F454128

General Info

Members Datasets Scaffolds Average Seq Length
491 277 982 98

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10199940|Ga0265316_101999402
Length 115
Sequence MAGGLHPAGRALYDEAMHPQAGQPRVQVENTNDYREGYANSVQVRTSLWDFFLLFGTIQQNSAEVVNVRQFQGIYLSPQQTKALSNLLLQNVQQYEATFGAINLQAQEGDPRTLQ

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
104 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
269 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
270 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 2.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.65
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 25.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10199940 3300031344 Bacteria 1482
2 MRS1b_contig_2731466 2162886011 Eukaryota 1184
3 MBSR1b_contig_201130 2162886012 Bacteria 5475
4 MBSR1b_contig_3160416 2162886012 Bacteria 6945
5 JGI24737J22298_10098867 3300001990 Unclassified 865
6 JGI24743J22301_10002914 3300001991 Unclassified 2644
7 JGI24748J21848_1014212 3300002074 Unclassified 945
8 JGI24035J26624_1043400 3300002126 Unclassified 505
9 JGI24034J26672_10000570 3300002239 Bacteria 4702
10 JGI24034J26672_10027669 3300002239 Unclassified 913
11 JGI24751J29686_10005207 3300002459 Bacteria 2646
12 Ga0065704_10353288 3300005289 Unclassified 807
13 Ga0065712_10110296 3300005290 Bacteria 1839
14 Ga0065715_10197968 3300005293 Bacteria 1352
15 Ga0065707_10283605 3300005295 Bacteria 1041
16 Ga0070658_10012517 3300005327 Bacteria 6806
17 Ga0070676_10029507 3300005328 Bacteria 3120
18 Ga0070683_100229804 3300005329 Bacteria 1763
19 Ga0070690_100017708 3300005330 Bacteria 4291
20 Ga0070690_100322033 3300005330 Unclassified 1114
21 Ga0070670_100037359 3300005331 Bacteria 4178
22 Ga0070677_10004729 3300005333 Bacteria 4459
23 Ga0068869_100014353 3300005334 Bacteria 5289
24 Ga0068869_100076434 3300005334 Bacteria 2489
25 Ga0070666_10024834 3300005335 Bacteria 3906
26 Ga0070680_100210091 3300005336 Bacteria 1642
27 Ga0070680_101829185 3300005336 Unclassified 526
28 Ga0070682_100053668 3300005337 Bacteria 2527
29 Ga0068868_100002943 3300005338 Bacteria 11818
30 Ga0068868_100007856 3300005338 Bacteria 7614
31 Ga0068868_100071374 3300005338 Bacteria 2770
32 Ga0070660_100054526 3300005339 Bacteria 3087
33 Ga0070689_100016928 3300005340 Bacteria 5344
34 Ga0070687_100185664 3300005343 Bacteria 1249
35 Ga0070692_10042374 3300005345 Bacteria 2337
36 Ga0070669_100004840 3300005353 Bacteria 9718
37 Ga0070675_100003414 3300005354 Bacteria 12028
38 Ga0070671_100176449 3300005355 Bacteria 1808
39 Ga0070673_100011519 3300005364 Bacteria 6038
40 Ga0070688_100001337 3300005365 Bacteria 12230
41 Ga0070688_100655513 3300005365 Bacteria 809
42 Ga0070659_100051688 3300005366 Bacteria 3231
43 Ga0070667_101475695 3300005367 Unclassified 638
44 Ga0070709_10473026 3300005434 Unclassified 947
45 Ga0070714_100317158 3300005435 Bacteria 1457
46 Ga0070714_101042052 3300005435 Unclassified 797
47 Ga0070713_100218404 3300005436 Unclassified 1728
48 Ga0070713_100920084 3300005436 Bacteria 842
49 Ga0070713_100965953 3300005436 Bacteria 821
50 Ga0070713_101117975 3300005436 Unclassified 762
51 Ga0070701_10085366 3300005438 Bacteria 1718
52 Ga0070711_100097816 3300005439 Bacteria 2129
53 Ga0070711_100521062 3300005439 Unclassified 982
54 Ga0070711_101337736 3300005439 Unclassified 622
55 Ga0070694_100855665 3300005444 Unclassified 748
56 Ga0070694_100864652 3300005444 Bacteria 745
57 Ga0070694_101540157 3300005444 Unclassified 563
58 Ga0070708_100147229 3300005445 Bacteria 2188
59 Ga0070708_100245464 3300005445 Bacteria 1681
60 Ga0070663_100012124 3300005455 Bacteria 5440
61 Ga0070663_101202900 3300005455 Unclassified 666
62 Ga0070678_100175482 3300005456 Unclassified 1749
63 Ga0070662_100019368 3300005457 Bacteria 4619
64 Ga0070681_10179843 3300005458 Bacteria 2037
65 Ga0068867_100016708 3300005459 Bacteria 5214
66 Ga0070685_10001585 3300005466 Bacteria 12002
67 Ga0070706_100103429 3300005467 Bacteria 2648
68 Ga0070699_100044715 3300005518 Bacteria 3834
69 Ga0070699_100205691 3300005518 Bacteria 1751
70 Ga0070679_100026901 3300005530 Bacteria 5656
71 Ga0070679_100056846 3300005530 Bacteria 3899
72 Ga0070679_100630352 3300005530 Bacteria 1015
73 Ga0070684_100007581 3300005535 Bacteria 8452
74 Ga0070684_100165690 3300005535 Bacteria 2006
75 Ga0070684_100464426 3300005535 Unclassified 1170
76 Ga0070684_101261361 3300005535 Unclassified 695
77 Ga0070697_100118432 3300005536 Bacteria 2213
78 Ga0070697_100318735 3300005536 Bacteria 1338
79 Ga0068853_100046452 3300005539 Bacteria 3723
80 Ga0068853_100207746 3300005539 Unclassified 1784
81 Ga0068853_100355358 3300005539 Bacteria 1364
82 Ga0070672_100113925 3300005543 Bacteria 2207
83 Ga0070686_100024614 3300005544 Bacteria 3610
84 Ga0070695_100065974 3300005545 Bacteria 2359
85 Ga0070695_101534638 3300005545 Bacteria 555
86 Ga0070693_100013426 3300005547 Bacteria 4173
87 Ga0070693_100080864 3300005547 Bacteria 1937
88 Ga0070665_100577828 3300005548 Bacteria 1137
89 Ga0070665_100792097 3300005548 Bacteria 961
90 Ga0070665_100949271 3300005548 Unclassified 872
91 Ga0070704_101058921 3300005549 Unclassified 735
92 Ga0068855_100000425 3300005563 Bacteria 52146
93 Ga0068855_100016904 3300005563 Bacteria 8773
94 Ga0070664_100124863 3300005564 Bacteria 2256
95 Ga0070664_100152794 3300005564 Bacteria 2039
96 Ga0068857_100000372 3300005577 Bacteria 31428
97 Ga0068854_100014550 3300005578 Bacteria 5191
98 Ga0068854_100117868 3300005578 Unclassified 2011
99 Ga0068856_100000670 3300005614 Bacteria 37158
100 Ga0068856_100226967 3300005614 Bacteria 1883
101 Ga0070702_100004396 3300005615 Bacteria 6431
102 Ga0070702_100210040 3300005615 Bacteria 1295
103 Ga0068852_100002637 3300005616 Bacteria 12389
104 Ga0068859_100069593 3300005617 Bacteria 3554
105 Ga0068864_100015807 3300005618 Bacteria 6279
106 Ga0068864_100076826 3300005618 Bacteria 2919
107 Ga0068866_10000590 3300005718 Bacteria 16525
108 Ga0068866_10208530 3300005718 Bacteria 1172
109 Ga0068861_100031030 3300005719 Bacteria 3922
110 Ga0068851_10023871 3300005834 Bacteria 2991
111 Ga0068870_10003763 3300005840 Bacteria 6454
112 Ga0068863_100002208 3300005841 Bacteria 19334
113 Ga0068863_100015579 3300005841 Bacteria 7305
114 Ga0068863_100348862 3300005841 Bacteria 1441
115 Ga0068858_100020658 3300005842 Bacteria 6152
116 Ga0068858_100039179 3300005842 Bacteria 4395
117 Ga0068858_100078214 3300005842 Bacteria 3074
118 Ga0068860_100051754 3300005843 Bacteria 3906
119 Ga0068860_100071573 3300005843 Bacteria 3295
120 Ga0068860_100747158 3300005843 Unclassified 990
121 Ga0068862_100019742 3300005844 Bacteria 5628
122 Ga0068862_100314303 3300005844 Bacteria 1444
123 Ga0070717_10002439 3300006028 Bacteria 13123
124 Ga0070717_11416945 3300006028 Bacteria 631
125 Ga0070717_11833103 3300006028 Bacteria 548
126 Ga0070715_10324208 3300006163 Bacteria 832
127 Ga0070716_101022793 3300006173 Unclassified 655
128 Ga0070712_100126703 3300006175 Unclassified 1930
129 Ga0070712_100921273 3300006175 Bacteria 754
130 Ga0097621_100000210 3300006237 Bacteria 38363
131 Ga0097621_100028706 3300006237 Bacteria 4387
132 Ga0097621_100101585 3300006237 Bacteria 2420
133 Ga0097621_100252378 3300006237 Bacteria 1545
134 Ga0068871_100000168 3300006358 Bacteria 43632
135 Ga0068871_100022428 3300006358 Unclassified 4866
136 Ga0068871_100620626 3300006358 Bacteria 985
137 Ga0068871_101090535 3300006358 Bacteria 746
138 Ga0075434_100011620 3300006871 Bacteria 8314
139 Ga0068865_100005649 3300006881 Bacteria 7593
140 Ga0068865_100034331 3300006881 Unclassified 3403
141 Ga0075436_100002516 3300006914 Bacteria 12610
142 Ga0075436_100062015 3300006914 Unclassified 2584
143 Ga0075436_100364892 3300006914 Bacteria 1042
144 Ga0097620_100069589 3300006931 Bacteria 3554
145 Ga0075435_100122582 3300007076 Bacteria 2170
146 Ga0075435_100358771 3300007076 Bacteria 1250
147 Ga0099794_10378690 3300007265 Unclassified 738
148 Ga0105251_10116167 3300009011 Bacteria 1217
149 Ga0105250_10058537 3300009092 Bacteria 1547
150 Ga0105250_10100212 3300009092 Bacteria 1182
151 Ga0105240_10074992 3300009093 Unclassified 4174
152 Ga0105240_10106552 3300009093 Bacteria 3399
153 Ga0105240_10604271 3300009093 Bacteria 1207
154 Ga0105245_10017496 3300009098 Bacteria 6254
155 Ga0105245_10068031 3300009098 Bacteria 3226
156 Ga0105245_10415566 3300009098 Bacteria 1347
157 Ga0105245_10766501 3300009098 Bacteria 1001
158 Ga0105247_10048827 3300009101 Bacteria 2600
159 Ga0105241_10009776 3300009174 Bacteria 7049
160 Ga0105241_10122524 3300009174 Bacteria 2096
161 Ga0105241_10371364 3300009174 Unclassified 1247
162 Ga0105242_10069077 3300009176 Bacteria 2925
163 Ga0105242_10131953 3300009176 Bacteria 2157
164 Ga0105248_10008351 3300009177 Bacteria 11376
165 Ga0105248_11148469 3300009177 Unclassified 878
166 Ga0105248_11494826 3300009177 Unclassified 765
167 Ga0105248_12672292 3300009177 Bacteria 569
168 Ga0105248_13437040 3300009177 Bacteria 503
169 Ga0105237_10035715 3300009545 Bacteria 5028
170 Ga0105237_11323353 3300009545 Unclassified 727
171 Ga0105237_11391774 3300009545 Unclassified 708
172 Ga0105238_10100190 3300009551 Unclassified 2880
173 Ga0105238_10352174 3300009551 Bacteria 1461
174 Ga0105238_10375161 3300009551 Unclassified 1413
175 Ga0105249_10027251 3300009553 Bacteria 5156
176 Ga0105249_10034694 3300009553 Bacteria 4572
177 Ga0105249_11140121 3300009553 Unclassified 850
178 Ga0105239_10065337 3300010375 Bacteria 3995
179 Ga0105239_10157645 3300010375 Bacteria 2536
180 Ga0105239_10586915 3300010375 Unclassified 1270
181 Ga0105239_12963347 3300010375 Bacteria 553
182 Ga0105246_10005905 3300011119 Bacteria 7467
183 Ga0105246_12332717 3300011119 Unclassified 523
184 Ga0157324_1032110 3300012506 Unclassified 601
185 Ga0157316_1007402 3300012510 Unclassified 931
186 Ga0157373_10001551 3300013100 Bacteria 17528
187 Ga0157373_10931770 3300013100 Unclassified 646
188 Ga0157371_10002011 3300013102 Bacteria 20094
189 Ga0157371_10173813 3300013102 Bacteria 1540
190 Ga0157371_10964742 3300013102 Bacteria 649
191 Ga0157370_10024967 3300013104 Bacteria 5914
192 Ga0157370_10216727 3300013104 Bacteria 1774
193 Ga0157370_11827921 3300013104 Unclassified 545
194 Ga0157369_10006683 3300013105 Bacteria 13322
195 Ga0157369_10115301 3300013105 Unclassified 2853
196 Ga0157369_10137791 3300013105 Unclassified 2583
197 Ga0157369_10776101 3300013105 Bacteria 985
198 Ga0157374_10000436 3300013296 Bacteria 37798
199 Ga0157374_10021855 3300013296 Bacteria 5701
200 Ga0157378_10000413 3300013297 Bacteria 42040
201 Ga0157378_10302348 3300013297 Bacteria 1549
202 Ga0157378_10461545 3300013297 Bacteria 1262
203 Ga0163162_10161842 3300013306 Unclassified 2360
204 Ga0163162_10182354 3300013306 Bacteria 2226
205 Ga0163162_11140680 3300013306 Unclassified 884
206 Ga0157372_10002544 3300013307 Bacteria 19779
207 Ga0157372_10004039 3300013307 Bacteria 15735
208 Ga0157372_10013114 3300013307 Bacteria 8843
209 Ga0157372_10406393 3300013307 Bacteria 1586
210 Ga0157372_10456074 3300013307 Bacteria 1490
211 Ga0157372_10925051 3300013307 Unclassified 1011
212 Ga0157375_10868193 3300013308 Bacteria 1048
213 Ga0157375_11674565 3300013308 Unclassified 753
214 Ga0163163_10036135 3300014325 Bacteria 4797
215 Ga0163163_10191884 3300014325 Bacteria 2091
216 Ga0163163_11693222 3300014325 Unclassified 693
217 Ga0157380_10111169 3300014326 Bacteria 2303
218 Ga0157380_10287592 3300014326 Bacteria 1508
219 Ga0157380_10864141 3300014326 Unclassified 927
220 Ga0157380_11292769 3300014326 Bacteria 776
221 Ga0182008_10001531 3300014497 Bacteria 15380
222 Ga0157377_10173892 3300014745 Bacteria 1349
223 Ga0157379_10466166 3300014968 Bacteria 1168
224 Ga0157376_10056236 3300014969 Bacteria 3286
225 Ga0157376_10273263 3300014969 Bacteria 1588
226 Ga0157376_10384070 3300014969 Bacteria 1353
227 Ga0157376_10997144 3300014969 Bacteria 860
228 Ga0157376_12714756 3300014969 Unclassified 535
229 Ga0182006_1035572 3300015261 Bacteria 1984
230 Ga0182007_10010032 3300015262 Bacteria 3769
231 Ga0163161_10008677 3300017792 Bacteria 7028
232 Ga0206349_1537526 3300020075 Bacteria 777
233 Ga0206355_1239061 3300020076 Bacteria 1222
234 Ga0206351_10515526 3300020077 Bacteria 2127
235 Ga0206350_10303859 3300020080 Unclassified 774
236 Ga0206350_10363889 3300020080 Bacteria 1015
237 Ga0206353_11725309 3300020082 Bacteria 566
238 Ga0224712_10004321 3300022467 Bacteria 3818
239 Ga0224712_10493324 3300022467 Unclassified 591
240 Ga0207697_10036786 3300025315 Bacteria 2005
241 Ga0207656_10035208 3300025321 Bacteria 2095
242 Ga0207696_1051602 3300025711 Bacteria 1174
243 Ga0207682_10004580 3300025893 Bacteria 5761
244 Ga0207692_10890165 3300025898 Unclassified 585
245 Ga0207642_10236058 3300025899 Bacteria 1030
246 Ga0207642_10606004 3300025899 Unclassified 682
247 Ga0207710_10022943 3300025900 Bacteria 2679
248 Ga0207680_10004018 3300025903 Bacteria 6952
249 Ga0207647_10016321 3300025904 Bacteria 5071
250 Ga0207699_10172325 3300025906 Bacteria 1448
251 Ga0207699_11077717 3300025906 Unclassified 595
252 Ga0207645_10000181 3300025907 Bacteria 50200
253 Ga0207643_10000474 3300025908 Bacteria 25980
254 Ga0207705_10178773 3300025909 Bacteria 1600
255 Ga0207684_10478814 3300025910 Bacteria 1068
256 Ga0207654_10099251 3300025911 Bacteria 1791
257 Ga0207654_10505136 3300025911 Unclassified 854
258 Ga0207707_10110233 3300025912 Bacteria 2405
259 Ga0207707_11207314 3300025912 Unclassified 612
260 Ga0207695_10025828 3300025913 Bacteria 6566
261 Ga0207695_10054210 3300025913 Unclassified 4189
262 Ga0207695_10442004 3300025913 Bacteria 1184
263 Ga0207695_10748367 3300025913 Bacteria 858
264 Ga0207671_11021148 3300025914 Unclassified 651
265 Ga0207693_10012257 3300025915 Bacteria 6929
266 Ga0207693_10462494 3300025915 Bacteria 991
267 Ga0207693_10992457 3300025915 Unclassified 641
268 Ga0207663_10076995 3300025916 Bacteria 2169
269 Ga0207663_11235447 3300025916 Unclassified 602
270 Ga0207660_11018110 3300025917 Unclassified 675
271 Ga0207660_11040172 3300025917 Unclassified 668
272 Ga0207662_10001688 3300025918 Bacteria 10806
273 Ga0207657_10007963 3300025919 Bacteria 10807
274 Ga0207657_10477730 3300025919 Unclassified 977
275 Ga0207649_10000343 3300025920 Bacteria 35195
276 Ga0207649_10113748 3300025920 Bacteria 1813
277 Ga0207652_10047490 3300025921 Bacteria 3667
278 Ga0207652_10306062 3300025921 Bacteria 1434
279 Ga0207694_10250276 3300025924 Bacteria 1450
280 Ga0207694_10545056 3300025924 Unclassified 973
281 Ga0207694_11172493 3300025924 Bacteria 650
282 Ga0207650_10000223 3300025925 Bacteria 64087
283 Ga0207650_10000224 3300025925 Bacteria 63557
284 Ga0207650_10000296 3300025925 Bacteria 50068
285 Ga0207659_10215112 3300025926 Bacteria 1542
286 Ga0207687_10130271 3300025927 Bacteria 1895
287 Ga0207687_10363394 3300025927 Bacteria 1182
288 Ga0207687_11057821 3300025927 Bacteria 696
289 Ga0207700_10141943 3300025928 Unclassified 1974
290 Ga0207700_10241288 3300025928 Bacteria 1540
291 Ga0207700_10387743 3300025928 Bacteria 1223
292 Ga0207700_10486997 3300025928 Bacteria 1090
293 Ga0207700_11279576 3300025928 Bacteria 654
294 Ga0207664_10054171 3300025929 Bacteria 3178
295 Ga0207664_10251371 3300025929 Unclassified 1543
296 Ga0207664_10285359 3300025929 Bacteria 1449
297 Ga0207664_11195908 3300025929 Bacteria 678
298 Ga0207664_11989077 3300025929 Unclassified 504
299 Ga0207644_10007871 3300025931 Bacteria 6964
300 Ga0207644_11587571 3300025931 Bacteria 549
301 Ga0207690_10240042 3300025932 Bacteria 1395
302 Ga0207706_10000613 3300025933 Bacteria 37863
303 Ga0207686_10256600 3300025934 Bacteria 1280
304 Ga0207670_10024184 3300025936 Bacteria 3794
305 Ga0207704_10114297 3300025938 Bacteria 1832
306 Ga0207704_10206156 3300025938 Bacteria 1443
307 Ga0207665_10021840 3300025939 Unclassified 4209
308 Ga0207691_10000345 3300025940 Bacteria 46775
309 Ga0207691_10631989 3300025940 Bacteria 905
310 Ga0207711_10042912 3300025941 Bacteria 3856
311 Ga0207711_10527919 3300025941 Bacteria 1101
312 Ga0207711_10634283 3300025941 Bacteria 997
313 Ga0207689_10000499 3300025942 Bacteria 37043
314 Ga0207689_10932281 3300025942 Unclassified 733
315 Ga0207661_10009584 3300025944 Bacteria 6952
316 Ga0207661_11389892 3300025944 Unclassified 644
317 Ga0207679_10000115 3300025945 Bacteria 64466
318 Ga0207679_10253274 3300025945 Bacteria 1498
319 Ga0207667_10005374 3300025949 Bacteria 15617
320 Ga0207667_10111640 3300025949 Bacteria 2820
321 Ga0207651_10003483 3300025960 Bacteria 7733
322 Ga0207712_10049581 3300025961 Bacteria 2926
323 Ga0207712_10114177 3300025961 Bacteria 2031
324 Ga0207712_10816018 3300025961 Unclassified 821
325 Ga0207668_10007185 3300025972 Bacteria 6615
326 Ga0207640_10088223 3300025981 Bacteria 2141
327 Ga0207658_10007316 3300025986 Bacteria 7530
328 Ga0207658_11277233 3300025986 Unclassified 671
329 Ga0207677_10002452 3300026023 Bacteria 9745
330 Ga0207677_10009191 3300026023 Bacteria 5551
331 Ga0207677_10380609 3300026023 Bacteria 1191
332 Ga0207703_10027419 3300026035 Bacteria 4487
333 Ga0207703_10032799 3300026035 Bacteria 4113
334 Ga0207703_10387560 3300026035 Bacteria 1294
335 Ga0207639_10184803 3300026041 Bacteria 1776
336 Ga0207639_10595806 3300026041 Unclassified 1019
337 Ga0207639_10960779 3300026041 Unclassified 800
338 Ga0207678_10000130 3300026067 Bacteria 63279
339 Ga0207678_10333228 3300026067 Unclassified 1307
340 Ga0207702_10002343 3300026078 Bacteria 18095
341 Ga0207702_10081192 3300026078 Bacteria 2815
342 Ga0207702_10578718 3300026078 Bacteria 1100
343 Ga0207641_10000287 3300026088 Bacteria 63251
344 Ga0207641_10002584 3300026088 Bacteria 16638
345 Ga0207641_10458365 3300026088 Bacteria 1233
346 Ga0207648_10002054 3300026089 Bacteria 21941
347 Ga0207676_10000115 3300026095 Bacteria 71633
348 Ga0207676_10090726 3300026095 Bacteria 2508
349 Ga0207676_11101495 3300026095 Unclassified 785
350 Ga0207674_10001340 3300026116 Bacteria 31912
351 Ga0207675_100009457 3300026118 Bacteria 9124
352 Ga0207683_10000217 3300026121 Bacteria 50192
353 Ga0207683_11063905 3300026121 Unclassified 751
354 Ga0207698_10645229 3300026142 Bacteria 1048
355 Ga0268266_10000761 3300028379 Bacteria 43122
356 Ga0268266_10079016 3300028379 Bacteria 2864
357 Ga0268266_10209172 3300028379 Bacteria 1788
358 Ga0268266_10271516 3300028379 Bacteria 1574
359 Ga0268265_10012035 3300028380 Bacteria 5856
360 Ga0268265_10505123 3300028380 Bacteria 1140
361 Ga0268264_10158632 3300028381 Bacteria 2035
362 Ga0268264_10367388 3300028381 Bacteria 1374
363 Ga0268264_10690034 3300028381 Bacteria 1013
364 Ga0265762_1046360 3300030760 Bacteria 862
365 Ga0265770_1033333 3300030878 Bacteria 873
366 Ga0265770_1115741 3300030878 Unclassified 559
367 Ga0265760_10114059 3300031090 Unclassified 863
368 Ga0265760_10287275 3300031090 Unclassified 580
369 Ga0265340_10031293 3300031247 Bacteria 2662
370 Ga0265316_10593463 3300031344 Bacteria 786
371 Ga0265314_10003977 3300031711 Bacteria 13983
372 Ga0265342_10493690 3300031712 Bacteria 625
373 Ga0373926_0005155 3300035083 Unclassified 4299
374 Ga0373934_0069311 3300035086 Bacteria 1409
375 Ga0373923_0337053 3300035111 Bacteria 718
376 Ga0373923_0461149 3300035111 Unclassified 617
377 Ga0373936_0280381 3300035113 Unclassified 749
378 Ga0373953_0063569 3300035117 Bacteria 1513
379 Ga0373954_0010580 3300035118 Unclassified 4073
380 Ga0373954_0024206 3300035118 Bacteria 2767
381 Ga0373956_0077277 3300035119 Bacteria 1524
382 Ga0373943_0049693 3300035170 Bacteria 2059
383 Ga0373943_0065885 3300035170 Bacteria 1823
384 Ga0373946_0396001 3300035171 Bacteria 697
385 Ga0373955_0127231 3300035172 Bacteria 1485
386 Ga0373955_0209975 3300035172 Bacteria 1161
387 Ga0373955_0226515 3300035172 Bacteria 1118
388 Ga0373924_0148256 3300035410 Bacteria 1026
389 Ga0373931_0076845 3300035691 Bacteria 1835
390 Ga0373935_0027380 3300035692 Bacteria 3523
391 Ga0373935_0031141 3300035692 Bacteria 3309
392 Ga0373935_0266215 3300035692 Bacteria 1203
393 Ga0373935_1089551 3300035692 Unclassified 594
394 Ga0373927_0012282 3300035695 Bacteria 5698
395 Ga0373927_0721753 3300035695 Unclassified 658
396 Ga0373927_1098178 3300035695 Unclassified 525
397 Ga0373933_0099377 3300035724 Bacteria 1804
398 Ga0373947_0015185 3300035725 Unclassified 4421
399 Ga0373947_0710189 3300035725 Unclassified 686
400 Ga0373947_1042011 3300035725 Unclassified 558
401 Ga0373937_0013411 3300036401 Bacteria 7219
402 Ga0373937_0112676 3300036401 Bacteria 2530
403 Ga0373937_0118482 3300036401 Bacteria 2466
404 Ga0373937_0202967 3300036401 Bacteria 1864
405 Ga0373937_0442652 3300036401 Unclassified 1234
406 Ga0373925_0009712 3300037068 Bacteria 6996
407 Ga0373925_0053693 3300037068 Bacteria 3013
408 Ga0373925_0500327 3300037068 Unclassified 998
409 Ga0373925_0735835 3300037068 Unclassified 813
410 Ga0436364_0424453 3300037853 Unclassified 949
411 Ga0436365_0192148 3300039437 Bacteria 1820
412 Ga0436363_0480187 3300039450 Unclassified 909
413 Ga0439448_0081480 3300042005 Unclassified 1087
414 Ga0451577_0269255 3300042876 Bacteria 1543
415 Ga0466963_0148783 3300044694 Bacteria 1626
416 Ga0453684_0401680 3300044712 Bacteria 1535
417 Ga0453684_0632133 3300044712 Bacteria 1170
418 Ga0453684_1753230 3300044712 Unclassified 633
419 Ga0466968_0246737 3300044735 Bacteria 847
420 Ga0466968_0409232 3300044735 Bacteria 666
421 Ga0466957_0940859 3300044842 Unclassified 619
422 Ga0466957_0981949 3300044842 Bacteria 606
423 Ga0451576_0132678 3300045051 Bacteria 2597
424 Ga0451576_1040136 3300045051 Bacteria 858
425 Ga0466967_0674942 3300045976 Bacteria 1023
426 Ga0466967_1223599 3300045976 Bacteria 748
427 Ga0495651_0192713 3300046462 Bacteria 1433
428 Ga0495580_0006580 3300046472 Bacteria 9444
429 Ga0495580_0012801 3300046472 Bacteria 6430
430 Ga0495580_0803841 3300046472 Unclassified 609
431 Ga0495580_0805933 3300046472 Bacteria 608
432 Ga0495582_0003871 3300046473 Bacteria 8429
433 Ga0495582_0161618 3300046473 Bacteria 1274
434 Ga0495639_0240082 3300046475 Bacteria 894
435 Ga0495664_0200278 3300046477 Unclassified 1210
436 Ga0495594_0668090 3300046499 Unclassified 588
437 Ga0495608_0206840 3300046511 Bacteria 1235
438 Ga0495630_0332709 3300046517 Bacteria 1162
439 Ga0495652_0666997 3300046529 Bacteria 703
440 Ga0495665_0000769 3300046531 Bacteria 16703
441 Ga0495645_0226151 3300046543 Unclassified 1256
442 Ga0495667_0068404 3300046559 Bacteria 2319
443 Ga0495667_0442803 3300046559 Unclassified 817
444 Ga0495635_0523038 3300046663 Unclassified 779
445 Ga0495623_0345557 3300046679 Unclassified 812
446 Ga0495623_0709791 3300046679 Unclassified 514
447 Ga0495658_0359445 3300046683 Bacteria 926
448 Ga0495669_0518807 3300046684 Bacteria 579
449 Ga0495613_0235994 3300046689 Bacteria 1280
450 Ga0495624_0168336 3300046690 Unclassified 1337
451 Ga0495600_0246586 3300046809 Unclassified 1137
452 Ga0495581_0053487 3300047315 Bacteria 2332
453 Ga0495674_0114465 3300047319 Bacteria 2284
454 Ga0495674_0186431 3300047319 Bacteria 1726
455 Ga0495674_0442739 3300047319 Unclassified 1045
456 Ga0495680_0573131 3300047322 Unclassified 758
457 Ga0495684_0058140 3300047471 Bacteria 2946
458 Ga0495684_0489251 3300047471 Bacteria 848
459 Ga0495602_0070624 3300048088 Unclassified 2987
460 Ga0496101_0089337 3300048904 Unclassified 2290
461 Ga0496102_0688876 3300048905 Unclassified 945
462 Ga0496104_1390208 3300048907 Unclassified 605
463 Ga0496105_0306941 3300048908 Bacteria 1274
464 Ga0496108_0000325 3300048911 Bacteria 40507
465 Ga0496109_0000117 3300048912 Bacteria 82245
466 Ga0496110_0002628 3300048913 Bacteria 13526
467 Ga0496110_0153895 3300048913 Bacteria 2083
468 Ga0496111_0015679 3300048914 Bacteria 5208
469 Ga0496112_0000283 3300048915 Bacteria 32864
470 Ga0496112_0121039 3300048915 Bacteria 2587
471 Ga0496113_0000504 3300048916 Bacteria 19266
472 Ga0496114_1604532 3300048917 Unclassified 539
473 Ga0496126_0161431 3300048929 Bacteria 1915
474 Ga0501036_1173854 3300049572 Unclassified 626
475 Ga0501039_1191231 3300049575 Bacteria 589
476 Ga0501042_1171696 3300049578 Unclassified 560
477 Ga0501042_1414440 3300049578 Bacteria 507
478 Ga0501046_1209262 3300049580 Unclassified 519
479 Ga0501239_016316 3300049672 Unclassified 876
480 Ga0501249_031444 3300049679 Bacteria 1184
481 Ga0501258_016162 3300049687 Bacteria 841
482 Ga0501081_1116897 3300049743 Bacteria 597
483 Ga0501268_011245 3300049765 Bacteria 1409
484 nmdc:mga0n895_5329_c1 3300050512 Bacteria 10714
485 nmdc:mga0rr50_340893_c1 3300050513 Bacteria 1259
486 nmdc:mga0rr50_51207_c1 3300050513 Bacteria 3063
487 nmdc:mga08x19_30116_c1 3300050514 Unclassified 3408
488 nmdc:mga08x19_70356_c1 3300050514 Bacteria 2280
489 nmdc:mga08x19_706875_c1 3300050514 Bacteria 715
490 Ga0495612_0117989 3300053078 Bacteria 1140
491 Ga0501082_0015070 3300060353 Bacteria 6659
492 Ga0265316_10199940
493 MRS1b_contig_2731466
494 MBSR1b_contig_201130
495 MBSR1b_contig_3160416
496 JGI24737J22298_10098867
497 JGI24743J22301_10002914
498 JGI24748J21848_1014212
499 JGI24035J26624_1043400
500 JGI24034J26672_10000570
501 JGI24034J26672_10027669
502 JGI24751J29686_10005207
503 Ga0065704_10353288
504 Ga0065712_10110296
505 Ga0065715_10197968
506 Ga0065707_10283605
507 Ga0070658_10012517
508 Ga0070676_10029507
509 Ga0070683_100229804
510 Ga0070690_100017708
511 Ga0070690_100322033
512 Ga0070670_100037359
513 Ga0070677_10004729
514 Ga0068869_100014353
515 Ga0068869_100076434
516 Ga0070666_10024834
517 Ga0070680_100210091
518 Ga0070680_101829185
519 Ga0070682_100053668
520 Ga0068868_100002943
521 Ga0068868_100007856
522 Ga0068868_100071374
523 Ga0070660_100054526
524 Ga0070689_100016928
525 Ga0070687_100185664
526 Ga0070692_10042374
527 Ga0070669_100004840
528 Ga0070675_100003414
529 Ga0070671_100176449
530 Ga0070673_100011519
531 Ga0070688_100001337
532 Ga0070688_100655513
533 Ga0070659_100051688
534 Ga0070667_101475695
535 Ga0070709_10473026
536 Ga0070714_100317158
537 Ga0070714_101042052
538 Ga0070713_100218404
539 Ga0070713_100920084
540 Ga0070713_100965953
541 Ga0070713_101117975
542 Ga0070701_10085366
543 Ga0070711_100097816
544 Ga0070711_100521062
545 Ga0070711_101337736
546 Ga0070694_100855665
547 Ga0070694_100864652
548 Ga0070694_101540157
549 Ga0070708_100147229
550 Ga0070708_100245464
551 Ga0070663_100012124
552 Ga0070663_101202900
553 Ga0070678_100175482
554 Ga0070662_100019368
555 Ga0070681_10179843
556 Ga0068867_100016708
557 Ga0070685_10001585
558 Ga0070706_100103429
559 Ga0070699_100044715
560 Ga0070699_100205691
561 Ga0070679_100026901
562 Ga0070679_100056846
563 Ga0070679_100630352
564 Ga0070684_100007581
565 Ga0070684_100165690
566 Ga0070684_100464426
567 Ga0070684_101261361
568 Ga0070697_100118432
569 Ga0070697_100318735
570 Ga0068853_100046452
571 Ga0068853_100207746
572 Ga0068853_100355358
573 Ga0070672_100113925
574 Ga0070686_100024614
575 Ga0070695_100065974
576 Ga0070695_101534638
577 Ga0070693_100013426
578 Ga0070693_100080864
579 Ga0070665_100577828
580 Ga0070665_100792097
581 Ga0070665_100949271
582 Ga0070704_101058921
583 Ga0068855_100000425
584 Ga0068855_100016904
585 Ga0070664_100124863
586 Ga0070664_100152794
587 Ga0068857_100000372
588 Ga0068854_100014550
589 Ga0068854_100117868
590 Ga0068856_100000670
591 Ga0068856_100226967
592 Ga0070702_100004396
593 Ga0070702_100210040
594 Ga0068852_100002637
595 Ga0068859_100069593
596 Ga0068864_100015807
597 Ga0068864_100076826
598 Ga0068866_10000590
599 Ga0068866_10208530
600 Ga0068861_100031030
601 Ga0068851_10023871
602 Ga0068870_10003763
603 Ga0068863_100002208
604 Ga0068863_100015579
605 Ga0068863_100348862
606 Ga0068858_100020658
607 Ga0068858_100039179
608 Ga0068858_100078214
609 Ga0068860_100051754
610 Ga0068860_100071573
611 Ga0068860_100747158
612 Ga0068862_100019742
613 Ga0068862_100314303
614 Ga0070717_10002439
615 Ga0070717_11416945
616 Ga0070717_11833103
617 Ga0070715_10324208
618 Ga0070716_101022793
619 Ga0070712_100126703
620 Ga0070712_100921273
621 Ga0097621_100000210
622 Ga0097621_100028706
623 Ga0097621_100101585
624 Ga0097621_100252378
625 Ga0068871_100000168
626 Ga0068871_100022428
627 Ga0068871_100620626
628 Ga0068871_101090535
629 Ga0075434_100011620
630 Ga0068865_100005649
631 Ga0068865_100034331
632 Ga0075436_100002516
633 Ga0075436_100062015
634 Ga0075436_100364892
635 Ga0097620_100069589
636 Ga0075435_100122582
637 Ga0075435_100358771
638 Ga0099794_10378690
639 Ga0105251_10116167
640 Ga0105250_10058537
641 Ga0105250_10100212
642 Ga0105240_10074992
643 Ga0105240_10106552
644 Ga0105240_10604271
645 Ga0105245_10017496
646 Ga0105245_10068031
647 Ga0105245_10415566
648 Ga0105245_10766501
649 Ga0105247_10048827
650 Ga0105241_10009776
651 Ga0105241_10122524
652 Ga0105241_10371364
653 Ga0105242_10069077
654 Ga0105242_10131953
655 Ga0105248_10008351
656 Ga0105248_11148469
657 Ga0105248_11494826
658 Ga0105248_12672292
659 Ga0105248_13437040
660 Ga0105237_10035715
661 Ga0105237_11323353
662 Ga0105237_11391774
663 Ga0105238_10100190
664 Ga0105238_10352174
665 Ga0105238_10375161
666 Ga0105249_10027251
667 Ga0105249_10034694
668 Ga0105249_11140121
669 Ga0105239_10065337
670 Ga0105239_10157645
671 Ga0105239_10586915
672 Ga0105239_12963347
673 Ga0105246_10005905
674 Ga0105246_12332717
675 Ga0157324_1032110
676 Ga0157316_1007402
677 Ga0157373_10001551
678 Ga0157373_10931770
679 Ga0157371_10002011
680 Ga0157371_10173813
681 Ga0157371_10964742
682 Ga0157370_10024967
683 Ga0157370_10216727
684 Ga0157370_11827921
685 Ga0157369_10006683
686 Ga0157369_10115301
687 Ga0157369_10137791
688 Ga0157369_10776101
689 Ga0157374_10000436
690 Ga0157374_10021855
691 Ga0157378_10000413
692 Ga0157378_10302348
693 Ga0157378_10461545
694 Ga0163162_10161842
695 Ga0163162_10182354
696 Ga0163162_11140680
697 Ga0157372_10002544
698 Ga0157372_10004039
699 Ga0157372_10013114
700 Ga0157372_10406393
701 Ga0157372_10456074
702 Ga0157372_10925051
703 Ga0157375_10868193
704 Ga0157375_11674565
705 Ga0163163_10036135
706 Ga0163163_10191884
707 Ga0163163_11693222
708 Ga0157380_10111169
709 Ga0157380_10287592
710 Ga0157380_10864141
711 Ga0157380_11292769
712 Ga0182008_10001531
713 Ga0157377_10173892
714 Ga0157379_10466166
715 Ga0157376_10056236
716 Ga0157376_10273263
717 Ga0157376_10384070
718 Ga0157376_10997144
719 Ga0157376_12714756
720 Ga0182006_1035572
721 Ga0182007_10010032
722 Ga0163161_10008677
723 Ga0206349_1537526
724 Ga0206355_1239061
725 Ga0206351_10515526
726 Ga0206350_10303859
727 Ga0206350_10363889
728 Ga0206353_11725309
729 Ga0224712_10004321
730 Ga0224712_10493324
731 Ga0207697_10036786
732 Ga0207656_10035208
733 Ga0207696_1051602
734 Ga0207682_10004580
735 Ga0207692_10890165
736 Ga0207642_10236058
737 Ga0207642_10606004
738 Ga0207710_10022943
739 Ga0207680_10004018
740 Ga0207647_10016321
741 Ga0207699_10172325
742 Ga0207699_11077717
743 Ga0207645_10000181
744 Ga0207643_10000474
745 Ga0207705_10178773
746 Ga0207684_10478814
747 Ga0207654_10099251
748 Ga0207654_10505136
749 Ga0207707_10110233
750 Ga0207707_11207314
751 Ga0207695_10025828
752 Ga0207695_10054210
753 Ga0207695_10442004
754 Ga0207695_10748367
755 Ga0207671_11021148
756 Ga0207693_10012257
757 Ga0207693_10462494
758 Ga0207693_10992457
759 Ga0207663_10076995
760 Ga0207663_11235447
761 Ga0207660_11018110
762 Ga0207660_11040172
763 Ga0207662_10001688
764 Ga0207657_10007963
765 Ga0207657_10477730
766 Ga0207649_10000343
767 Ga0207649_10113748
768 Ga0207652_10047490
769 Ga0207652_10306062
770 Ga0207694_10250276
771 Ga0207694_10545056
772 Ga0207694_11172493
773 Ga0207650_10000223
774 Ga0207650_10000224
775 Ga0207650_10000296
776 Ga0207659_10215112
777 Ga0207687_10130271
778 Ga0207687_10363394
779 Ga0207687_11057821
780 Ga0207700_10141943
781 Ga0207700_10241288
782 Ga0207700_10387743
783 Ga0207700_10486997
784 Ga0207700_11279576
785 Ga0207664_10054171
786 Ga0207664_10251371
787 Ga0207664_10285359
788 Ga0207664_11195908
789 Ga0207664_11989077
790 Ga0207644_10007871
791 Ga0207644_11587571
792 Ga0207690_10240042
793 Ga0207706_10000613
794 Ga0207686_10256600
795 Ga0207670_10024184
796 Ga0207704_10114297
797 Ga0207704_10206156
798 Ga0207665_10021840
799 Ga0207691_10000345
800 Ga0207691_10631989
801 Ga0207711_10042912
802 Ga0207711_10527919
803 Ga0207711_10634283
804 Ga0207689_10000499
805 Ga0207689_10932281
806 Ga0207661_10009584
807 Ga0207661_11389892
808 Ga0207679_10000115
809 Ga0207679_10253274
810 Ga0207667_10005374
811 Ga0207667_10111640
812 Ga0207651_10003483
813 Ga0207712_10049581
814 Ga0207712_10114177
815 Ga0207712_10816018
816 Ga0207668_10007185
817 Ga0207640_10088223
818 Ga0207658_10007316
819 Ga0207658_11277233
820 Ga0207677_10002452
821 Ga0207677_10009191
822 Ga0207677_10380609
823 Ga0207703_10027419
824 Ga0207703_10032799
825 Ga0207703_10387560
826 Ga0207639_10184803
827 Ga0207639_10595806
828 Ga0207639_10960779
829 Ga0207678_10000130
830 Ga0207678_10333228
831 Ga0207702_10002343
832 Ga0207702_10081192
833 Ga0207702_10578718
834 Ga0207641_10000287
835 Ga0207641_10002584
836 Ga0207641_10458365
837 Ga0207648_10002054
838 Ga0207676_10000115
839 Ga0207676_10090726
840 Ga0207676_11101495
841 Ga0207674_10001340
842 Ga0207675_100009457
843 Ga0207683_10000217
844 Ga0207683_11063905
845 Ga0207698_10645229
846 Ga0268266_10000761
847 Ga0268266_10079016
848 Ga0268266_10209172
849 Ga0268266_10271516
850 Ga0268265_10012035
851 Ga0268265_10505123
852 Ga0268264_10158632
853 Ga0268264_10367388
854 Ga0268264_10690034
855 Ga0265762_1046360
856 Ga0265770_1033333
857 Ga0265770_1115741
858 Ga0265760_10114059
859 Ga0265760_10287275
860 Ga0265340_10031293
861 Ga0265316_10593463
862 Ga0265314_10003977
863 Ga0265342_10493690
864 Ga0373926_0005155
865 Ga0373934_0069311
866 Ga0373923_0337053
867 Ga0373923_0461149
868 Ga0373936_0280381
869 Ga0373953_0063569
870 Ga0373954_0010580
871 Ga0373954_0024206
872 Ga0373956_0077277
873 Ga0373943_0049693
874 Ga0373943_0065885
875 Ga0373946_0396001
876 Ga0373955_0127231
877 Ga0373955_0209975
878 Ga0373955_0226515
879 Ga0373924_0148256
880 Ga0373931_0076845
881 Ga0373935_0027380
882 Ga0373935_0031141
883 Ga0373935_0266215
884 Ga0373935_1089551
885 Ga0373927_0012282
886 Ga0373927_0721753
887 Ga0373927_1098178
888 Ga0373933_0099377
889 Ga0373947_0015185
890 Ga0373947_0710189
891 Ga0373947_1042011
892 Ga0373937_0013411
893 Ga0373937_0112676
894 Ga0373937_0118482
895 Ga0373937_0202967
896 Ga0373937_0442652
897 Ga0373925_0009712
898 Ga0373925_0053693
899 Ga0373925_0500327
900 Ga0373925_0735835
901 Ga0436364_0424453
902 Ga0436365_0192148
903 Ga0436363_0480187
904 Ga0439448_0081480
905 Ga0451577_0269255
906 Ga0466963_0148783
907 Ga0453684_0401680
908 Ga0453684_0632133
909 Ga0453684_1753230
910 Ga0466968_0246737
911 Ga0466968_0409232
912 Ga0466957_0940859
913 Ga0466957_0981949
914 Ga0451576_0132678
915 Ga0451576_1040136
916 Ga0466967_0674942
917 Ga0466967_1223599
918 Ga0495651_0192713
919 Ga0495580_0006580
920 Ga0495580_0012801
921 Ga0495580_0803841
922 Ga0495580_0805933
923 Ga0495582_0003871
924 Ga0495582_0161618
925 Ga0495639_0240082
926 Ga0495664_0200278
927 Ga0495594_0668090
928 Ga0495608_0206840
929 Ga0495630_0332709
930 Ga0495652_0666997
931 Ga0495665_0000769
932 Ga0495645_0226151
933 Ga0495667_0068404
934 Ga0495667_0442803
935 Ga0495635_0523038
936 Ga0495623_0345557
937 Ga0495623_0709791
938 Ga0495658_0359445
939 Ga0495669_0518807
940 Ga0495613_0235994
941 Ga0495624_0168336
942 Ga0495600_0246586
943 Ga0495581_0053487
944 Ga0495674_0114465
945 Ga0495674_0186431
946 Ga0495674_0442739
947 Ga0495680_0573131
948 Ga0495684_0058140
949 Ga0495684_0489251
950 Ga0495602_0070624
951 Ga0496101_0089337
952 Ga0496102_0688876
953 Ga0496104_1390208
954 Ga0496105_0306941
955 Ga0496108_0000325
956 Ga0496109_0000117
957 Ga0496110_0002628
958 Ga0496110_0153895
959 Ga0496111_0015679
960 Ga0496112_0000283
961 Ga0496112_0121039
962 Ga0496113_0000504
963 Ga0496114_1604532
964 Ga0496126_0161431
965 Ga0501036_1173854
966 Ga0501039_1191231
967 Ga0501042_1171696
968 Ga0501042_1414440
969 Ga0501046_1209262
970 Ga0501239_016316
971 Ga0501249_031444
972 Ga0501258_016162
973 Ga0501081_1116897
974 Ga0501268_011245
975 nmdc:mga0n895_5329_c1
976 nmdc:mga0rr50_340893_c1
977 nmdc:mga0rr50_51207_c1
978 nmdc:mga08x19_30116_c1
979 nmdc:mga08x19_70356_c1
980 nmdc:mga08x19_706875_c1
981 Ga0495612_0117989
982 Ga0501082_0015070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

11

104

0.88

Map