F454121

General Info

Members Datasets Scaffolds Average Seq Length
491 246 982 189

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10123708|Ga0207678_101237081
Length 193
Sequence MGKIVVTEFISLDGVIEDPGGSEDFEHGGWSFEISRGDEGDRFKLDELMESDALLLGRTTYEGFADAWPSREGEFADKFNQMPKYVVSESMDEAEWENSTVIGGADLAAEVGKLKASHEGDVVVHGSATLAQALLDQGLVDELRLMVFPVVLGSGRRLLDETPSPQRLRLVESRPVGPDGVVILIYGPAGDDA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 9.57
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10123708 3300026067 Bacteria 2207
2 JGI24743J22301_10038410 3300001991 Archaea 956
3 JGI25407J50210_10012083 3300003373 Bacteria 2212
4 JGI25407J50210_10041344 3300003373 Bacteria 1180
5 Ga0070683_100129728 3300005329 Bacteria 2385
6 Ga0070683_100272620 3300005329 Bacteria 1609
7 Ga0070683_100870927 3300005329 Bacteria 864
8 Ga0070690_100020683 3300005330 Unclassified 4011
9 Ga0070690_100097031 3300005330 Bacteria 1949
10 Ga0068869_100084941 3300005334 Bacteria 2370
11 Ga0068869_100209442 3300005334 Bacteria 1541
12 Ga0070666_10063295 3300005335 Unclassified 2507
13 Ga0070680_100022262 3300005336 Bacteria 5044
14 Ga0070680_100036307 3300005336 Bacteria 3981
15 Ga0070680_100166601 3300005336 Bacteria 1853
16 Ga0070682_100028815 3300005337 Unclassified 3341
17 Ga0070682_100072602 3300005337 Bacteria 2206
18 Ga0070682_100151978 3300005337 Bacteria 1589
19 Ga0068868_100007751 3300005338 Bacteria 7662
20 Ga0068868_100243439 3300005338 Bacteria 1512
21 Ga0068868_100445070 3300005338 Archaea 1126
22 Ga0070660_101191418 3300005339 Bacteria 646
23 Ga0070689_100002533 3300005340 Bacteria 11969
24 Ga0070691_10249624 3300005341 Bacteria 951
25 Ga0070692_10040193 3300005345 Unclassified 2391
26 Ga0070692_10391209 3300005345 Bacteria 875
27 Ga0070668_100061678 3300005347 Bacteria 2905
28 Ga0070668_100397728 3300005347 Bacteria 1176
29 Ga0070675_100377183 3300005354 Unclassified 1262
30 Ga0070671_100038733 3300005355 Unclassified 3956
31 Ga0070671_100113783 3300005355 Bacteria 2274
32 Ga0070671_100116832 3300005355 Bacteria 2243
33 Ga0070671_100251088 3300005355 Bacteria 1502
34 Ga0070674_100004775 3300005356 Bacteria 7764
35 Ga0070673_100059966 3300005364 Unclassified 3014
36 Ga0070673_101431179 3300005364 Bacteria 651
37 Ga0070688_100064435 3300005365 Bacteria 2326
38 Ga0070688_100069595 3300005365 Unclassified 2247
39 Ga0070659_100348408 3300005366 Bacteria 1242
40 Ga0070667_100552937 3300005367 Archaea 1058
41 Ga0070709_10003132 3300005434 Bacteria 8871
42 Ga0070709_10039629 3300005434 Bacteria 2892
43 Ga0070709_10196090 3300005434 Bacteria 1427
44 Ga0070709_10344427 3300005434 Archaea 1100
45 Ga0070714_100128382 3300005435 Bacteria 2263
46 Ga0070710_10001597 3300005437 Bacteria 10691
47 Ga0070710_10518513 3300005437 Bacteria 818
48 Ga0070701_10015249 3300005438 Unclassified 3544
49 Ga0070711_100450527 3300005439 Archaea 1053
50 Ga0070705_100224621 3300005440 Bacteria 1302
51 Ga0070700_100030839 3300005441 Unclassified 3208
52 Ga0070700_100143092 3300005441 Bacteria 1627
53 Ga0070694_100036559 3300005444 Unclassified 3253
54 Ga0070708_100839856 3300005445 Bacteria 863
55 Ga0070663_100014726 3300005455 Bacteria 5027
56 Ga0070663_100016429 3300005455 Unclassified 4808
57 Ga0070678_100000298 3300005456 Bacteria 23008
58 Ga0070678_100107795 3300005456 Bacteria 2173
59 Ga0070662_100010172 3300005457 Bacteria 6167
60 Ga0070662_100629323 3300005457 Bacteria 904
61 Ga0070681_10293840 3300005458 Bacteria 1535
62 Ga0068867_100002281 3300005459 Bacteria 13492
63 Ga0070685_10002987 3300005466 Bacteria 8639
64 Ga0070685_10065224 3300005466 Bacteria 2143
65 Ga0070706_100720194 3300005467 Bacteria 925
66 Ga0070707_100943159 3300005468 Bacteria 828
67 Ga0070698_100107617 3300005471 Bacteria 2755
68 Ga0070699_100010926 3300005518 Bacteria 7854
69 Ga0070684_100102767 3300005535 Bacteria 2555
70 Ga0068853_100027030 3300005539 Bacteria 4821
71 Ga0068853_100243727 3300005539 Bacteria 1648
72 Ga0070672_100263284 3300005543 Bacteria 1455
73 Ga0070686_100011739 3300005544 Unclassified 4976
74 Ga0070686_100120809 3300005544 Bacteria 1798
75 Ga0070695_100043537 3300005545 Unclassified 2855
76 Ga0070695_100232767 3300005545 Bacteria 1333
77 Ga0070695_100270557 3300005545 Unclassified 1244
78 Ga0070696_100014839 3300005546 Bacteria 5229
79 Ga0070696_100073588 3300005546 Bacteria 2408
80 Ga0070696_100105045 3300005546 Bacteria 2028
81 Ga0070696_100417216 3300005546 Bacteria 1053
82 Ga0070696_100882284 3300005546 Bacteria 741
83 Ga0070693_100177440 3300005547 Unclassified 1369
84 Ga0070693_100234271 3300005547 Bacteria 1209
85 Ga0070665_100066567 3300005548 Unclassified 3614
86 Ga0070665_100138091 3300005548 Bacteria 2441
87 Ga0070704_100143333 3300005549 Bacteria 1868
88 Ga0070704_100657127 3300005549 Bacteria 926
89 Ga0070704_101113445 3300005549 Bacteria 718
90 Ga0068855_100499676 3300005563 Unclassified 1322
91 Ga0070664_100075056 3300005564 Bacteria 2903
92 Ga0068857_100254895 3300005577 Bacteria 1609
93 Ga0068854_100106845 3300005578 Archaea 2106
94 Ga0068854_100179558 3300005578 Bacteria 1653
95 Ga0068856_100061449 3300005614 Bacteria 3711
96 Ga0068856_100114202 3300005614 Bacteria 2699
97 Ga0068856_100117842 3300005614 Bacteria 2656
98 Ga0068856_100129650 3300005614 Bacteria 2526
99 Ga0068856_100369718 3300005614 Unclassified 1453
100 Ga0068856_100534457 3300005614 Bacteria 1194
101 Ga0070702_100013346 3300005615 Bacteria 4146
102 Ga0070702_100037989 3300005615 Bacteria 2677
103 Ga0068852_100051337 3300005616 Bacteria 3538
104 Ga0068852_100158900 3300005616 Bacteria 2108
105 Ga0068864_100198932 3300005618 Bacteria 1840
106 Ga0068861_100093628 3300005719 Bacteria 2376
107 Ga0068861_100128598 3300005719 Bacteria 2053
108 Ga0068861_100385117 3300005719 Bacteria 1240
109 Ga0068870_10476288 3300005840 Bacteria 828
110 Ga0068863_100523700 3300005841 Bacteria 1169
111 Ga0068863_101214420 3300005841 Bacteria 760
112 Ga0068862_100169133 3300005844 Bacteria 1956
113 Ga0068862_100204912 3300005844 Bacteria 1780
114 Ga0081455_10015882 3300005937 Bacteria 7289
115 Ga0081455_10074909 3300005937 Bacteria 2794
116 Ga0081455_10110331 3300005937 Bacteria 2187
117 Ga0081538_10000073 3300005981 Bacteria 94991
118 Ga0081538_10003343 3300005981 Bacteria 15188
119 Ga0081538_10024148 3300005981 Bacteria 4339
120 Ga0081538_10031033 3300005981 Bacteria 3614
121 Ga0081538_10047783 3300005981 Bacteria 2620
122 Ga0081538_10204514 3300005981 Bacteria 806
123 Ga0081540_1050266 3300005983 Bacteria 2072
124 Ga0081539_10003735 3300005985 Bacteria 18108
125 Ga0081539_10009325 3300005985 Bacteria 8235
126 Ga0070717_10187506 3300006028 Bacteria 1806
127 Ga0075365_10001387 3300006038 Bacteria 10909
128 Ga0075365_10019894 3300006038 Bacteria 4153
129 Ga0075364_10048838 3300006051 Bacteria 2758
130 Ga0070715_10014211 3300006163 Bacteria 2943
131 Ga0070715_10345743 3300006163 Archaea 811
132 Ga0070716_100023137 3300006173 Bacteria 3291
133 Ga0070716_100199840 3300006173 Archaea 1328
134 Ga0070712_100053450 3300006175 Bacteria 2820
135 Ga0070712_100072825 3300006175 Bacteria 2462
136 Ga0097621_100012262 3300006237 Bacteria 6343
137 Ga0097621_100018688 3300006237 Bacteria 5302
138 Ga0068871_100043829 3300006358 Bacteria 3595
139 Ga0068871_100049392 3300006358 Unclassified 3400
140 Ga0068871_100144843 3300006358 Bacteria 2022
141 Ga0075428_100042408 3300006844 Bacteria 5003
142 Ga0075428_100046783 3300006844 Bacteria 4752
143 Ga0075428_100616177 3300006844 Bacteria 1159
144 Ga0075430_100003297 3300006846 Bacteria 13538
145 Ga0075430_100038332 3300006846 Bacteria 4059
146 Ga0075430_100249148 3300006846 Bacteria 1472
147 Ga0075431_100002724 3300006847 Bacteria 17142
148 Ga0075431_100007850 3300006847 Bacteria 10634
149 Ga0075431_100200400 3300006847 Bacteria 2042
150 Ga0075431_100545850 3300006847 Bacteria 1147
151 Ga0075433_10381205 3300006852 Bacteria 1245
152 Ga0075429_100003163 3300006880 Bacteria 13991
153 Ga0075429_100773572 3300006880 Bacteria 841
154 Ga0068865_100003159 3300006881 Bacteria 9864
155 Ga0075436_100108573 3300006914 Bacteria 1936
156 Ga0075436_100142170 3300006914 Bacteria 1687
157 Ga0075435_100629632 3300007076 Bacteria 931
158 Ga0111539_10007920 3300009094 Bacteria 13547
159 Ga0111539_10571388 3300009094 Bacteria 1317
160 Ga0111539_10598685 3300009094 Bacteria 1284
161 Ga0111539_10883437 3300009094 Bacteria 1040
162 Ga0105245_10003411 3300009098 Bacteria 14229
163 Ga0105245_10024693 3300009098 Bacteria 5280
164 Ga0105245_10070447 3300009098 Bacteria 3173
165 Ga0105245_10072862 3300009098 Unclassified 3121
166 Ga0105247_10052927 3300009101 Bacteria 2503
167 Ga0105247_10088806 3300009101 Bacteria 1959
168 Ga0105247_10128638 3300009101 Bacteria 1649
169 Ga0114129_10387019 3300009147 Bacteria 1846
170 Ga0114129_11214382 3300009147 Bacteria 938
171 Ga0105243_10074976 3300009148 Bacteria 2745
172 Ga0105241_10015027 3300009174 Bacteria 5670
173 Ga0105241_10404014 3300009174 Bacteria 1199
174 Ga0105242_10386197 3300009176 Bacteria 1303
175 Ga0105248_10179624 3300009177 Unclassified 2385
176 Ga0105248_10422642 3300009177 Bacteria 1501
177 Ga0105237_10443541 3300009545 Unclassified 1304
178 Ga0105238_10129232 3300009551 Bacteria 2505
179 Ga0105238_10162755 3300009551 Bacteria 2207
180 Ga0105249_10154595 3300009553 Bacteria 2211
181 Ga0105239_10007916 3300010375 Bacteria 12151
182 Ga0105246_10013524 3300011119 Bacteria 5119
183 Ga0105246_10032419 3300011119 Bacteria 3465
184 Ga0157373_10062978 3300013100 Bacteria 2626
185 Ga0157374_10001529 3300013296 Bacteria 19473
186 Ga0157374_10072015 3300013296 Bacteria 3260
187 Ga0157378_10006911 3300013297 Bacteria 9908
188 Ga0157378_10616533 3300013297 Bacteria 1098
189 Ga0163162_10030501 3300013306 Bacteria 5342
190 Ga0163162_11947795 3300013306 Bacteria 673
191 Ga0157372_10041437 3300013307 Bacteria 5092
192 Ga0157372_10170048 3300013307 Unclassified 2521
193 Ga0157375_10207502 3300013308 Bacteria 2116
194 Ga0163163_10094254 3300014325 Bacteria 3012
195 Ga0163163_10106078 3300014325 Bacteria 2836
196 Ga0157380_10014137 3300014326 Bacteria 5836
197 Ga0157380_10111258 3300014326 Bacteria 2302
198 Ga0182008_10280495 3300014497 Bacteria 867
199 Ga0157377_10001729 3300014745 Bacteria 9527
200 Ga0157377_10039568 3300014745 Bacteria 2609
201 Ga0163161_10101504 3300017792 Unclassified 2142
202 Ga0207653_10198922 3300025885 Unclassified 755
203 Ga0207692_10182097 3300025898 Archaea 1224
204 Ga0207710_10057419 3300025900 Bacteria 1758
205 Ga0207710_10357258 3300025900 Bacteria 745
206 Ga0207688_10002934 3300025901 Bacteria 9277
207 Ga0207688_10069923 3300025901 Unclassified 1990
208 Ga0207680_10118742 3300025903 Unclassified 1726
209 Ga0207685_10045765 3300025905 Bacteria 1661
210 Ga0207699_10081614 3300025906 Bacteria 2006
211 Ga0207699_10978958 3300025906 Bacteria 625
212 Ga0207654_10094251 3300025911 Bacteria 1832
213 Ga0207654_10431070 3300025911 Bacteria 922
214 Ga0207654_10505657 3300025911 Bacteria 854
215 Ga0207707_10653258 3300025912 Bacteria 886
216 Ga0207671_10560969 3300025914 Bacteria 910
217 Ga0207693_10008999 3300025915 Bacteria 8150
218 Ga0207693_10025900 3300025915 Bacteria 4645
219 Ga0207693_10078314 3300025915 Bacteria 2587
220 Ga0207693_10078422 3300025915 Bacteria 2585
221 Ga0207663_10023338 3300025916 Unclassified 3548
222 Ga0207663_10038763 3300025916 Bacteria 2883
223 Ga0207663_10297700 3300025916 Bacteria 1204
224 Ga0207660_10083270 3300025917 Unclassified 2355
225 Ga0207657_10036167 3300025919 Unclassified 4422
226 Ga0207652_10048150 3300025921 Bacteria 3643
227 Ga0207652_10208180 3300025921 Unclassified 1761
228 Ga0207694_10335547 3300025924 Bacteria 1250
229 Ga0207659_10032809 3300025926 Unclassified 3568
230 Ga0207659_10140483 3300025926 Bacteria 1874
231 Ga0207687_10066870 3300025927 Unclassified 2555
232 Ga0207687_10171154 3300025927 Bacteria 1675
233 Ga0207687_10401278 3300025927 Bacteria 1128
234 Ga0207664_10104224 3300025929 Bacteria 2348
235 Ga0207644_10057095 3300025931 Unclassified 2818
236 Ga0207644_10134068 3300025931 Bacteria 1900
237 Ga0207644_10509471 3300025931 Bacteria 993
238 Ga0207690_11030052 3300025932 Unclassified 685
239 Ga0207706_10038205 3300025933 Bacteria 4258
240 Ga0207686_10058941 3300025934 Unclassified 2423
241 Ga0207709_10003145 3300025935 Bacteria 9924
242 Ga0207709_10136672 3300025935 Bacteria 1679
243 Ga0207709_10298429 3300025935 Bacteria 1197
244 Ga0207670_10056929 3300025936 Unclassified 2649
245 Ga0207669_10537932 3300025937 Bacteria 941
246 Ga0207704_10602916 3300025938 Unclassified 899
247 Ga0207665_10000831 3300025939 Bacteria 20900
248 Ga0207691_10271105 3300025940 Bacteria 1461
249 Ga0207711_10403369 3300025941 Archaea 1270
250 Ga0207689_10053481 3300025942 Bacteria 3327
251 Ga0207689_10226013 3300025942 Bacteria 1547
252 Ga0207661_10085248 3300025944 Bacteria 2618
253 Ga0207661_10255892 3300025944 Bacteria 1558
254 Ga0207661_10542391 3300025944 Bacteria 1065
255 Ga0207667_10295848 3300025949 Unclassified 1654
256 Ga0207712_10043879 3300025961 Unclassified 3087
257 Ga0207712_10292393 3300025961 Bacteria 1334
258 Ga0207640_10093855 3300025981 Archaea 2086
259 Ga0207658_10253357 3300025986 Archaea 1497
260 Ga0207639_10202096 3300026041 Bacteria 1705
261 Ga0207678_10002604 3300026067 Bacteria 16435
262 Ga0207678_10088991 3300026067 Bacteria 2639
263 Ga0207708_10000798 3300026075 Bacteria 23722
264 Ga0207708_10007367 3300026075 Bacteria 8132
265 Ga0207702_10059363 3300026078 Bacteria 3258
266 Ga0207641_10408558 3300026088 Bacteria 1305
267 Ga0207641_10437584 3300026088 Bacteria 1262
268 Ga0207648_10010532 3300026089 Bacteria 8756
269 Ga0207676_10181780 3300026095 Bacteria 1842
270 Ga0207674_10157396 3300026116 Bacteria 2227
271 Ga0207675_100133906 3300026118 Bacteria 2350
272 Ga0207675_100412571 3300026118 Bacteria 1333
273 Ga0207683_10000598 3300026121 Bacteria 33267
274 Ga0207683_10004193 3300026121 Bacteria 12465
275 Ga0207698_10085825 3300026142 Bacteria 2557
276 Ga0207428_10067858 3300027907 Bacteria 2807
277 Ga0268266_10128920 3300028379 Bacteria 2261
278 Ga0268266_10535916 3300028379 Unclassified 1120
279 Ga0268265_10373247 3300028380 Bacteria 1310
280 Ga0268265_10994832 3300028380 Bacteria 828
281 Ga0307408_100066308 3300031548 Bacteria 2651
282 Ga0307408_100142399 3300031548 Bacteria 1883
283 Ga0307408_100494843 3300031548 Bacteria 1069
284 Ga0307405_10267512 3300031731 Bacteria 1280
285 Ga0307413_10216475 3300031824 Bacteria 1395
286 Ga0307410_10086576 3300031852 Bacteria 2213
287 Ga0307406_10004548 3300031901 Bacteria 7556
288 Ga0307406_10008770 3300031901 Bacteria 5652
289 Ga0307406_10157532 3300031901 Bacteria 1628
290 Ga0307406_11214540 3300031901 Bacteria 655
291 Ga0307407_10009845 3300031903 Bacteria 4474
292 Ga0307407_10067052 3300031903 Bacteria 2119
293 Ga0307407_10345509 3300031903 Bacteria 1052
294 Ga0307412_10158848 3300031911 Bacteria 1677
295 Ga0307412_10671036 3300031911 Bacteria 886
296 Ga0307409_100000908 3300031995 Bacteria 13730
297 Ga0307409_100004806 3300031995 Bacteria 7666
298 Ga0307409_100048396 3300031995 Bacteria 3235
299 Ga0307409_100419685 3300031995 Bacteria 1283
300 Ga0307409_101087959 3300031995 Bacteria 820
301 Ga0307416_100008762 3300032002 Bacteria 6555
302 Ga0307416_100011521 3300032002 Bacteria 5905
303 Ga0307416_100019607 3300032002 Bacteria 4802
304 Ga0307416_100021848 3300032002 Bacteria 4605
305 Ga0307414_10019526 3300032004 Bacteria 4203
306 Ga0307411_10543990 3300032005 Bacteria 989
307 Ga0307415_100011812 3300032126 Bacteria 5018
308 Ga0373948_0059782 3300034817 Bacteria 835
309 Ga0373932_0085471 3300035112 Bacteria 1004
310 Ga0373960_0050159 3300035121 Bacteria 1236
311 Ga0373943_0439461 3300035170 Bacteria 757
312 Ga0373942_0067812 3300035207 Bacteria 1035
313 Ga0373947_0659842 3300035725 Bacteria 713
314 Ga0373937_1212744 3300036401 Bacteria 703
315 Ga0395899_0005078 3300037312 Bacteria 10241
316 Ga0395899_0045607 3300037312 Bacteria 3266
317 Ga0395899_0054006 3300037312 Bacteria 2974
318 Ga0395899_0056622 3300037312 Bacteria 2897
319 Ga0395899_0082633 3300037312 Unclassified 2336
320 Ga0395899_0482714 3300037312 Bacteria 807
321 Ga0395900_0005938 3300037418 Bacteria 12745
322 Ga0395900_0015521 3300037418 Bacteria 7764
323 Ga0395900_0032532 3300037418 Bacteria 5363
324 Ga0395900_0034187 3300037418 Bacteria 5234
325 Ga0395900_0036566 3300037418 Bacteria 5062
326 Ga0395900_0040688 3300037418 Bacteria 4790
327 Ga0395900_0074512 3300037418 Bacteria 3489
328 Ga0395900_0098289 3300037418 Unclassified 3007
329 Ga0395900_0228946 3300037418 Bacteria 1870
330 Ga0395900_0372188 3300037418 Bacteria 1398
331 Ga0395900_0681897 3300037418 Bacteria 962
332 Ga0395898_0000723 3300037466 Bacteria 58117
333 Ga0395898_0013731 3300037466 Bacteria 8330
334 Ga0395898_0014172 3300037466 Bacteria 8198
335 Ga0395898_0039888 3300037466 Bacteria 4646
336 Ga0395898_0051456 3300037466 Bacteria 4028
337 Ga0395898_0061385 3300037466 Bacteria 3651
338 Ga0395898_0073103 3300037466 Bacteria 3312
339 Ga0395898_0159923 3300037466 Unclassified 2154
340 Ga0395898_0233981 3300037466 Bacteria 1752
341 Ga0395898_0654708 3300037466 Bacteria 993
342 Ga0395898_0796568 3300037466 Bacteria 885
343 Ga0395905_0002667 3300037471 Bacteria 19578
344 Ga0395905_0010880 3300037471 Bacteria 8814
345 Ga0395905_0032331 3300037471 Bacteria 4921
346 Ga0395905_0039441 3300037471 Bacteria 4431
347 Ga0395905_0056706 3300037471 Bacteria 3664
348 Ga0395905_0085083 3300037471 Unclassified 2963
349 Ga0395905_0198714 3300037471 Bacteria 1880
350 Ga0395905_0239192 3300037471 Bacteria 1697
351 Ga0395905_0565401 3300037471 Bacteria 1038
352 Ga0395905_1110655 3300037471 Bacteria 694
353 Ga0395901_0002809 3300038443 Bacteria 17581
354 Ga0395901_0009606 3300038443 Bacteria 9813
355 Ga0395901_0027465 3300038443 Bacteria 5848
356 Ga0395901_0064438 3300038443 Bacteria 3815
357 Ga0395901_0065962 3300038443 Bacteria 3770
358 Ga0395901_0067472 3300038443 Bacteria 3725
359 Ga0395901_0093205 3300038443 Bacteria 3153
360 Ga0395901_0115497 3300038443 Bacteria 2819
361 Ga0395901_0124025 3300038443 Bacteria 2714
362 Ga0395901_0193074 3300038443 Bacteria 2135
363 Ga0395901_0193380 3300038443 Bacteria 2133
364 Ga0395901_0378082 3300038443 Bacteria 1458
365 Ga0395901_0445178 3300038443 Archaea 1325
366 Ga0395901_0454274 3300038443 Bacteria 1310
367 Ga0395901_0731862 3300038443 Bacteria 984
368 Ga0395901_0765490 3300038443 Bacteria 957
369 Ga0395901_1018878 3300038443 Bacteria 803
370 Ga0395901_1048906 3300038443 Bacteria 788
371 Ga0439464_0161838 3300042439 Bacteria 703
372 Ga0450916_010361 3300042530 Bacteria 1164
373 Ga0466960_0008611 3300044901 Bacteria 4181
374 Ga0466960_0088771 3300044901 Bacteria 1572
375 Ga0451576_0363144 3300045051 Bacteria 1517
376 Ga0495603_0004657 3300046455 Bacteria 8200
377 Ga0495585_0123088 3300046492 Bacteria 1371
378 Ga0495594_0274295 3300046499 Bacteria 961
379 Ga0495642_0106998 3300046528 Bacteria 1194
380 Ga0495652_0008276 3300046529 Bacteria 9507
381 Ga0495645_0025204 3300046543 Bacteria 4315
382 Ga0495634_0016468 3300046642 Bacteria 5288
383 Ga0495659_0170024 3300046664 Bacteria 884
384 Ga0495669_0008613 3300046684 Bacteria 4293
385 Ga0495670_0184698 3300046691 Bacteria 1102
386 Ga0495676_0171691 3300047321 Bacteria 1525
387 Ga0495676_0648715 3300047321 Bacteria 685
388 Ga0496100_0030385 3300048903 Bacteria 3351
389 Ga0496100_0056159 3300048903 Bacteria 2575
390 Ga0496101_0066284 3300048904 Bacteria 2633
391 Ga0496101_0239879 3300048904 Bacteria 1410
392 Ga0496102_0033078 3300048905 Bacteria 4645
393 Ga0496102_0033696 3300048905 Bacteria 4604
394 Ga0496102_0207291 3300048905 Bacteria 1848
395 Ga0496103_0007546 3300048906 Bacteria 6482
396 Ga0496103_0061184 3300048906 Bacteria 2341
397 Ga0496103_0075967 3300048906 Bacteria 2107
398 Ga0496104_0007445 3300048907 Bacteria 9673
399 Ga0496104_0060939 3300048907 Unclassified 3575
400 Ga0496104_0156267 3300048907 Bacteria 2188
401 Ga0496105_0014191 3300048908 Bacteria 6341
402 Ga0496105_0042608 3300048908 Bacteria 3742
403 Ga0496105_0056548 3300048908 Bacteria 3238
404 Ga0496106_0014651 3300048909 Bacteria 5794
405 Ga0496106_0544551 3300048909 Bacteria 931
406 Ga0496107_0016667 3300048910 Bacteria 5163
407 Ga0496107_0053300 3300048910 Bacteria 2918
408 Ga0496107_0125265 3300048910 Bacteria 1894
409 Ga0496108_0000716 3300048911 Bacteria 25781
410 Ga0496108_0062955 3300048911 Bacteria 3123
411 Ga0496108_0120416 3300048911 Bacteria 2251
412 Ga0496108_0367103 3300048911 Bacteria 1257
413 Ga0496108_0599685 3300048911 Bacteria 960
414 Ga0496109_0004184 3300048912 Bacteria 12038
415 Ga0496109_0012167 3300048912 Bacteria 7422
416 Ga0496109_0070273 3300048912 Bacteria 3212
417 Ga0496109_0379635 3300048912 Bacteria 1335
418 Ga0496109_0780016 3300048912 Bacteria 894
419 Ga0496110_0052723 3300048913 Unclassified 3575
420 Ga0496110_0113853 3300048913 Bacteria 2433
421 Ga0496110_0349724 3300048913 Bacteria 1346
422 Ga0496110_0825773 3300048913 Bacteria 832
423 Ga0496111_0003808 3300048914 Bacteria 9410
424 Ga0496111_0045662 3300048914 Bacteria 3152
425 Ga0496112_0005979 3300048915 Bacteria 10617
426 Ga0496112_0008702 3300048915 Bacteria 9101
427 Ga0496113_0013931 3300048916 Bacteria 5467
428 Ga0496113_0035195 3300048916 Bacteria 3661
429 Ga0496113_0073903 3300048916 Bacteria 2598
430 Ga0496114_0153879 3300048917 Bacteria 1996
431 Ga0496114_0839038 3300048917 Bacteria 799
432 Ga0496115_0048460 3300048918 Bacteria 3398
433 Ga0496115_0118013 3300048918 Bacteria 2182
434 Ga0496115_0547208 3300048918 Archaea 925
435 Ga0501031_0149779 3300049568 Bacteria 1524
436 Ga0501033_0101558 3300049570 Bacteria 2098
437 Ga0501037_0031097 3300049573 Bacteria 3942
438 Ga0501039_0057595 3300049575 Bacteria 3009
439 Ga0501040_0012337 3300049576 Bacteria 5598
440 Ga0501041_0159451 3300049577 Bacteria 1410
441 Ga0501041_0159633 3300049577 Bacteria 1409
442 Ga0501042_0020964 3300049578 Bacteria 4551
443 Ga0501042_0161282 3300049578 Bacteria 1618
444 Ga0501043_0410456 3300049579 Bacteria 1022
445 Ga0501046_0382525 3300049580 Bacteria 1018
446 Ga0501048_0264328 3300049582 Bacteria 1222
447 Ga0501071_0079112 3300049587 Bacteria 2403
448 Ga0501072_0017622 3300049588 Bacteria 5492
449 Ga0501072_0088277 3300049588 Bacteria 2461
450 Ga0501074_0045983 3300049590 Bacteria 3157
451 Ga0501075_0090568 3300049591 Bacteria 2320
452 Ga0501075_0408566 3300049591 Bacteria 1035
453 Ga0501076_0074406 3300049592 Bacteria 2721
454 Ga0501076_0521568 3300049592 Bacteria 979
455 Ga0501077_0002109 3300049593 Bacteria 11994
456 Ga0501079_0028083 3300049741 Bacteria 4316
457 Ga0501080_0182388 3300049742 Bacteria 1931
458 Ga0501081_0004983 3300049743 Bacteria 8550
459 Ga0501045_0061009 3300049824 Bacteria 2765
460 Ga0501045_0471790 3300049824 Bacteria 932
461 nmdc:mga00v17_207455_c1 3300050491 Bacteria 1267
462 nmdc:mga0yw44_43319_c1 3300050492 Bacteria 2687
463 nmdc:mga05p37_436365_c1 3300050507 Bacteria 1520
464 nmdc:mga05p37_892538_c1 3300050507 Bacteria 960
465 nmdc:mga09592_140075_c1 3300050508 Bacteria 2084
466 nmdc:mga09592_21136_c1 3300050508 Bacteria 5361
467 nmdc:mga09592_751586_c1 3300050508 Bacteria 827
468 nmdc:mga0qj67_138430_c1 3300050509 Bacteria 1973
469 nmdc:mga0qj67_157406_c1 3300050509 Bacteria 1844
470 nmdc:mga06r32_28020_c1 3300050510 Bacteria 5268
471 nmdc:mga06r32_323793_c1 3300050510 Bacteria 1527
472 nmdc:mga06r32_673425_c1 3300050510 Bacteria 1001
473 nmdc:mga06r32_67508_c1 3300050510 Bacteria 3453
474 nmdc:mga08y16_123116_c1 3300050511 Bacteria 2698
475 nmdc:mga08y16_133272_c1 3300050511 Bacteria 2583
476 nmdc:mga0n895_275535_c1 3300050512 Bacteria 1706
477 nmdc:mga0n895_582989_c1 3300050512 Bacteria 1122
478 nmdc:mga0rr50_63410_c1 3300050513 Bacteria 2791
479 nmdc:mga08x19_728955_c1 3300050514 Bacteria 704
480 nmdc:mga08x19_93993_c1 3300050514 Bacteria 1982
481 nmdc:mga0a205_436335_c1 3300050515 Bacteria 1171
482 Ga0495601_0026005 3300053077 Bacteria 3612
483 Ga0495655_0007402 3300053083 Bacteria 2040
484 Ga0495655_0135970 3300053083 Bacteria 761
485 Ga0501084_0052023 3300054114 Bacteria 3427
486 Ga0501084_0079156 3300054114 Bacteria 2755
487 Ga0501082_0851558 3300060353 Bacteria 797
488 Ga0530510_0005469 3300061734 Bacteria 8793
489 Ga0530510_0016999 3300061734 Bacteria 5153
490 Ga0530510_0119769 3300061734 Bacteria 1931
491 Ga0530510_0263919 3300061734 Bacteria 1285
492 Ga0207678_10123708
493 JGI24743J22301_10038410
494 JGI25407J50210_10012083
495 JGI25407J50210_10041344
496 Ga0070683_100129728
497 Ga0070683_100272620
498 Ga0070683_100870927
499 Ga0070690_100020683
500 Ga0070690_100097031
501 Ga0068869_100084941
502 Ga0068869_100209442
503 Ga0070666_10063295
504 Ga0070680_100022262
505 Ga0070680_100036307
506 Ga0070680_100166601
507 Ga0070682_100028815
508 Ga0070682_100072602
509 Ga0070682_100151978
510 Ga0068868_100007751
511 Ga0068868_100243439
512 Ga0068868_100445070
513 Ga0070660_101191418
514 Ga0070689_100002533
515 Ga0070691_10249624
516 Ga0070692_10040193
517 Ga0070692_10391209
518 Ga0070668_100061678
519 Ga0070668_100397728
520 Ga0070675_100377183
521 Ga0070671_100038733
522 Ga0070671_100113783
523 Ga0070671_100116832
524 Ga0070671_100251088
525 Ga0070674_100004775
526 Ga0070673_100059966
527 Ga0070673_101431179
528 Ga0070688_100064435
529 Ga0070688_100069595
530 Ga0070659_100348408
531 Ga0070667_100552937
532 Ga0070709_10003132
533 Ga0070709_10039629
534 Ga0070709_10196090
535 Ga0070709_10344427
536 Ga0070714_100128382
537 Ga0070710_10001597
538 Ga0070710_10518513
539 Ga0070701_10015249
540 Ga0070711_100450527
541 Ga0070705_100224621
542 Ga0070700_100030839
543 Ga0070700_100143092
544 Ga0070694_100036559
545 Ga0070708_100839856
546 Ga0070663_100014726
547 Ga0070663_100016429
548 Ga0070678_100000298
549 Ga0070678_100107795
550 Ga0070662_100010172
551 Ga0070662_100629323
552 Ga0070681_10293840
553 Ga0068867_100002281
554 Ga0070685_10002987
555 Ga0070685_10065224
556 Ga0070706_100720194
557 Ga0070707_100943159
558 Ga0070698_100107617
559 Ga0070699_100010926
560 Ga0070684_100102767
561 Ga0068853_100027030
562 Ga0068853_100243727
563 Ga0070672_100263284
564 Ga0070686_100011739
565 Ga0070686_100120809
566 Ga0070695_100043537
567 Ga0070695_100232767
568 Ga0070695_100270557
569 Ga0070696_100014839
570 Ga0070696_100073588
571 Ga0070696_100105045
572 Ga0070696_100417216
573 Ga0070696_100882284
574 Ga0070693_100177440
575 Ga0070693_100234271
576 Ga0070665_100066567
577 Ga0070665_100138091
578 Ga0070704_100143333
579 Ga0070704_100657127
580 Ga0070704_101113445
581 Ga0068855_100499676
582 Ga0070664_100075056
583 Ga0068857_100254895
584 Ga0068854_100106845
585 Ga0068854_100179558
586 Ga0068856_100061449
587 Ga0068856_100114202
588 Ga0068856_100117842
589 Ga0068856_100129650
590 Ga0068856_100369718
591 Ga0068856_100534457
592 Ga0070702_100013346
593 Ga0070702_100037989
594 Ga0068852_100051337
595 Ga0068852_100158900
596 Ga0068864_100198932
597 Ga0068861_100093628
598 Ga0068861_100128598
599 Ga0068861_100385117
600 Ga0068870_10476288
601 Ga0068863_100523700
602 Ga0068863_101214420
603 Ga0068862_100169133
604 Ga0068862_100204912
605 Ga0081455_10015882
606 Ga0081455_10074909
607 Ga0081455_10110331
608 Ga0081538_10000073
609 Ga0081538_10003343
610 Ga0081538_10024148
611 Ga0081538_10031033
612 Ga0081538_10047783
613 Ga0081538_10204514
614 Ga0081540_1050266
615 Ga0081539_10003735
616 Ga0081539_10009325
617 Ga0070717_10187506
618 Ga0075365_10001387
619 Ga0075365_10019894
620 Ga0075364_10048838
621 Ga0070715_10014211
622 Ga0070715_10345743
623 Ga0070716_100023137
624 Ga0070716_100199840
625 Ga0070712_100053450
626 Ga0070712_100072825
627 Ga0097621_100012262
628 Ga0097621_100018688
629 Ga0068871_100043829
630 Ga0068871_100049392
631 Ga0068871_100144843
632 Ga0075428_100042408
633 Ga0075428_100046783
634 Ga0075428_100616177
635 Ga0075430_100003297
636 Ga0075430_100038332
637 Ga0075430_100249148
638 Ga0075431_100002724
639 Ga0075431_100007850
640 Ga0075431_100200400
641 Ga0075431_100545850
642 Ga0075433_10381205
643 Ga0075429_100003163
644 Ga0075429_100773572
645 Ga0068865_100003159
646 Ga0075436_100108573
647 Ga0075436_100142170
648 Ga0075435_100629632
649 Ga0111539_10007920
650 Ga0111539_10571388
651 Ga0111539_10598685
652 Ga0111539_10883437
653 Ga0105245_10003411
654 Ga0105245_10024693
655 Ga0105245_10070447
656 Ga0105245_10072862
657 Ga0105247_10052927
658 Ga0105247_10088806
659 Ga0105247_10128638
660 Ga0114129_10387019
661 Ga0114129_11214382
662 Ga0105243_10074976
663 Ga0105241_10015027
664 Ga0105241_10404014
665 Ga0105242_10386197
666 Ga0105248_10179624
667 Ga0105248_10422642
668 Ga0105237_10443541
669 Ga0105238_10129232
670 Ga0105238_10162755
671 Ga0105249_10154595
672 Ga0105239_10007916
673 Ga0105246_10013524
674 Ga0105246_10032419
675 Ga0157373_10062978
676 Ga0157374_10001529
677 Ga0157374_10072015
678 Ga0157378_10006911
679 Ga0157378_10616533
680 Ga0163162_10030501
681 Ga0163162_11947795
682 Ga0157372_10041437
683 Ga0157372_10170048
684 Ga0157375_10207502
685 Ga0163163_10094254
686 Ga0163163_10106078
687 Ga0157380_10014137
688 Ga0157380_10111258
689 Ga0182008_10280495
690 Ga0157377_10001729
691 Ga0157377_10039568
692 Ga0163161_10101504
693 Ga0207653_10198922
694 Ga0207692_10182097
695 Ga0207710_10057419
696 Ga0207710_10357258
697 Ga0207688_10002934
698 Ga0207688_10069923
699 Ga0207680_10118742
700 Ga0207685_10045765
701 Ga0207699_10081614
702 Ga0207699_10978958
703 Ga0207654_10094251
704 Ga0207654_10431070
705 Ga0207654_10505657
706 Ga0207707_10653258
707 Ga0207671_10560969
708 Ga0207693_10008999
709 Ga0207693_10025900
710 Ga0207693_10078314
711 Ga0207693_10078422
712 Ga0207663_10023338
713 Ga0207663_10038763
714 Ga0207663_10297700
715 Ga0207660_10083270
716 Ga0207657_10036167
717 Ga0207652_10048150
718 Ga0207652_10208180
719 Ga0207694_10335547
720 Ga0207659_10032809
721 Ga0207659_10140483
722 Ga0207687_10066870
723 Ga0207687_10171154
724 Ga0207687_10401278
725 Ga0207664_10104224
726 Ga0207644_10057095
727 Ga0207644_10134068
728 Ga0207644_10509471
729 Ga0207690_11030052
730 Ga0207706_10038205
731 Ga0207686_10058941
732 Ga0207709_10003145
733 Ga0207709_10136672
734 Ga0207709_10298429
735 Ga0207670_10056929
736 Ga0207669_10537932
737 Ga0207704_10602916
738 Ga0207665_10000831
739 Ga0207691_10271105
740 Ga0207711_10403369
741 Ga0207689_10053481
742 Ga0207689_10226013
743 Ga0207661_10085248
744 Ga0207661_10255892
745 Ga0207661_10542391
746 Ga0207667_10295848
747 Ga0207712_10043879
748 Ga0207712_10292393
749 Ga0207640_10093855
750 Ga0207658_10253357
751 Ga0207639_10202096
752 Ga0207678_10002604
753 Ga0207678_10088991
754 Ga0207708_10000798
755 Ga0207708_10007367
756 Ga0207702_10059363
757 Ga0207641_10408558
758 Ga0207641_10437584
759 Ga0207648_10010532
760 Ga0207676_10181780
761 Ga0207674_10157396
762 Ga0207675_100133906
763 Ga0207675_100412571
764 Ga0207683_10000598
765 Ga0207683_10004193
766 Ga0207698_10085825
767 Ga0207428_10067858
768 Ga0268266_10128920
769 Ga0268266_10535916
770 Ga0268265_10373247
771 Ga0268265_10994832
772 Ga0307408_100066308
773 Ga0307408_100142399
774 Ga0307408_100494843
775 Ga0307405_10267512
776 Ga0307413_10216475
777 Ga0307410_10086576
778 Ga0307406_10004548
779 Ga0307406_10008770
780 Ga0307406_10157532
781 Ga0307406_11214540
782 Ga0307407_10009845
783 Ga0307407_10067052
784 Ga0307407_10345509
785 Ga0307412_10158848
786 Ga0307412_10671036
787 Ga0307409_100000908
788 Ga0307409_100004806
789 Ga0307409_100048396
790 Ga0307409_100419685
791 Ga0307409_101087959
792 Ga0307416_100008762
793 Ga0307416_100011521
794 Ga0307416_100019607
795 Ga0307416_100021848
796 Ga0307414_10019526
797 Ga0307411_10543990
798 Ga0307415_100011812
799 Ga0373948_0059782
800 Ga0373932_0085471
801 Ga0373960_0050159
802 Ga0373943_0439461
803 Ga0373942_0067812
804 Ga0373947_0659842
805 Ga0373937_1212744
806 Ga0395899_0005078
807 Ga0395899_0045607
808 Ga0395899_0054006
809 Ga0395899_0056622
810 Ga0395899_0082633
811 Ga0395899_0482714
812 Ga0395900_0005938
813 Ga0395900_0015521
814 Ga0395900_0032532
815 Ga0395900_0034187
816 Ga0395900_0036566
817 Ga0395900_0040688
818 Ga0395900_0074512
819 Ga0395900_0098289
820 Ga0395900_0228946
821 Ga0395900_0372188
822 Ga0395900_0681897
823 Ga0395898_0000723
824 Ga0395898_0013731
825 Ga0395898_0014172
826 Ga0395898_0039888
827 Ga0395898_0051456
828 Ga0395898_0061385
829 Ga0395898_0073103
830 Ga0395898_0159923
831 Ga0395898_0233981
832 Ga0395898_0654708
833 Ga0395898_0796568
834 Ga0395905_0002667
835 Ga0395905_0010880
836 Ga0395905_0032331
837 Ga0395905_0039441
838 Ga0395905_0056706
839 Ga0395905_0085083
840 Ga0395905_0198714
841 Ga0395905_0239192
842 Ga0395905_0565401
843 Ga0395905_1110655
844 Ga0395901_0002809
845 Ga0395901_0009606
846 Ga0395901_0027465
847 Ga0395901_0064438
848 Ga0395901_0065962
849 Ga0395901_0067472
850 Ga0395901_0093205
851 Ga0395901_0115497
852 Ga0395901_0124025
853 Ga0395901_0193074
854 Ga0395901_0193380
855 Ga0395901_0378082
856 Ga0395901_0445178
857 Ga0395901_0454274
858 Ga0395901_0731862
859 Ga0395901_0765490
860 Ga0395901_1018878
861 Ga0395901_1048906
862 Ga0439464_0161838
863 Ga0450916_010361
864 Ga0466960_0008611
865 Ga0466960_0088771
866 Ga0451576_0363144
867 Ga0495603_0004657
868 Ga0495585_0123088
869 Ga0495594_0274295
870 Ga0495642_0106998
871 Ga0495652_0008276
872 Ga0495645_0025204
873 Ga0495634_0016468
874 Ga0495659_0170024
875 Ga0495669_0008613
876 Ga0495670_0184698
877 Ga0495676_0171691
878 Ga0495676_0648715
879 Ga0496100_0030385
880 Ga0496100_0056159
881 Ga0496101_0066284
882 Ga0496101_0239879
883 Ga0496102_0033078
884 Ga0496102_0033696
885 Ga0496102_0207291
886 Ga0496103_0007546
887 Ga0496103_0061184
888 Ga0496103_0075967
889 Ga0496104_0007445
890 Ga0496104_0060939
891 Ga0496104_0156267
892 Ga0496105_0014191
893 Ga0496105_0042608
894 Ga0496105_0056548
895 Ga0496106_0014651
896 Ga0496106_0544551
897 Ga0496107_0016667
898 Ga0496107_0053300
899 Ga0496107_0125265
900 Ga0496108_0000716
901 Ga0496108_0062955
902 Ga0496108_0120416
903 Ga0496108_0367103
904 Ga0496108_0599685
905 Ga0496109_0004184
906 Ga0496109_0012167
907 Ga0496109_0070273
908 Ga0496109_0379635
909 Ga0496109_0780016
910 Ga0496110_0052723
911 Ga0496110_0113853
912 Ga0496110_0349724
913 Ga0496110_0825773
914 Ga0496111_0003808
915 Ga0496111_0045662
916 Ga0496112_0005979
917 Ga0496112_0008702
918 Ga0496113_0013931
919 Ga0496113_0035195
920 Ga0496113_0073903
921 Ga0496114_0153879
922 Ga0496114_0839038
923 Ga0496115_0048460
924 Ga0496115_0118013
925 Ga0496115_0547208
926 Ga0501031_0149779
927 Ga0501033_0101558
928 Ga0501037_0031097
929 Ga0501039_0057595
930 Ga0501040_0012337
931 Ga0501041_0159451
932 Ga0501041_0159633
933 Ga0501042_0020964
934 Ga0501042_0161282
935 Ga0501043_0410456
936 Ga0501046_0382525
937 Ga0501048_0264328
938 Ga0501071_0079112
939 Ga0501072_0017622
940 Ga0501072_0088277
941 Ga0501074_0045983
942 Ga0501075_0090568
943 Ga0501075_0408566
944 Ga0501076_0074406
945 Ga0501076_0521568
946 Ga0501077_0002109
947 Ga0501079_0028083
948 Ga0501080_0182388
949 Ga0501081_0004983
950 Ga0501045_0061009
951 Ga0501045_0471790
952 nmdc:mga00v17_207455_c1
953 nmdc:mga0yw44_43319_c1
954 nmdc:mga05p37_436365_c1
955 nmdc:mga05p37_892538_c1
956 nmdc:mga09592_140075_c1
957 nmdc:mga09592_21136_c1
958 nmdc:mga09592_751586_c1
959 nmdc:mga0qj67_138430_c1
960 nmdc:mga0qj67_157406_c1
961 nmdc:mga06r32_28020_c1
962 nmdc:mga06r32_323793_c1
963 nmdc:mga06r32_673425_c1
964 nmdc:mga06r32_67508_c1
965 nmdc:mga08y16_123116_c1
966 nmdc:mga08y16_133272_c1
967 nmdc:mga0n895_275535_c1
968 nmdc:mga0n895_582989_c1
969 nmdc:mga0rr50_63410_c1
970 nmdc:mga08x19_728955_c1
971 nmdc:mga08x19_93993_c1
972 nmdc:mga0a205_436335_c1
973 Ga0495601_0026005
974 Ga0495655_0007402
975 Ga0495655_0135970
976 Ga0501084_0052023
977 Ga0501084_0079156
978 Ga0501082_0851558
979 Ga0530510_0005469
980 Ga0530510_0016999
981 Ga0530510_0119769
982 Ga0530510_0263919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

182

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8706 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.866 1 187
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8592 1 185
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.859 1 187
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.856 3 187
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8477 3 187 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8386 3 187 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8316 3 185 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8246 3 187 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8227 3 185 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9794 34 187 GO:0008703
GO:0009231
AF-A0A537YCT7-F1-model_v4 Dihydrofolate reductase 0.9791 1 187 GO:0008703
GO:0009231
AF-A0A536N3B8-F1-model_v4 Dihydrofolate reductase 0.9741 1 162 GO:0008703
GO:0009231
AF-A0A536N3B8-F1-model_v4 Dihydrofolate reductase 0.9683 1 162 GO:0008703
GO:0009231
AF-A0A5M3XEI8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9674 1 187 GO:0008703
GO:0009231

Map