0075367_10208275
596 Ga0075367_10420090
597 Ga0075369_10021437
598 Ga0075369_10152094
599 Ga0075369_10195165
600 Ga0075369_10266015
601 Ga0075366_10092476
602 Ga0075366_10122481
603 Ga0075366_10396366
604 Ga0097621_100086348
605 Ga0075370_10155602
606 Ga0075370_10269029
607 Ga0075370_10363082
608 Ga0068871_100159264
609 Ga0075428_100008629
610 Ga0075431_100026840
611 Ga0075429_101731191
612 Ga0068865_100756620
613 Ga0068865_100775511
614 Ga0068865_101589025
615 Ga0097620_100093954
616 Ga0105240_10521374
617 Ga0111539_10436622
618 Ga0105245_10011273
619 Ga0105245_10746483
620 Ga0105247_10572345
621 Ga0114129_10145709
622 Ga0114129_10323311
623 Ga0114129_12023855
624 Ga0105243_10419865
625 Ga0105243_10712456
626 Ga0105237_10068275
627 Ga0105237_10126655
628 Ga0105238_10308494
629 Ga0105249_10838288
630 Ga0099796_10115678
631 Ga0105239_10277642
632 Ga0105239_10339549
633 Ga0105239_10434872
634 Ga0157378_10194058
635 Ga0163162_10876870
636 Ga0157375_12157755
637 Ga0157375_12720663
638 Ga0163163_12466386
639 Ga0157380_10333605
640 Ga0157380_11360741
641 Ga0157379_10901927
642 Ga0214544_1027977
643 Ga0214542_1026457
644 Ga0214545_1025145
645 Ga0214543_1024854
646 Ga0213872_10123855
647 Ga0213871_10002050
648 Ga0209148_1000333
649 Ga0209233_1017409
650 Ga0209233_1033412
651 Ga0209455_1001261
652 Ga0209564_1015663
653 Ga0209758_1000074
654 Ga0209758_1000109
655 Ga0209758_1005697
656 Ga0209758_1005871
657 Ga0209758_1033851
658 Ga0209758_1116989
659 Ga0209256_1005669
660 Ga0207426_1002302
661 Ga0207426_1043071
662 Ga0207426_1074160
663 Ga0207426_1109507
664 Ga0209257_1001604
665 Ga0207692_10013363
666 Ga0207685_10087909
667 Ga0207699_10025436
668 Ga0207699_10033253
669 Ga0207645_11003044
670 Ga0207684_10192411
671 Ga0207671_10195887
672 Ga0207671_10197592
673 Ga0207693_10107815
674 Ga0207693_10974136
675 Ga0207663_10158815
676 Ga0207662_10963761
677 Ga0207657_10937732
678 Ga0207646_10065943
679 Ga0207687_10017727
680 Ga0207700_10029482
681 Ga0207700_10060213
682 Ga0207700_10221913
683 Ga0207664_10118826
684 Ga0207664_10411700
685 Ga0207706_10357987
686 Ga0207686_11121371
687 Ga0207709_10674566
688 Ga0207709_11541558
689 Ga0207670_11113030
690 Ga0207704_10589500
691 Ga0207704_11182048
692 Ga0207665_10014723
693 Ga0207689_10335883
694 Ga0207651_10525421
695 Ga0207658_10346136
696 Ga0207677_10650771
697 Ga0207677_10669161
698 Ga0207703_10042729
699 Ga0207703_10304537
700 Ga0207703_10921474
701 Ga0207703_11949489
702 Ga0207639_10297165
703 Ga0207678_11414491
704 Ga0207708_11439916
705 Ga0207702_10469307
706 Ga0207675_100050673
707 Ga0207675_100438575
708 Ga0207683_10094037
709 Ga0209179_1040569
710 Ga0209813_10001872
711 Ga0268266_11018367
712 Ga0268265_10894763
713 Ga0307515_10022977
714 Ga0307515_10575693
715 Ga0307511_10167587
716 Ga0307512_10274543
717 Ga0265763_1013541
718 Ga0307509_10161098
719 Ga0307509_10286140
720 Ga0307509_10415509
721 Ga0307408_101048074
722 Ga0307405_11894632
723 Ga0307406_10103348
724 Ga0307412_10903343
725 Ga0307412_11407075
726 Ga0307409_101401925
727 Ga0307415_100343711
728 Ga0307507_10029194
729 Ga0307510_10169793
730 Ga0307510_10401460
731 Ga0307510_10490332
732 Ga0373949_0190854
733 Ga0373951_0221139
734 Ga0373943_0508841
735 Ga0373946_0185714
736 Ga0373931_0379806
737 Ga0373931_0695870
738 Ga0373927_0088415
739 Ga0373947_0029772
740 Ga0372808_026346
741 Ga0373925_0105936
742 Ga0395905_0778120
743 Ga0436365_1082098
744 Ga0436360_0639185
745 Ga0436360_0895299
746 Ga0436361_0013825
747 Ga0436361_0376036
748 Ga0436363_1271563
749 Ga0436363_1431306
750 Ga0436362_0240197
751 Ga0451789_0234065
752 Ga0451797_1549951
753 Ga0451804_0845905
754 Ga0451833_1103218
755 Ga0466968_0195636
756 Ga0466960_0519100
757 Ga0466959_1134252
758 Ga0466967_1224477
759 Ga0495638_0030995
760 Ga0495641_0226008
761 Ga0495641_0365808
762 Ga0495650_0067071
763 Ga0495605_0264669
764 Ga0495639_0108897
765 Ga0495596_0214018
766 Ga0495583_0436410
767 Ga0495606_0004129
768 Ga0495610_0179661
769 Ga0495610_0360832
770 Ga0495616_0089595
771 Ga0495628_0900518
772 Ga0495631_0285544
773 Ga0495632_0014504
774 Ga0495632_0249640
775 Ga0495643_0106226
776 Ga0495643_0217122
777 Ga0495643_0372528
778 Ga0495644_0109939
779 Ga0495648_0005296
780 Ga0495648_0277342
781 Ga0495642_0456337
782 Ga0495598_0005681
783 Ga0495609_0430940
784 Ga0495622_0062246
785 Ga0495622_0339939
786 Ga0495633_0114718
787 Ga0495656_0025123
788 Ga0495656_0498831
789 Ga0495668_0352179
790 Ga0495625_0031132
791 Ga0495625_0503967
792 Ga0495625_0546433
793 Ga0495649_0187057
794 Ga0495589_0274165
795 Ga0495660_0080518
796 Ga0495581_0288778
797 Ga0495674_1488520
798 Ga0495672_0008801
799 Ga0495672_0161193
800 Ga0495672_0336526
801 Ga0495679_061568
802 Ga0495673_0273661
803 Ga0495684_0716534
804 Ga0495686_0170809
805 Ga0495626_0265027
806 Ga0496100_1607984
807 Ga0496104_0097881
808 Ga0496104_1493195
809 Ga0496106_0984688
810 Ga0496110_1288171
811 Ga0496112_0000054
812 Ga0496112_1396456
813 Ga0496115_0369955
814 Ga0496116_0337448
815 Ga0496118_0264638
816 Ga0496121_0123607
817 Ga0496121_0150167
818 Ga0496121_0171477
819 Ga0496125_0039186
820 Ga0496125_0251093
821 Ga0496126_0003769
822 Ga0496126_0146520
823 Ga0496126_0316600
824 Ga0496126_0963376
825 Ga0501034_0624902
826 nmdc:mga03683_13803_c1
827 nmdc:mga03683_241897_c1
828 nmdc:mga03683_381502_c1
829 nmdc:mga03n38_13756_c1
830 nmdc:mga03n38_59829_c1
831 nmdc:mga03n38_7943_c1
832 nmdc:mga00v17_109270_c1
833 nmdc:mga00v17_180417_c1
834 nmdc:mga00v17_46603_c1
835 nmdc:mga00v17_757093_c1
836 nmdc:mga0yw44_16840_c1
837 nmdc:mga0yw44_258786_c1
838 nmdc:mga0yw44_700527_c1
839 nmdc:mga0yw44_73194_c1
840 nmdc:mga0yw44_737558_c1
841 nmdc:mga0yw44_821847_c1
842 nmdc:mga06z11_10159_c1
843 nmdc:mga06z11_144468_c1
844 nmdc:mga06z11_338943_c1
845 nmdc:mga06z11_44946_c1
846 nmdc:mga06z11_5049_c1
847 nmdc:mga06z11_70938_c1
848 nmdc:mga04h51_2181_c1
849 nmdc:mga07m45_142608_c1
850 nmdc:mga07m45_465000_c1
851 nmdc:mga07m45_67210_c1
852 nmdc:mga06r32_625299_c1
853 nmdc:mga06r32_73969_c1
854 nmdc:mga08y16_1740474_c1
855 nmdc:mga0n895_1547467_c1
856 nmdc:mga0rr50_233558_c1
857 nmdc:mga0sz30_298178_c1
858 nmdc:mga0sz30_309384_c1
859 Ga0495655_0067924
860 Ga0500647_0041221
861 Ga0500647_0351904
862 Ga0500583_0082234
863 Ga0500583_0092902
864 Ga0500651_0176694
865 Ga0500651_0662692
866 Ga0500566_0368089
867 Ga0500650_0315205
868 Ga0500650_0330555
869 Ga0500555_108607
870 Ga0500557_254953
871 Ga0500562_090330
872 Ga0500595_110358
873 Ga0500597_202575
874 Ga0500597_271298
875 Ga0500607_106214
876 Ga0500614_013434
877 Ga0500642_0007562
878 Ga0500642_0074235
879 Ga0500652_119390
880 Ga0500658_0089987
881 Ga0500559_0028319
882 Ga0500559_0031590
883 Ga0500573_0082894
884 Ga0500589_333470
885 Ga0500590_355180
886 Ga0500603_157174
887 Ga0500603_315351
888 Ga0500604_0013734
889 Ga0500604_0318598
890 Ga0500619_003690
891 Ga0500620_000162
892 Ga0500620_004527
893 Ga0500634_0218049
894 Ga0500636_0051749
895 Ga0500636_0177963
896 Ga0500636_0311327
897 Ga0500637_0250545
898 Ga0500625_016313
899 Ga0500645_055524
900 Ga0500661_004541
901 2509373592
902 2510313991
903 2511396733
904 2514034761
905 2524464709
906 2617349563
907 2617376754
908 2643987976
909 2644158146
910 2688597648
911 2793077509
912 2824685224
913 2824738758
914 2824749757
915 2838130506
916 2841942187
917 2841955353
918 2841971290
919 2841981582
920 2841987110
921 2844008116
922 2856333546
923 2856337951
924 2857368964
925 2869254375
926 2869270541
927 2869272930
928 2871437956
929 2871466124
930 2874116241
931 2874165372
932 2876370991
933 2876402908
934 2876407495
935 2878777488
936 2881150934
937 2885308693
938 2885312533
939 2885340510
940 2885391602
941 2903734228
942 2906364720
943 2906377203
944 2906390173
945 2906412529
946 2908758023
947 2908782649
948 2922175845
949 2924713320
950 2924752697
951 2924769165
952 2937828887
953 2937871201
954 2958128024
955 2958161718
956 2961141547
957 2965025839
958 2965036806
959 2965042845
960 2965050363
961 2965091676
962 2965108537
963 2968140759
964 2970493413
965 2970511197
966 2970551532
967 2970619580
968 2977865433
969 2977878024
970 2977939078
971 2977954710
972 2977959360
973 2987645663
974 2987673016
975 2996388541
976 3004232851
977 3004244343
978 3005716800
979 649872192
980 8004306916
981 8004362908
982 8056695518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

8

123

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eek-assembly2.cif.gz_B c. ammoniagenes monoamine oxidase (mao) bound to tyramine 0.6833 61 74
6fsa-assembly2.cif.gz_B beta-cardiac myosin post-rigor 0.6695 60 74
8eej-assembly2.cif.gz_A c. ammoniagenes monoamine oxidase (mao) c424s variant bound to dopamine 0.6687 61 74
1syr-assembly4.cif.gz_H initial structural analysis of plasmodium falciparum thioredoxin 0.6686 6 73
2oe3-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6432 3 73
ID Description Score Start End Superfamily
4k22B01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7346 60 74 3.50.50.60
af_Q84P94_74_185_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.734 9 114 3.40.30.10
af_X1WG54_49_160_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7239 9 119 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7086 9 114 3.40.30.10
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7067 9 119 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A436BR88-F1-model_v4 DUF393 domain-containing protein 0.9924 6 110 GO:0015035
AF-A0A7R6WKY5-F1-model_v4 Thiol-disulfide oxidoreductase 0.9708 3 126 GO:0015035
AF-A0A436BR88-F1-model_v4 DUF393 domain-containing protein 0.965 6 110 GO:0015035
AF-A0A529I5X5-F1-model_v4 DUF393 domain-containing protein 0.9516 1 84 GO:0015035
AF-A0A7R6WKY5-F1-model_v4 Thiol-disulfide oxidoreductase 0.9483 3 126 GO:0015035

Map