F454079

General Info

Members Datasets Scaffolds Average Seq Length
491 403 237 290

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10077072|Ga0070717_100770721
Length 329
Sequence VVVSAHAYPGTREGVILVVEVPPTVSDPPALDSGQILGANEERRREELADFLRKRRALLKPEDVGLPSGGRRRTPGLRREEVSHLAGVGTTWYTWLEQGRDVRASLDVLEAISRALRLTPAERTHLVLLGRGEAPPPCKSDERVHPTVRRLIEHLGPNPAFVIGRRWDYLSWNSAACVILGDLDDVPRAARNHLWMHFMDPTRREMFDDWARSSRLMAAKFRADMAHHIGDPTFEELVNSLRNSSPEFCKLWRKHEVATSATGRKTVHHPTVGTMLFEHAVFHPQESPEQRMILYSPLPDEDTPAKLATLLGAPPAGVAGAGAQAPKGA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
12 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
16 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
17 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
18 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
19 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
20 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
21 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
22 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
23 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
24 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
25 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
26 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
27 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
28 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
29 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
30 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
31 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
32 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
33 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
34 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
35 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
36 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
37 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
38 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
39 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
40 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
41 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
42 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
43 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
44 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
45 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
46 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
47 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
48 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
49 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
50 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
51 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
52 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
53 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
54 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
55 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
56 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
57 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
58 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
59 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
60 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
61 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
62 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
63 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
64 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
65 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
66 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
67 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
68 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
69 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
70 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
71 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
72 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
73 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
74 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
75 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
76 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
77 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
78 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
79 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
80 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
81 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
82 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
83 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
84 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
85 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
86 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
87 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
88 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
89 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
90 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
91 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
92 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
93 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
94 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
95 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
96 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
97 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
98 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
99 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
100 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
101 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
102 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
103 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
104 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
105 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
106 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
107 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
108 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
109 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
110 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
111 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
112 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
113 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
114 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
115 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
116 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
117 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
118 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
119 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
120 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
121 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
122 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
123 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
124 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
125 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
126 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
127 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
128 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
129 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
130 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
131 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
132 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
133 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
134 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
135 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
136 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
137 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
138 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
139 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
140 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
141 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
142 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
143 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
144 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
145 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
146 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
147 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
148 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
149 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
150 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
151 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
152 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
153 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
154 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
155 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
156 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
157 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
158 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
159 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
160 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
161 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
162 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
163 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
164 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
165 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
166 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
167 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
168 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
169 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
170 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
171 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
172 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
173 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
174 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
175 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
176 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
177 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
178 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
179 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
180 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
181 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
182 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
183 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
184 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
185 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
186 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
187 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
188 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
189 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
190 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
191 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
192 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
193 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
194 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
195 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
196 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
197 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
198 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
199 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
200 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
201 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
202 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
203 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
204 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
205 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
206 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
207 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
208 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
209 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
210 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
211 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
212 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
213 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
214 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
215 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
216 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
217 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
218 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
219 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
220 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
221 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
222 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
223 3004167301 Mesorhizobium loti 582 Isolate Unclassified
224 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
225 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
226 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
227 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
228 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
229 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
230 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
231 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
232 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
233 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
234 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
235 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
236 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
237 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
238 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
239 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
240 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
241 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
242 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
243 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
244 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
245 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
246 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
247 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
248 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
249 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
250 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
251 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
252 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
253 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
254 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
255 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
256 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
257 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
258 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
259 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
260 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
261 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
262 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
263 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
264 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
265 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
268 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
269 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
270 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
271 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
274 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
275 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
276 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
277 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
278 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
279 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
280 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
281 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
282 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
303 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
304 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
305 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
306 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
318 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
319 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
320 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
325 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
328 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
329 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
341 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
346 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
379 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
382 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
383 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
384 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
386 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
387 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
388 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
389 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
390 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
391 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
392 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
393 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
394 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
395 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
396 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
397 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
398 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
399 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
400 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
401 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
402 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
403 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 47.86
Metatranscriptomes 0.41
Isolates 51.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 5.91
Nodule 44.6
Rhizoplane 3.46
Rhizosphere 37.47
Stem 0
Stem Tuber 0
Unclassified 8.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002502 3300002705 Bacteria 6546
2 JGI25157J39369_1000162 3300002741 Bacteria 55941
3 JGI25165J46597_1000015 3300003214 Bacteria 380891
4 rootH1_10249277 3300003323 Unclassified 1191
5 JGI25160J50197_1011230 3300003354 Bacteria 3186
6 Ga0055542_1000601 3300003762 Bacteria 30747
7 Ga0070658_10106577 3300005327 Bacteria 2319
8 Ga0070683_100045909 3300005329 Bacteria 4033
9 Ga0070680_100001292 3300005336 Bacteria 18106
10 Ga0070680_100097122 3300005336 Bacteria 2443
11 Ga0068868_100110820 3300005338 Bacteria 2230
12 Ga0070660_100014434 3300005339 Bacteria 5691
13 Ga0070714_100030967 3300005435 Bacteria 4458
14 Ga0070714_100556313 3300005435 Bacteria 1099
15 Ga0070713_100032642 3300005436 Bacteria 4161
16 Ga0070713_100178576 3300005436 Bacteria 1906
17 Ga0070681_10007425 3300005458 Bacteria 10719
18 Ga0070681_10053721 3300005458 Bacteria 4015
19 Ga0070679_100002056 3300005530 Bacteria 18077
20 Ga0070679_100197957 3300005530 Bacteria 1976
21 Ga0070684_100006586 3300005535 Bacteria 8996
22 Ga0068853_100048986 3300005539 Bacteria 3629
23 Ga0068857_100102036 3300005577 Bacteria 2575
24 Ga0068854_100044720 3300005578 Bacteria 3145
25 Ga0068854_100160901 3300005578 Bacteria 1739
26 Ga0068856_100023191 3300005614 Bacteria 6037
27 Ga0068856_100623639 3300005614 Unclassified 1099
28 Ga0068852_100003292 3300005616 Bacteria 11283
29 Ga0068852_100310155 3300005616 Bacteria 1530
30 Ga0081455_10045852 3300005937 Bacteria 3800
31 Ga0081455_10075466 3300005937 Bacteria 2781
32 Ga0081455_10113459 3300005937 Bacteria 2149
33 Ga0070717_10045639 3300006028 Bacteria 3583
34 Ga0070717_10063593 3300006028 Bacteria 3063
35 Ga0070717_10077072 3300006028 Bacteria 2791
36 Ga0070717_10078358 3300006028 Bacteria 2769
37 Ga0075365_10004112 3300006038 Bacteria 7649
38 Ga0075365_10010038 3300006038 Bacteria 5489
39 Ga0075368_10067201 3300006042 Bacteria 1443
40 Ga0075363_100010332 3300006048 Bacteria 4427
41 Ga0075364_10051448 3300006051 Bacteria 2691
42 Ga0070716_100115545 3300006173 Bacteria 1671
43 Ga0070712_100006529 3300006175 Bacteria 7239
44 Ga0075367_10072656 3300006178 Bacteria 2071
45 Ga0075367_10164652 3300006178 Bacteria 1379
46 Ga0075370_10156993 3300006353 Bacteria 1334
47 Ga0105240_10291139 3300009093 Bacteria 1872
48 Ga0105248_10534485 3300009177 Bacteria 1322
49 Ga0105238_10029129 3300009551 Bacteria 5625
50 Ga0105238_10041608 3300009551 Plasmid 4653
51 Ga0105238_10217028 3300009551 Bacteria 1889
52 Ga0105238_10241182 3300009551 Bacteria 1785
53 Ga0105238_10376927 3300009551 Bacteria 1410
54 Ga0105239_10105954 3300010375 Bacteria 3114
55 Ga0105239_10211810 3300010375 Bacteria 2172
56 Ga0105239_10252800 3300010375 Bacteria 1979
57 Ga0105239_10720567 3300010375 Bacteria 1141
58 Ga0157371_10000939 3300013102 Bacteria 32557
59 Ga0157371_10055502 3300013102 Bacteria 2811
60 Ga0157370_10006581 3300013104 Bacteria 12793
61 Ga0157370_10192809 3300013104 Bacteria 1891
62 Ga0157370_10450327 3300013104 Bacteria 1183
63 Ga0157369_10002716 3300013105 Bacteria 21122
64 Ga0157369_10325192 3300013105 Bacteria 1598
65 Ga0157374_10068374 3300013296 Bacteria 3342
66 Ga0157374_10544686 3300013296 Bacteria 1168
67 Ga0157372_10006744 3300013307 Bacteria 12209
68 Ga0206354_11037117 3300020081 Bacteria 3497
69 Ga0206353_11814754 3300020082 Bacteria 6497
70 Ga0213876_10197973 3300021384 Bacteria 1068
71 Ga0209026_1000025 3300025250 Bacteria 352548
72 Ga0209759_1000121 3300025256 Bacteria 138469
73 Ga0209233_1000010 3300025261 Bacteria 1194329
74 Ga0209233_1001825 3300025261 Bacteria 8170
75 Ga0207426_1002327 3300025302 Bacteria 12424
76 Ga0207692_10020895 3300025898 Bacteria 2987
77 Ga0207647_10090650 3300025904 Bacteria 1823
78 Ga0207647_10134320 3300025904 Bacteria 1453
79 Ga0207699_10103056 3300025906 Bacteria 1814
80 Ga0207707_10003455 3300025912 Bacteria 14008
81 Ga0207707_10087230 3300025912 Bacteria 2727
82 Ga0207693_10008857 3300025915 Bacteria 8220
83 Ga0207660_10016949 3300025917 Bacteria 4834
84 Ga0207657_10006943 3300025919 Bacteria 11665
85 Ga0207652_10003768 3300025921 Bacteria 12411
86 Ga0207694_10242093 3300025924 Bacteria 1474
87 Ga0207694_10405282 3300025924 Bacteria 1134
88 Ga0207690_10030557 3300025932 Bacteria 3437
89 Ga0207706_10472571 3300025933 Bacteria 1083
90 Ga0207661_10005414 3300025944 Bacteria 8989
91 Ga0207651_10358156 3300025960 Bacteria 1231
92 Ga0207640_10256302 3300025981 Bacteria 1361
93 Ga0207677_10093363 3300026023 Bacteria 2194
94 Ga0207703_10454843 3300026035 Bacteria 1196
95 Ga0207639_10044108 3300026041 Bacteria 3352
96 Ga0207639_10431026 3300026041 Bacteria 1194
97 Ga0207678_10119358 3300026067 Bacteria 2250
98 Ga0207702_10023059 3300026078 Bacteria 5162
99 Ga0207702_10043887 3300026078 Bacteria 3756
100 Ga0207702_10622853 3300026078 Unclassified 1060
101 Ga0207698_10711136 3300026142 Bacteria 1000
102 Ga0265337_1030853 3300028556 Bacteria 1594
103 Ga0265326_10018217 3300028558 Bacteria 2022
104 Ga0265327_10003267 3300031251 Bacteria 15713
105 Ga0373953_0017661 3300035117 Bacteria 2627
106 Ga0373955_0224762 3300035172 Bacteria 1122
107 Ga0373935_0202951 3300035692 Bacteria 1371
108 Ga0373937_0170786 3300036401 Bacteria 2040
109 Ga0395899_0181444 3300037312 Bacteria 1478
110 Ga0395900_0020814 3300037418 Bacteria 6704
111 Ga0395900_0059579 3300037418 Bacteria 3931
112 Ga0395900_0095969 3300037418 Bacteria 3046
113 Ga0395900_0219573 3300037418 Bacteria 1917
114 Ga0395900_0465822 3300037418 Bacteria 1218
115 Ga0395898_0600607 3300037466 Bacteria 1043
116 Ga0395905_0000398 3300037471 Bacteria 61654
117 Ga0395905_0037666 3300037471 Bacteria 4539
118 Ga0395905_0040607 3300037471 Bacteria 4365
119 Ga0395905_0101025 3300037471 Bacteria 2708
120 Ga0395905_0201506 3300037471 Bacteria 1866
121 Ga0436364_1037724 3300037853 Bacteria 19923
122 Ga0395901_0019713 3300038443 Bacteria 6895
123 Ga0395901_0029109 3300038443 Bacteria 5684
124 Ga0395901_0050945 3300038443 Bacteria 4302
125 Ga0395901_0107902 3300038443 Bacteria 2923
126 Ga0395901_0219885 3300038443 Bacteria 1986
127 Ga0395901_0339010 3300038443 Bacteria 1553
128 Ga0395901_0400617 3300038443 Bacteria 1410
129 Ga0436365_1142223 3300039437 Bacteria 1080
130 Ga0436362_0317014 3300039453 Bacteria 2890
131 Ga0439432_068456 3300042006 Bacteria 1085
132 Ga0466972_0019059 3300044658 Bacteria 3430
133 Ga0466972_0026672 3300044658 Bacteria 2863
134 Ga0466965_0126820 3300044683 Bacteria 1321
135 Ga0466966_0022457 3300044684 Bacteria 4140
136 Ga0466961_0039876 3300044693 Bacteria 3010
137 Ga0466961_0050236 3300044693 Bacteria 2664
138 Ga0466961_0145847 3300044693 Bacteria 1480
139 Ga0466963_0008731 3300044694 Bacteria 6084
140 Ga0466963_0033269 3300044694 Bacteria 3345
141 Ga0466963_0038265 3300044694 Bacteria 3136
142 Ga0466963_0425350 3300044694 Unclassified 937
143 Ga0466971_0015059 3300044719 Bacteria 3401
144 Ga0466971_0016030 3300044719 Bacteria 3303
145 Ga0466968_0018166 3300044735 Bacteria 2819
146 Ga0466968_0084516 3300044735 Bacteria 1399
147 Ga0466968_0100494 3300044735 Bacteria 1291
148 Ga0466970_0040722 3300044765 Bacteria 2467
149 Ga0466970_0044369 3300044765 Bacteria 2367
150 Ga0466957_0000645 3300044842 Bacteria 17690
151 Ga0466957_0009766 3300044842 Bacteria 5482
152 Ga0466957_0133462 3300044842 Bacteria 1593
153 Ga0466957_0327060 3300044842 Unclassified 1035
154 Ga0466959_0030734 3300045049 Bacteria 3976
155 Ga0466959_0034181 3300045049 Bacteria 3762
156 Ga0466959_0057747 3300045049 Bacteria 2828
157 Ga0466959_0213912 3300045049 Unclassified 1339
158 Ga0466958_0001735 3300045836 Bacteria 10541
159 Ga0466958_0002321 3300045836 Bacteria 9490
160 Ga0466958_0030684 3300045836 Bacteria 3194
161 Ga0466958_0075574 3300045836 Bacteria 2066
162 Ga0466967_0038491 3300045976 Bacteria 4102
163 Ga0466967_0055787 3300045976 Bacteria 3481
164 Ga0495592_0019563 3300046454 Bacteria 5150
165 Ga0495606_0004192 3300046507 Bacteria 14599
166 Ga0495606_0091114 3300046507 Bacteria 1875
167 Ga0495608_0030610 3300046511 Bacteria 3642
168 Ga0495610_0032708 3300046512 Bacteria 2698
169 Ga0495618_0115922 3300046514 Bacteria 1715
170 Ga0495628_0037949 3300046516 Bacteria 3860
171 Ga0495643_0066316 3300046522 Bacteria 1904
172 Ga0495652_0105381 3300046529 Bacteria 2278
173 Ga0495667_0002175 3300046559 Bacteria 13086
174 Ga0495634_0141808 3300046642 Bacteria 1525
175 Ga0495625_0318370 3300046660 Bacteria 991
176 Ga0495635_0015462 3300046663 Bacteria 5335
177 Ga0495657_0039247 3300046675 Bacteria 3255
178 Ga0495623_0023208 3300046679 Bacteria 4004
179 Ga0495646_0171757 3300046680 Bacteria 1194
180 Ga0495660_0117445 3300046810 Bacteria 1350
181 Ga0495604_0040148 3300047317 Bacteria 3675
182 Ga0495674_0047898 3300047319 Bacteria 3786
183 Ga0495680_0020567 3300047322 Bacteria 5547
184 Ga0495675_0077969 3300047444 Bacteria 2087
185 Ga0495684_0034158 3300047471 Bacteria 3902
186 Ga0495686_0000685 3300047472 Bacteria 45846
187 Ga0495686_0186287 3300047472 Bacteria 1199
188 Ga0495602_0055000 3300048088 Bacteria 3508
189 Ga0495602_0261430 3300048088 Bacteria 1284
190 Ga0496102_0208205 3300048905 Bacteria 1844
191 Ga0496102_0356101 3300048905 Bacteria 1378
192 Ga0496104_0103209 3300048907 Bacteria 2732
193 Ga0496105_0229309 3300048908 Bacteria 1509
194 Ga0496107_0081164 3300048910 Bacteria 2365
195 Ga0496108_0333821 3300048911 Bacteria 1322
196 Ga0496109_0064404 3300048912 Bacteria 3354
197 Ga0496111_0009098 3300048914 Bacteria 6611
198 Ga0496112_0001845 3300048915 Bacteria 16674
199 Ga0496112_0010818 3300048915 Bacteria 8301
200 Ga0496112_0036243 3300048915 Bacteria 4811
201 Ga0496112_0196080 3300048915 Bacteria 1980
202 Ga0496113_0016932 3300048916 Bacteria 5046
203 Ga0496113_0094448 3300048916 Bacteria 2310
204 Ga0496115_0039315 3300048918 Bacteria 3757
205 Ga0496116_0077778 3300048919 Bacteria 2071
206 Ga0496117_0237779 3300048920 Bacteria 1002
207 Ga0496118_0141896 3300048921 Bacteria 1521
208 Ga0496119_0140232 3300048922 Bacteria 1306
209 Ga0496120_0001242 3300048923 Bacteria 32187
210 Ga0496121_0014862 3300048924 Bacteria 8212
211 Ga0496121_0017335 3300048924 Bacteria 7367
212 Ga0496121_0110900 3300048924 Bacteria 2093
213 Ga0496121_0310451 3300048924 Bacteria 1066
214 Ga0496124_0010137 3300048927 Bacteria 9592
215 Ga0496126_0115114 3300048929 Bacteria 2339
216 Ga0501037_0046229 3300049573 Bacteria 3193
217 Ga0501047_0096742 3300049581 Bacteria 2831
218 Ga0501044_0002316 3300049823 Bacteria 21702
219 nmdc:mga03n38_27103_c1 3300050490 Bacteria 2373
220 nmdc:mga03n38_46021_c1 3300050490 Bacteria 1924
221 nmdc:mga03n38_69641_c1 3300050490 Bacteria 1625
222 nmdc:mga00v17_121098_c1 3300050491 Bacteria 1666
223 nmdc:mga00v17_64610_c1 3300050491 Bacteria 2255
224 nmdc:mga0yw44_152279_c1 3300050492 Bacteria 1509
225 nmdc:mga0yw44_185493_c1 3300050492 Bacteria 1371
226 nmdc:mga0yw44_25366_c1 3300050492 Bacteria 3370
227 nmdc:mga07m45_102790_c1 3300050496 Bacteria 1642
228 Ga0500610_0040164 3300053079 Bacteria 2417
229 Ga0495595_0018505 3300053084 Bacteria 3011
230 Ga0500643_000395 3300053087 Bacteria 33621
231 Ga0500607_188343 3300053121 Bacteria 905
232 Ga0500620_000398 3300053155 Bacteria 8059
233 Ga0500622_0000237 3300053156 Bacteria 57253
234 Ga0500637_0132161 3300053178 Bacteria 1447
235 Ga0466962_0002049 3300061719 Bacteria 9536
236 Ga0466962_0021168 3300061719 Bacteria 3123
237 Ga0466962_0057736 3300061719 Bacteria 1853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10106577 Ga0070658_101065772 229
2 3300005329 Ga0070683_100045909 Ga0070683_1000459092 229
3 3300005336 Ga0070680_100001292 Ga0070680_1000012929 229
4 3300005339 Ga0070660_100014434 Ga0070660_1000144342 229
5 3300005458 Ga0070681_10007425 Ga0070681_100074259 229
6 3300005530 Ga0070679_100002056 Ga0070679_1000020567 229
7 3300005535 Ga0070684_100006586 Ga0070684_1000065864 229
8 3300005577 Ga0068857_100102036 Ga0068857_1001020362 229
9 3300005578 Ga0068854_100044720 Ga0068854_1000447203 229
10 3300005614 Ga0068856_100023191 Ga0068856_1000231912 229
11 3300005616 Ga0068852_100003292 Ga0068852_1000032928 229
12 3300009551 Ga0105238_10241182 Ga0105238_102411822 229
13 3300010375 Ga0105239_10720567 Ga0105239_107205671 229
14 3300013104 Ga0157370_10006581 Ga0157370_1000658111 229
15 3300013105 Ga0157369_10002716 Ga0157369_1000271611 229
16 3300013307 Ga0157372_10006744 Ga0157372_100067447 229
17 3300020081 Ga0206354_11037117 Ga0206354_110371173 229
18 3300020082 Ga0206353_11814754 Ga0206353_118147545 229
19 3300025912 Ga0207707_10003455 Ga0207707_1000345511 229
20 3300025917 Ga0207660_10016949 Ga0207660_100169493 229
21 3300025919 Ga0207657_10006943 Ga0207657_100069432 229
22 3300025921 Ga0207652_10003768 Ga0207652_100037686 229
23 3300025924 Ga0207694_10405282 Ga0207694_104052822 229
24 3300025932 Ga0207690_10030557 Ga0207690_100305571 229
25 3300025944 Ga0207661_10005414 Ga0207661_100054145 229
26 3300025981 Ga0207640_10256302 Ga0207640_102563022 229
27 3300026078 Ga0207702_10023059 Ga0207702_100230594 229
28 3300025924 Ga0207694_10242093 Ga0207694_102420932 233
29 3300044694 Ga0466963_0425350 Ga0466963_0425350_11_757 245
30 3300042006 Ga0439432_068456 Ga0439432_068456_281_1045 253
31 iso_pu_bacteria 2937980651 2937982558 255
32 3300006038 Ga0075365_10010038 Ga0075365_100100383 259
33 3300050491 nmdc:mga00v17_64610_c1 nmdc:mga00v17_64610_c1_517_1428 259
34 3300050492 nmdc:mga0yw44_25366_c1 nmdc:mga0yw44_25366_c1_1946_2857 259
35 iso_pu_bacteria 2965089291 2965090594 263
36 3300005435 Ga0070714_100556313 Ga0070714_1005563131 268
37 iso_pu_bacteria 2984504281 2984504309 269
38 iso_pu_bacteria 8016728285 8016728468 269
39 3300037853 Ga0436364_1037724 Ga0436364_1037724_5940_6764 271
40 3300037418 Ga0395900_0095969 Ga0395900_0095969_1571_2512 272
41 3300037471 Ga0395905_0040607 Ga0395905_0040607_2296_3237 272
42 3300038443 Ga0395901_0050945 Ga0395901_0050945_2026_2967 272
43 3300013102 Ga0157371_10000939 Ga0157371_1000093920 273
44 3300044684 Ga0466966_0022457 Ga0466966_0022457_1341_2264 274
45 3300044693 Ga0466961_0039876 Ga0466961_0039876_734_1657 274
46 3300044694 Ga0466963_0033269 Ga0466963_0033269_158_1081 274
47 3300044719 Ga0466971_0015059 Ga0466971_0015059_1034_1957 274
48 3300044842 Ga0466957_0009766 Ga0466957_0009766_1468_2391 274
49 3300045049 Ga0466959_0034181 Ga0466959_0034181_1317_2240 274
50 3300061719 Ga0466962_0021168 Ga0466962_0021168_1431_2354 274
51 3300005937 Ga0081455_10045852 Ga0081455_100458524 276
52 3300048924 Ga0496121_0110900 Ga0496121_0110900_271_1116 276
53 iso_pu_bacteria 2919100787 2919104487 276
54 3300006028 Ga0070717_10045639 Ga0070717_100456392 277
55 3300044683 Ga0466965_0126820 Ga0466965_0126820_420_1295 277
56 3300044694 Ga0466963_0038265 Ga0466963_0038265_1219_2094 277
57 3300045049 Ga0466959_0057747 Ga0466959_0057747_1519_2394 277
58 3300045836 Ga0466958_0030684 Ga0466958_0030684_17_892 277
59 3300005937 Ga0081455_10075466 Ga0081455_100754662 278
60 3300044693 Ga0466961_0050236 Ga0466961_0050236_645_1514 278
61 3300005336 Ga0070680_100097122 Ga0070680_1000971222 279
62 3300005436 Ga0070713_100032642 Ga0070713_1000326423 279
63 3300005458 Ga0070681_10053721 Ga0070681_100537213 279
64 3300005937 Ga0081455_10113459 Ga0081455_101134594 279
65 3300006028 Ga0070717_10063593 Ga0070717_100635933 279
66 3300010375 Ga0105239_10211810 Ga0105239_102118102 279
67 3300025912 Ga0207707_10087230 Ga0207707_100872302 279
68 3300037418 Ga0395900_0219573 Ga0395900_0219573_528_1493 279
69 3300037471 Ga0395905_0000398 Ga0395905_0000398_21275_22186 279
70 3300046507 Ga0495606_0091114 Ga0495606_0091114_98_952 279
71 3300046512 Ga0495610_0032708 Ga0495610_0032708_1413_2267 279
72 3300046522 Ga0495643_0066316 Ga0495643_0066316_127_981 279
73 3300047472 Ga0495686_0186287 Ga0495686_0186287_50_904 279
74 3300048919 Ga0496116_0077778 Ga0496116_0077778_805_1659 279
75 3300048920 Ga0496117_0237779 Ga0496117_0237779_14_868 279
76 3300048924 Ga0496121_0017335 Ga0496121_0017335_5435_6289 279
77 3300048927 Ga0496124_0010137 Ga0496124_0010137_1099_1953 279
78 3300050490 nmdc:mga03n38_69641_c1 nmdc:mga03n38_69641_c1_389_1399 279
79 3300053156 Ga0500622_0000237 Ga0500622_0000237_12922_13776 279
80 iso_pu_bacteria 2510917030 2511200130 279
81 iso_pu_bacteria 2582581298 2585224860 279
82 iso_pu_bacteria 2585427529 2585547416 279
83 iso_pu_bacteria 2977907340 2977910370 279
84 3300003323 rootH1_10249277 rootH1_102492772 280
85 3300005614 Ga0068856_100623639 Ga0068856_1006236392 280
86 3300009177 Ga0105248_10534485 Ga0105248_105344852 280
87 3300013102 Ga0157371_10055502 Ga0157371_100555022 280
88 3300021384 Ga0213876_10197973 Ga0213876_101979731 280
89 3300026078 Ga0207702_10043887 Ga0207702_100438873 280
90 3300026078 Ga0207702_10622853 Ga0207702_106228531 280
91 3300037418 Ga0395900_0465822 Ga0395900_0465822_262_1179 280
92 3300039437 Ga0436365_1142223 Ga0436365_1142223_125_1021 280
93 iso_pu_bacteria 2791355406 2793981514 280
94 iso_pu_bacteria 8047893842 8047903370 280
95 iso_pu_bacteria 8048356638 8048365961 280
96 iso_pu_bacteria 8048369669 8048379190 280
97 iso_pu_bacteria 8048379754 8048388296 280
98 3300005338 Ga0068868_100110820 Ga0068868_1001108201 281
99 3300005435 Ga0070714_100030967 Ga0070714_1000309674 281
100 3300009551 Ga0105238_10041608 Ga0105238_100416083 281
101 3300026023 Ga0207677_10093363 Ga0207677_100933631 281
102 3300026035 Ga0207703_10454843 Ga0207703_104548432 281
103 3300026041 Ga0207639_10431026 Ga0207639_104310261 281
104 3300026142 Ga0207698_10711136 Ga0207698_107111361 281
105 3300044693 Ga0466961_0145847 Ga0466961_0145847_521_1381 281
106 3300044694 Ga0466963_0008731 Ga0466963_0008731_2563_3450 281
107 3300044765 Ga0466970_0044369 Ga0466970_0044369_323_1210 281
108 3300044842 Ga0466957_0133462 Ga0466957_0133462_488_1375 281
109 3300045049 Ga0466959_0030734 Ga0466959_0030734_2675_3562 281
110 3300045836 Ga0466958_0075574 Ga0466958_0075574_290_1177 281
111 3300048907 Ga0496104_0103209 Ga0496104_0103209_1572_2480 281
112 3300048908 Ga0496105_0229309 Ga0496105_0229309_372_1280 281
113 3300048910 Ga0496107_0081164 Ga0496107_0081164_1233_2141 281
114 3300048912 Ga0496109_0064404 Ga0496109_0064404_1103_2011 281
115 3300048914 Ga0496111_0009098 Ga0496111_0009098_2356_3264 281
116 3300048915 Ga0496112_0010818 Ga0496112_0010818_762_1670 281
117 3300048916 Ga0496113_0016932 Ga0496113_0016932_4092_5000 281
118 3300003354 JGI25160J50197_1011230 JGI25160J50197_10112303 282
119 3300005530 Ga0070679_100197957 Ga0070679_1001979572 282
120 3300006028 Ga0070717_10077072 Ga0070717_100770721 282
121 3300006028 Ga0070717_10078358 Ga0070717_100783582 282
122 3300006173 Ga0070716_100115545 Ga0070716_1001155452 282
123 3300006175 Ga0070712_100006529 Ga0070712_1000065294 282
124 3300025302 Ga0207426_1002327 Ga0207426_10023274 282
125 3300025898 Ga0207692_10020895 Ga0207692_100208952 282
126 3300025906 Ga0207699_10103056 Ga0207699_101030562 282
127 3300025915 Ga0207693_10008857 Ga0207693_100088573 282
128 3300035117 Ga0373953_0017661 Ga0373953_0017661_261_1187 282
129 3300035172 Ga0373955_0224762 Ga0373955_0224762_153_1079 282
130 3300036401 Ga0373937_0170786 Ga0373937_0170786_381_1307 282
131 3300044658 Ga0466972_0026672 Ga0466972_0026672_163_1059 282
132 3300044765 Ga0466970_0040722 Ga0466970_0040722_687_1583 282
133 3300045976 Ga0466967_0038491 Ga0466967_0038491_1536_2402 282
134 3300046454 Ga0495592_0019563 Ga0495592_0019563_366_1292 282
135 3300046507 Ga0495606_0004192 Ga0495606_0004192_8713_9564 282
136 3300046511 Ga0495608_0030610 Ga0495608_0030610_2660_3586 282
137 3300046514 Ga0495618_0115922 Ga0495618_0115922_191_1117 282
138 3300046516 Ga0495628_0037949 Ga0495628_0037949_287_1213 282
139 3300046529 Ga0495652_0105381 Ga0495652_0105381_1333_2259 282
140 3300046559 Ga0495667_0002175 Ga0495667_0002175_9720_10646 282
141 3300046642 Ga0495634_0141808 Ga0495634_0141808_388_1314 282
142 3300046663 Ga0495635_0015462 Ga0495635_0015462_889_1815 282
143 3300046675 Ga0495657_0039247 Ga0495657_0039247_366_1292 282
144 3300046679 Ga0495623_0023208 Ga0495623_0023208_1848_2774 282
145 3300046680 Ga0495646_0171757 Ga0495646_0171757_175_1110 282
146 3300047317 Ga0495604_0040148 Ga0495604_0040148_2298_3224 282
147 3300047319 Ga0495674_0047898 Ga0495674_0047898_1263_2189 282
148 3300047322 Ga0495680_0020567 Ga0495680_0020567_4564_5490 282
149 3300047444 Ga0495675_0077969 Ga0495675_0077969_119_1045 282
150 3300047471 Ga0495684_0034158 Ga0495684_0034158_2522_3448 282
151 3300048088 Ga0495602_0055000 Ga0495602_0055000_2131_3057 282
152 3300048088 Ga0495602_0261430 Ga0495602_0261430_335_1270 282
153 3300048911 Ga0496108_0333821 Ga0496108_0333821_304_1230 282
154 3300048915 Ga0496112_0001845 Ga0496112_0001845_577_1503 282
155 3300048915 Ga0496112_0196080 Ga0496112_0196080_360_1226 282
156 3300048916 Ga0496113_0094448 Ga0496113_0094448_170_1096 282
157 3300048924 Ga0496121_0014862 Ga0496121_0014862_7319_8170 282
158 3300048924 Ga0496121_0310451 Ga0496121_0310451_25_876 282
159 3300053084 Ga0495595_0018505 Ga0495595_0018505_1857_2783 282
160 3300025933 Ga0207706_10472571 Ga0207706_104725712 283
161 3300039453 Ga0436362_0317014 Ga0436362_0317014_331_1281 283
162 3300044719 Ga0466971_0016030 Ga0466971_0016030_676_1644 283
163 3300044735 Ga0466968_0018166 Ga0466968_0018166_701_1630 283
164 3300044735 Ga0466968_0084516 Ga0466968_0084516_95_1036 283
165 3300044735 Ga0466968_0100494 Ga0466968_0100494_67_957 283
166 3300044842 Ga0466957_0000645 Ga0466957_0000645_14136_15104 283
167 3300045836 Ga0466958_0001735 Ga0466958_0001735_614_1555 283
168 3300045836 Ga0466958_0002321 Ga0466958_0002321_3652_4620 283
169 3300045976 Ga0466967_0055787 Ga0466967_0055787_1967_2908 283
170 3300053087 Ga0500643_000395 Ga0500643_000395_13580_14431 283
171 3300053121 Ga0500607_188343 Ga0500607_188343_11_871 283
172 3300053178 Ga0500637_0132161 Ga0500637_0132161_441_1301 283
173 3300061719 Ga0466962_0002049 Ga0466962_0002049_713_1681 283
174 3300061719 Ga0466962_0057736 Ga0466962_0057736_865_1806 283
175 iso_pu_bacteria 2513237090 2513611312 283
176 iso_pu_bacteria 2847670302 2847675594 283
177 iso_pu_bacteria 2856314179 2856319480 283
178 iso_pu_bacteria 2871444079 2871447555 283
179 iso_pu_bacteria 2871495908 2871501416 283
180 iso_pu_bacteria 2878035449 2878040714 283
181 iso_pu_bacteria 2885305155 2885309412 283
182 iso_pu_bacteria 2885326080 2885328420 283
183 iso_pu_bacteria 2885334103 2885338550 283
184 iso_pu_bacteria 2903540706 2903546227 283
185 iso_pu_bacteria 2906414383 2906420200 283
186 3300035692 Ga0373935_0202951 Ga0373935_0202951_296_1246 284
187 3300044842 Ga0466957_0327060 Ga0466957_0327060_150_1013 284
188 3300047472 Ga0495686_0000685 Ga0495686_0000685_7927_8784 284
189 3300049573 Ga0501037_0046229 Ga0501037_0046229_168_1034 284
190 3300049581 Ga0501047_0096742 Ga0501047_0096742_1774_2640 284
191 3300049823 Ga0501044_0002316 Ga0501044_0002316_20626_21492 284
192 3300028556 Ga0265337_1030853 Ga0265337_10308532 285
193 3300028558 Ga0265326_10018217 Ga0265326_100182172 285
194 3300031251 Ga0265327_10003267 Ga0265327_100032676 285
195 3300005436 Ga0070713_100178576 Ga0070713_1001785762 286
196 3300005539 Ga0068853_100048986 Ga0068853_1000489863 286
197 3300025904 Ga0207647_10134320 Ga0207647_101343202 286
198 3300026041 Ga0207639_10044108 Ga0207639_100441083 286
199 3300038443 Ga0395901_0219885 Ga0395901_0219885_38_982 286
200 3300045049 Ga0466959_0213912 Ga0466959_0213912_435_1319 286
201 iso_pu_bacteria 2503198000 2503201510 286
202 iso_pu_bacteria 2509276022 2509396289 286
203 iso_pu_bacteria 2512875016 2512931521 286
204 iso_pu_bacteria 2512875024 2512959353 286
205 iso_pu_bacteria 2513237164 2514033593 286
206 iso_pu_bacteria 2513237305 2514420861 286
207 iso_pu_bacteria 2599185301 2599936770 286
208 iso_pu_bacteria 2693429783 2694631054 286
209 iso_pu_bacteria 2693429784 2694636448 286
210 iso_pu_bacteria 2847686936 2847692240 286
211 iso_pu_bacteria 2856320880 2856327501 286
212 iso_pu_bacteria 2856356410 2856363634 286
213 iso_pu_bacteria 2856364286 2856369438 286
214 iso_pu_bacteria 2857349434 2857351170 286
215 iso_pu_bacteria 2869162929 2869167273 286
216 iso_pu_bacteria 2869278585 2869284911 286
217 iso_pu_bacteria 2869285874 2869286489 286
218 iso_pu_bacteria 2871429161 2871434642 286
219 iso_pu_bacteria 2871488783 2871494562 286
220 iso_pu_bacteria 2874102143 2874109022 286
221 iso_pu_bacteria 2874123672 2874130581 286
222 iso_pu_bacteria 2874139085 2874145854 286
223 iso_pu_bacteria 2874146452 2874149847 286
224 iso_pu_bacteria 2874155637 2874158105 286
225 iso_pu_bacteria 2876363079 2876368502 286
226 iso_pu_bacteria 2876369609 2876375576 286
227 iso_pu_bacteria 2876377896 2876383689 286
228 iso_pu_bacteria 2876392853 2876398422 286
229 iso_pu_bacteria 2876413966 2876416309 286
230 iso_pu_bacteria 2878738818 2878745193 286
231 iso_pu_bacteria 2878745973 2878751775 286
232 iso_pu_bacteria 2878753008 2878758856 286
233 iso_pu_bacteria 2878760144 2878765396 286
234 iso_pu_bacteria 2878767105 2878773104 286
235 iso_pu_bacteria 2881147464 2881151312 286
236 iso_pu_bacteria 2881161766 2881167512 286
237 iso_pu_bacteria 2881845957 2881848325 286
238 iso_pu_bacteria 2881853255 2881853817 286
239 iso_pu_bacteria 2881861095 2881865044 286
240 iso_pu_bacteria 2882632389 2882636255 286
241 iso_pu_bacteria 2882912400 2882918748 286
242 iso_pu_bacteria 2885312484 2885318007 286
243 iso_pu_bacteria 2885318864 2885324630 286
244 iso_pu_bacteria 2885342637 2885347279 286
245 iso_pu_bacteria 2885350715 2885351299 286
246 iso_pu_bacteria 2888337043 2888339404 286
247 iso_pu_bacteria 2888350351 2888355739 286
248 iso_pu_bacteria 2889010040 2889010676 286
249 iso_pu_bacteria 2889016732 2889017625 286
250 iso_pu_bacteria 2903448605 2903451292 286
251 iso_pu_bacteria 2903492973 2903503905 286
252 iso_pu_bacteria 2903492973 2903504721 286
253 iso_pu_bacteria 2903521522 2903527501 286
254 iso_pu_bacteria 2903528002 2903533955 286
255 iso_pu_bacteria 2904659560 2904664977 286
256 iso_pu_bacteria 2906308376 2906314173 286
257 iso_pu_bacteria 2906321335 2906327339 286
258 iso_pu_bacteria 2906328253 2906330023 286
259 iso_pu_bacteria 2906354277 2906355996 286
260 iso_pu_bacteria 2922158528 2922161109 286
261 iso_pu_bacteria 2922185730 2922187965 286
262 iso_pu_bacteria 2924718760 2924724596 286
263 iso_pu_bacteria 2924726620 2924727569 286
264 iso_pu_bacteria 2924762789 2924764272 286
265 iso_pu_bacteria 2924776078 2924783330 286
266 iso_pu_bacteria 2924784321 2924789059 286
267 iso_pu_bacteria 2937813078 2937815717 286
268 iso_pu_bacteria 2937822353 2937824434 286
269 iso_pu_bacteria 2937848649 2937851844 286
270 iso_pu_bacteria 2937877337 2937882143 286
271 iso_pu_bacteria 2937891427 2937896272 286
272 iso_pu_bacteria 2937972304 2937978603 286
273 iso_pu_bacteria 2937994558 2938000085 286
274 iso_pu_bacteria 2938014810 2938016094 286
275 iso_pu_bacteria 2958041894 2958056443 286
276 iso_pu_bacteria 2958084443 2958089265 286
277 iso_pu_bacteria 2958100919 2958105726 286
278 iso_pu_bacteria 2958115193 2958118444 286
279 iso_pu_bacteria 2958130278 2958130892 286
280 iso_pu_bacteria 2958144490 2958147677 286
281 iso_pu_bacteria 2958165035 2958170549 286
282 iso_pu_bacteria 2958172287 2958174494 286
283 iso_pu_bacteria 2958179912 2958184813 286
284 iso_pu_bacteria 2961077736 2961082980 286
285 iso_pu_bacteria 2961114664 2961119976 286
286 iso_pu_bacteria 2961163497 2961169004 286
287 iso_pu_bacteria 2965018300 2965024291 286
288 iso_pu_bacteria 2965062239 2965065987 286
289 iso_pu_bacteria 2965119406 2965122303 286
290 iso_pu_bacteria 2968016561 2968018470 286
291 iso_pu_bacteria 2968091066 2968096349 286
292 iso_pu_bacteria 2968097103 2968098850 286
293 iso_pu_bacteria 2968110612 2968116333 286
294 iso_pu_bacteria 2968117919 2968120614 286
295 iso_pu_bacteria 2968128360 2968129168 286
296 iso_pu_bacteria 2968171901 2968177398 286
297 iso_pu_bacteria 2970469710 2970471357 286
298 iso_pu_bacteria 2970489779 2970492901 286
299 iso_pu_bacteria 2970554993 2970560244 286
300 iso_pu_bacteria 2977843712 2977845953 286
301 iso_pu_bacteria 2977858184 2977861323 286
302 iso_pu_bacteria 2977864932 2977867103 286
303 iso_pu_bacteria 2977922695 2977924199 286
304 iso_pu_bacteria 2977942078 2977942731 286
305 iso_pu_bacteria 2977971508 2977971937 286
306 iso_pu_bacteria 2977986579 2977987415 286
307 iso_pu_bacteria 2979710463 2979714940 286
308 iso_pu_bacteria 2979779861 2979785592 286
309 iso_pu_bacteria 2987636660 2987638354 286
310 iso_pu_bacteria 2987652177 2987658383 286
311 iso_pu_bacteria 2987659509 2987665035 286
312 iso_pu_bacteria 2996341866 2996345054 286
313 iso_pu_bacteria 2996348954 2996350149 286
314 iso_pu_bacteria 3004188549 3004194092 286
315 iso_pu_bacteria 3004203850 3004205402 286
316 iso_pu_bacteria 3004211236 3004215933 286
317 iso_pu_bacteria 3004218560 3004223683 286
318 iso_pu_bacteria 3004275668 3004276848 286
319 iso_pu_bacteria 3004334049 3004334382 286
320 iso_pu_bacteria 637000159 637074621 286
321 iso_pu_bacteria 8004387939 8004393663 286
322 iso_pu_bacteria 8004445564 8004450217 286
323 iso_pu_bacteria 8004640170 8004640843 286
324 iso_pu_bacteria 8004703790 8004709346 286
325 iso_pu_bacteria 8004714634 8004720431 286
326 3300038443 Ga0395901_0400617 Ga0395901_0400617_189_1262 287
327 iso_pu_bacteria 2871451962 2871457192 287
328 3300002705 JGI25156J39149_1002502 JGI25156J39149_10025023 288
329 3300002741 JGI25157J39369_1000162 JGI25157J39369_100016256 288
330 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015200 288
331 3300003762 Ga0055542_1000601 Ga0055542_100060121 288
332 3300005578 Ga0068854_100160901 Ga0068854_1001609012 288
333 3300005616 Ga0068852_100310155 Ga0068852_1003101551 288
334 3300006038 Ga0075365_10004112 Ga0075365_100041129 288
335 3300006042 Ga0075368_10067201 Ga0075368_100672012 288
336 3300006048 Ga0075363_100010332 Ga0075363_1000103323 288
337 3300006051 Ga0075364_10051448 Ga0075364_100514482 288
338 3300006178 Ga0075367_10072656 Ga0075367_100726562 288
339 3300006178 Ga0075367_10164652 Ga0075367_101646522 288
340 3300006353 Ga0075370_10156993 Ga0075370_101569932 288
341 3300009093 Ga0105240_10291139 Ga0105240_102911392 288
342 3300009551 Ga0105238_10029129 Ga0105238_100291296 288
343 3300009551 Ga0105238_10217028 Ga0105238_102170282 288
344 3300009551 Ga0105238_10376927 Ga0105238_103769272 288
345 3300010375 Ga0105239_10105954 Ga0105239_101059542 288
346 3300010375 Ga0105239_10252800 Ga0105239_102528002 288
347 3300013104 Ga0157370_10192809 Ga0157370_101928092 288
348 3300013104 Ga0157370_10450327 Ga0157370_104503272 288
349 3300013105 Ga0157369_10325192 Ga0157369_103251921 288
350 3300013296 Ga0157374_10068374 Ga0157374_100683742 288
351 3300013296 Ga0157374_10544686 Ga0157374_105446862 288
352 3300025250 Ga0209026_1000025 Ga0209026_1000025110 288
353 3300025256 Ga0209759_1000121 Ga0209759_1000121122 288
354 3300025261 Ga0209233_1000010 Ga0209233_1000010298 288
355 3300025261 Ga0209233_1001825 Ga0209233_10018255 288
356 3300025904 Ga0207647_10090650 Ga0207647_100906502 288
357 3300025960 Ga0207651_10358156 Ga0207651_103581562 288
358 3300026067 Ga0207678_10119358 Ga0207678_101193582 288
359 3300037312 Ga0395899_0181444 Ga0395899_0181444_405_1277 288
360 3300037418 Ga0395900_0020814 Ga0395900_0020814_5562_6434 288
361 3300037418 Ga0395900_0059579 Ga0395900_0059579_167_1039 288
362 3300037466 Ga0395898_0600607 Ga0395898_0600607_27_899 288
363 3300037471 Ga0395905_0037666 Ga0395905_0037666_3035_3907 288
364 3300037471 Ga0395905_0101025 Ga0395905_0101025_442_1314 288
365 3300037471 Ga0395905_0201506 Ga0395905_0201506_398_1339 288
366 3300038443 Ga0395901_0019713 Ga0395901_0019713_219_1091 288
367 3300038443 Ga0395901_0029109 Ga0395901_0029109_3090_3962 288
368 3300038443 Ga0395901_0107902 Ga0395901_0107902_1354_2226 288
369 3300038443 Ga0395901_0339010 Ga0395901_0339010_383_1255 288
370 3300044658 Ga0466972_0019059 Ga0466972_0019059_2203_3075 288
371 3300046660 Ga0495625_0318370 Ga0495625_0318370_63_935 288
372 3300046810 Ga0495660_0117445 Ga0495660_0117445_449_1321 288
373 3300048905 Ga0496102_0208205 Ga0496102_0208205_207_1079 288
374 3300048905 Ga0496102_0356101 Ga0496102_0356101_224_1096 288
375 3300048915 Ga0496112_0036243 Ga0496112_0036243_719_1591 288
376 3300048918 Ga0496115_0039315 Ga0496115_0039315_1867_2808 288
377 3300048921 Ga0496118_0141896 Ga0496118_0141896_633_1505 288
378 3300048922 Ga0496119_0140232 Ga0496119_0140232_231_1103 288
379 3300048923 Ga0496120_0001242 Ga0496120_0001242_29292_30164 288
380 3300048929 Ga0496126_0115114 Ga0496126_0115114_116_988 288
381 3300050490 nmdc:mga03n38_27103_c1 nmdc:mga03n38_27103_c1_65_937 288
382 3300050490 nmdc:mga03n38_46021_c1 nmdc:mga03n38_46021_c1_615_1556 288
383 3300050491 nmdc:mga00v17_121098_c1 nmdc:mga00v17_121098_c1_434_1375 288
384 3300050492 nmdc:mga0yw44_152279_c1 nmdc:mga0yw44_152279_c1_620_1492 288
385 3300050492 nmdc:mga0yw44_185493_c1 nmdc:mga0yw44_185493_c1_292_1233 288
386 3300050496 nmdc:mga07m45_102790_c1 nmdc:mga07m45_102790_c1_565_1437 288
387 3300053079 Ga0500610_0040164 Ga0500610_0040164_406_1347 288
388 3300053155 Ga0500620_000398 Ga0500620_000398_5606_6478 288
389 iso_pu_bacteria 2508501123 2509113115 288
390 iso_pu_bacteria 2510065059 2510315524 288
391 iso_pu_bacteria 2588253730 2588517358 288
392 iso_pu_bacteria 2756170246 2756675491 288
393 iso_pu_bacteria 2791355123 2792750280 288
394 iso_pu_bacteria 2844002411 2844007448 288
395 iso_pu_bacteria 2844009547 2844013685 288
396 iso_pu_bacteria 2856328259 2856334547 288
397 iso_pu_bacteria 2856334872 2856335619 288
398 iso_pu_bacteria 2857367948 2857371344 288
399 iso_pu_bacteria 2869169390 2869172896 288
400 iso_pu_bacteria 2869234852 2869236565 288
401 iso_pu_bacteria 2869242130 2869249085 288
402 iso_pu_bacteria 2869256925 2869263854 288
403 iso_pu_bacteria 2869264136 2869265415 288
404 iso_pu_bacteria 2869271264 2869272208 288
405 iso_pu_bacteria 2871435913 2871439943 288
406 iso_pu_bacteria 2871459585 2871463566 288
407 iso_pu_bacteria 2871466892 2871473095 288
408 iso_pu_bacteria 2871481445 2871482470 288
409 iso_pu_bacteria 2874116593 2874117746 288
410 iso_pu_bacteria 2874131515 2874134373 288
411 iso_pu_bacteria 2874162495 2874164442 288
412 iso_pu_bacteria 2874168670 2874169834 288
413 iso_pu_bacteria 2876386047 2876392671 288
414 iso_pu_bacteria 2876399893 2876403711 288
415 iso_pu_bacteria 2876406927 2876408759 288
416 iso_pu_bacteria 2876420981 2876422565 288
417 iso_pu_bacteria 2878730984 2878738676 288
418 iso_pu_bacteria 2878774303 2878775931 288
419 iso_pu_bacteria 2878781027 2878785863 288
420 iso_pu_bacteria 2906363423 2906369843 288
421 iso_pu_bacteria 2906370794 2906372181 288
422 iso_pu_bacteria 2906378014 2906379602 288
423 iso_pu_bacteria 2906386501 2906392748 288
424 iso_pu_bacteria 2906393657 2906399598 288
425 iso_pu_bacteria 2906401398 2906404275 288
426 iso_pu_bacteria 2906408224 2906408886 288
427 iso_pu_bacteria 2906427513 2906435542 288
428 iso_pu_bacteria 2922151315 2922152053 288
429 iso_pu_bacteria 2922172374 2922176152 288
430 iso_pu_bacteria 2922178524 2922183438 288
431 iso_pu_bacteria 2924733363 2924739109 288
432 iso_pu_bacteria 2924741084 2924744220 288
433 iso_pu_bacteria 2924748358 2924753661 288
434 iso_pu_bacteria 2937861824 2937865560 288
435 iso_pu_bacteria 2958034702 2958040613 288
436 iso_pu_bacteria 2958041894 2958056695 288
437 iso_pu_bacteria 2958064165 2958064393 288
438 iso_pu_bacteria 2958092219 2958096815 288
439 iso_pu_bacteria 2958108152 2958115032 288
440 iso_pu_bacteria 2958122699 2958127558 288
441 iso_pu_bacteria 2961127735 2961130363 288
442 iso_pu_bacteria 2961136820 2961137467 288
443 iso_pu_bacteria 2961170736 2961176066 288
444 iso_pu_bacteria 2961183825 2961190353 288
445 iso_pu_bacteria 2963644680 2963647691 288
446 iso_pu_bacteria 2965025482 2965031771 288
447 iso_pu_bacteria 2965032056 2965034364 288
448 iso_pu_bacteria 2965040258 2965040409 288
449 iso_pu_bacteria 2965047637 2965052814 288
450 iso_pu_bacteria 2965102966 2965105886 288
451 iso_pu_bacteria 2967996073 2968001953 288
452 iso_pu_bacteria 2968003550 2968009023 288
453 iso_pu_bacteria 2968083720 2968090322 288
454 iso_pu_bacteria 2968138860 2968145283 288
455 iso_pu_bacteria 2970503327 2970508732 288
456 iso_pu_bacteria 2970510686 2970511071 288
457 iso_pu_bacteria 2970532167 2970539964 288
458 iso_pu_bacteria 2970547951 2970552042 288
459 iso_pu_bacteria 2970593180 2970599526 288
460 iso_pu_bacteria 2970619444 2970621220 288
461 iso_pu_bacteria 2970627176 2970630713 288
462 iso_pu_bacteria 2977821940 2977827396 288
463 iso_pu_bacteria 2977828996 2977832832 288
464 iso_pu_bacteria 2977851361 2977857728 288
465 iso_pu_bacteria 2977872689 2977873007 288
466 iso_pu_bacteria 2977898635 2977900425 288
467 iso_pu_bacteria 2977915119 2977922622 288
468 iso_pu_bacteria 2977935797 2977936033 288
469 iso_pu_bacteria 2977950692 2977954913 288
470 iso_pu_bacteria 2977957713 2977962070 288
471 iso_pu_bacteria 2979764755 2979768366 288
472 iso_pu_bacteria 2979772303 2979778767 288
473 iso_pu_bacteria 2979793036 2979796436 288
474 iso_pu_bacteria 2979808191 2979811620 288
475 iso_pu_bacteria 2987645492 2987650243 288
476 iso_pu_bacteria 2987666974 2987668006 288
477 iso_pu_bacteria 2996386984 2996391464 288
478 iso_pu_bacteria 3000135777 3000140683 288
479 iso_pu_bacteria 3004167301 3004168878 288
480 iso_pu_bacteria 3004195979 3004198025 288
481 iso_pu_bacteria 3004232784 3004239532 288
482 iso_pu_bacteria 3004239961 3004240719 288
483 iso_pu_bacteria 3004268573 3004274923 288
484 iso_pu_bacteria 3004289098 3004289769 288
485 iso_pu_bacteria 649633066 649872954 288
486 iso_pu_bacteria 8004300914 8004302608 288
487 iso_pu_bacteria 8004312739 8004318574 288
488 iso_pu_bacteria 8004361976 8004364431 288
489 iso_pu_bacteria 8004374579 8004380377 288
490 iso_pu_bacteria 8004695233 8004699635 288
491 iso_pu_bacteria 8004727605 8004732945 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17765

MLTR_LBD

MmyB-like transcription regulator ligand binding domain

144

311

0.98

PF13560

HTH_31

Helix-turn-helix domain

47

126

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8503 12 93
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8303 5 93
7ewe-assembly3.cif.gz_E mycobacterium tuberculosis higa2 (form iii) 0.8302 43 83
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8194 5 93
7ewc-assembly1.cif.gz_A mycobacterium tuberculosis higa2 (form i) 0.8133 15 83
ID Description Score Start End Superfamily
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8503 12 93 1.10.260.40
2ofyB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8419 7 90 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8303 5 93 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8228 43 88 1.10.260.40
2ebyB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8221 43 97 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2W4REA5-F1-model_v4 Transcriptional regulator 0.9776 8 96 GO:0003677
AF-A0A6B1ML08-F1-model_v4 deleted 0.9734 11 85
AF-A0A7K2M030-F1-model_v4 Helix-turn-helix domain-containing protein 0.9701 10 97 GO:0003677
AF-A0A6B3FDD3-F1-model_v4 Helix-turn-helix domain-containing protein 0.9647 20 101 GO:0003677
AF-A0A6B2DK90-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9591 11 92 GO:0003677

Feature Viewer

pLDDT pTM Quality
89.4 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map