F454058

General Info

Members Datasets Scaffolds Average Seq Length
491 235 982 312

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100015370|Ga0070659_1000153706
Length 364
Sequence MPKGFFSYYIFRLRSKISKLKIPSLVEKNIFLRSATNGFYYLQNFIRTFASYFINMNSIIFPDQTDFYKGKVRDVYTINDRLLVMIASNRISAFDVILPKPIPNKGQVLNQVAAHMLNATKDICKNWLLTTPAPNVSIGKKCDPFKVEMVVRGNVTGHAWRTYSSGEKILCGVKMPEGLRENDYFPEPIITPSTKAAEGHDEDISKEEIIRRKIVGKEDYEQLEKYALKLFARGKELAAKRGLILVDTKYEFGKLGDEIILIDEIHTPDSSRYFYADGFEKRQSKGEKQKQLSKEFVREWLIENNFMGKENQHVPEMSDEWISVIRNRYIELYEKLIGEKFVPQTLSDEETKERIIASLNDLKM

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
197 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
204 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
211 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
215 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
222 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
228 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
229 2818991444 Filimonas endophytica 3197 Isolate Unclassified
230 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
231 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
232 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
233 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
234 2914759650 Rhizosphaericola mali Isolate Rhizosphere
235 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 0
Rhizoplane 1.02
Rhizosphere 89.61
Stem 0
Stem Tuber 0
Unclassified 8.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100015370 3300005366 Bacteria 5733
2 SwRhRL2b_contig_1762647 2162886007 Bacteria 207340
3 JGI24740J21852_10006389 3300001979 Bacteria 4886
4 JGI24739J22299_10055840 3300001989 Bacteria 1261
5 JGI24751J29686_10006201 3300002459 Unclassified 2436
6 JGI25406J46586_10007985 3300003203 Bacteria 4812
7 rootL2_10027437 3300003322 Unclassified 2318
8 rootL2_10036715 3300003322 Bacteria 8207
9 rootL2_10331046 3300003322 Unclassified 1341
10 rootH1_10029767 3300003323 Bacteria 13135
11 rootH1_10046815 3300003323 Bacteria 11279
12 rootH1_10081256 3300003323 Bacteria 9212
13 rootH1_10115930 3300003323 Bacteria 8260
14 JGI25160J50197_1003536 3300003354 Bacteria 6963
15 JGI25160J50197_1005975 3300003354 Bacteria 4996
16 Ga0055526_1017447 3300003771 Bacteria 2739
17 Ga0055528_1003719 3300003790 Bacteria 7539
18 Ga0055530_10000583 3300003791 Bacteria 31527
19 Ga0055531_10049635 3300003794 Bacteria 1119
20 Ga0065165_1000657 3300005262 Bacteria 49860
21 Ga0065704_10070151 3300005289 Bacteria 259038
22 Ga0065704_10078469 3300005289 Bacteria 4419
23 Ga0065712_10128342 3300005290 Bacteria 1575
24 Ga0070683_100132515 3300005329 Unclassified 2359
25 Ga0070683_100235937 3300005329 Bacteria 1739
26 Ga0070670_100013660 3300005331 Bacteria 6960
27 Ga0070670_100025054 3300005331 Bacteria 5133
28 Ga0070670_100030103 3300005331 Bacteria 4675
29 Ga0070670_100104998 3300005331 Bacteria 2434
30 Ga0070670_100162100 3300005331 Bacteria 1938
31 Ga0068869_100002043 3300005334 Bacteria 12130
32 Ga0068869_100059139 3300005334 Bacteria 2805
33 Ga0070680_100056959 3300005336 Bacteria 3194
34 Ga0068868_100025038 3300005338 Bacteria 4533
35 Ga0068868_100060148 3300005338 Bacteria 3007
36 Ga0068868_100114319 3300005338 Bacteria 2196
37 Ga0068868_100413854 3300005338 Bacteria 1166
38 Ga0070660_100008582 3300005339 Bacteria 7155
39 Ga0070660_100010817 3300005339 Bacteria 6459
40 Ga0070660_100110870 3300005339 Bacteria 2183
41 Ga0070660_100264885 3300005339 Bacteria 1404
42 Ga0070660_100318208 3300005339 Bacteria 1278
43 Ga0070689_100002230 3300005340 Bacteria 12582
44 Ga0070689_100020658 3300005340 Bacteria 4889
45 Ga0070689_100022104 3300005340 Bacteria 4747
46 Ga0070687_100027377 3300005343 Bacteria 2754
47 Ga0070661_100016397 3300005344 Bacteria 5237
48 Ga0070661_100043146 3300005344 Unclassified 3294
49 Ga0070668_100008360 3300005347 Bacteria 7686
50 Ga0070675_100004073 3300005354 Bacteria 11096
51 Ga0070675_100115560 3300005354 Bacteria 2275
52 Ga0070674_100161600 3300005356 Bacteria 1700
53 Ga0070673_100004376 3300005364 Bacteria 8920
54 Ga0070673_100014656 3300005364 Bacteria 5472
55 Ga0070673_100028374 3300005364 Bacteria 4162
56 Ga0070673_100061505 3300005364 Bacteria 2979
57 Ga0070673_100128200 3300005364 Bacteria 2125
58 Ga0070673_100380768 3300005364 Bacteria 1258
59 Ga0070688_100043238 3300005365 Bacteria 2775
60 Ga0070688_100050404 3300005365 Bacteria 2593
61 Ga0070688_100080749 3300005365 Bacteria 2104
62 Ga0070659_100002698 3300005366 Bacteria 12622
63 Ga0070659_100071524 3300005366 Unclassified 2758
64 Ga0070667_100104542 3300005367 Bacteria 2449
65 Ga0070663_100068810 3300005455 Unclassified 2570
66 Ga0070678_100050085 3300005456 Unclassified 3019
67 Ga0070662_100135747 3300005457 Bacteria 1902
68 Ga0070681_10033300 3300005458 Bacteria 5173
69 Ga0070681_10046548 3300005458 Bacteria 4337
70 Ga0070681_10131224 3300005458 Bacteria 2438
71 Ga0070681_10242119 3300005458 Bacteria 1717
72 Ga0068867_100014573 3300005459 Bacteria 5571
73 Ga0068867_100037650 3300005459 Unclassified 3516
74 Ga0070685_10033505 3300005466 Bacteria 2887
75 Ga0070685_10057301 3300005466 Bacteria 2267
76 Ga0070679_100005166 3300005530 Bacteria 12080
77 Ga0070679_100013309 3300005530 Bacteria 7876
78 Ga0070679_100060943 3300005530 Bacteria 3761
79 Ga0070679_100104569 3300005530 Bacteria 2818
80 Ga0070679_100298976 3300005530 Bacteria 1560
81 Ga0068853_100051252 3300005539 Bacteria 3552
82 Ga0068853_100098011 3300005539 Bacteria 2589
83 Ga0070672_100065720 3300005543 Bacteria 2870
84 Ga0070686_100005927 3300005544 Bacteria 6775
85 Ga0070686_100298531 3300005544 Bacteria 1194
86 Ga0070665_100124213 3300005548 Bacteria 2583
87 Ga0068855_100000454 3300005563 Bacteria 50341
88 Ga0068855_100005142 3300005563 Bacteria 15957
89 Ga0068855_100047499 3300005563 Bacteria 5071
90 Ga0068855_100048054 3300005563 Bacteria 5037
91 Ga0068855_100134778 3300005563 Bacteria 2818
92 Ga0070664_100193221 3300005564 Bacteria 1814
93 Ga0068857_100105633 3300005577 Bacteria 2528
94 Ga0068857_100184401 3300005577 Bacteria 1899
95 Ga0068857_100421867 3300005577 Bacteria 1244
96 Ga0068854_100063389 3300005578 Bacteria 2683
97 Ga0068854_100125930 3300005578 Bacteria 1951
98 Ga0068856_100038663 3300005614 Bacteria 4684
99 Ga0068856_100124363 3300005614 Bacteria 2582
100 Ga0068856_100279363 3300005614 Bacteria 1686
101 Ga0068852_100011063 3300005616 Bacteria 6775
102 Ga0068852_100078707 3300005616 Bacteria 2917
103 Ga0068859_100017814 3300005617 Bacteria 7140
104 Ga0068859_100051471 3300005617 Unclassified 4140
105 Ga0068859_100360016 3300005617 Bacteria 1550
106 Ga0068859_100443041 3300005617 Bacteria 1395
107 Ga0068864_100039378 3300005618 Bacteria 4041
108 Ga0068864_100097022 3300005618 Bacteria 2609
109 Ga0068864_100168436 3300005618 Bacteria 1996
110 Ga0068861_100001097 3300005719 Bacteria 16748
111 Ga0068861_100088162 3300005719 Unclassified 2443
112 Ga0068851_10097028 3300005834 Bacteria 1559
113 Ga0068863_100092283 3300005841 Bacteria 2873
114 Ga0068863_100153112 3300005841 Bacteria 2207
115 Ga0068863_100424227 3300005841 Bacteria 1303
116 Ga0068858_100442914 3300005842 Unclassified 1251
117 Ga0068858_100510792 3300005842 Bacteria 1161
118 Ga0068860_100004295 3300005843 Bacteria 14565
119 Ga0068860_100016616 3300005843 Bacteria 7177
120 Ga0068860_100056518 3300005843 Bacteria 3730
121 Ga0068862_100036131 3300005844 Bacteria 4186
122 Ga0068862_100200796 3300005844 Bacteria 1798
123 Ga0081539_10001220 3300005985 Bacteria 45919
124 Ga0097621_100162380 3300006237 Unclassified 1921
125 Ga0097621_100278162 3300006237 Bacteria 1473
126 Ga0097621_100309597 3300006237 Unclassified 1397
127 Ga0075428_100018437 3300006844 Bacteria 7717
128 Ga0075428_100041851 3300006844 Bacteria 5037
129 Ga0075430_100135164 3300006846 Unclassified 2055
130 Ga0075431_100023784 3300006847 Bacteria 6271
131 Ga0075429_100004950 3300006880 Bacteria 11474
132 Ga0075429_100235970 3300006880 Bacteria 1602
133 Ga0075429_100313074 3300006880 Bacteria 1374
134 Ga0068865_100030544 3300006881 Bacteria 3585
135 Ga0097620_100002930 3300006931 Bacteria 17331
136 Ga0097620_100017814 3300006931 Bacteria 7140
137 Ga0097620_100051471 3300006931 Unclassified 4140
138 Ga0097620_100094936 3300006931 Bacteria 3035
139 Ga0097620_100360007 3300006931 Bacteria 1550
140 Ga0097620_100442995 3300006931 Bacteria 1395
141 Ga0105240_10019673 3300009093 Bacteria 9017
142 Ga0105240_10044686 3300009093 Bacteria 5626
143 Ga0105240_10060066 3300009093 Bacteria 4741
144 Ga0105240_10060871 3300009093 Bacteria 4706
145 Ga0111539_10036535 3300009094 Bacteria 5937
146 Ga0111539_10303914 3300009094 Bacteria 1856
147 Ga0111539_10437031 3300009094 Bacteria 1524
148 Ga0114129_10334743 3300009147 Bacteria 2009
149 Ga0105241_10004396 3300009174 Bacteria 10420
150 Ga0105242_10031023 3300009176 Unclassified 4267
151 Ga0105242_10060912 3300009176 Bacteria 3103
152 Ga0105242_10120592 3300009176 Bacteria 2250
153 Ga0105242_10135015 3300009176 Bacteria 2134
154 Ga0105248_10106170 3300009177 Bacteria 3166
155 Ga0105248_10499059 3300009177 Bacteria 1372
156 Ga0105237_10009302 3300009545 Bacteria 10530
157 Ga0105237_10027081 3300009545 Bacteria 5855
158 Ga0105237_10078748 3300009545 Bacteria 3285
159 Ga0105237_10146114 3300009545 Bacteria 2359
160 Ga0105238_10108616 3300009551 Bacteria 2755
161 Ga0105249_10012020 3300009553 Bacteria 7618
162 Ga0105249_10014397 3300009553 Bacteria 6993
163 Ga0105239_10005001 3300010375 Bacteria 15651
164 Ga0105239_10011812 3300010375 Bacteria 9746
165 Ga0105239_10012617 3300010375 Bacteria 9403
166 Ga0105239_10024882 3300010375 Bacteria 6593
167 Ga0105239_10030625 3300010375 Bacteria 5918
168 Ga0105239_10048628 3300010375 Bacteria 4650
169 Ga0105239_10219494 3300010375 Bacteria 2132
170 Ga0157373_10007196 3300013100 Bacteria 8299
171 Ga0157373_10035115 3300013100 Bacteria 3600
172 Ga0157373_10161653 3300013100 Bacteria 1576
173 Ga0157371_10000596 3300013102 Bacteria 43030
174 Ga0157371_10002123 3300013102 Bacteria 19298
175 Ga0157371_10002924 3300013102 Bacteria 15952
176 Ga0157371_10008508 3300013102 Bacteria 8167
177 Ga0157371_10014887 3300013102 Bacteria 5854
178 Ga0157371_10021886 3300013102 Bacteria 4691
179 Ga0157371_10026759 3300013102 Bacteria 4189
180 Ga0157371_10029167 3300013102 Bacteria 3994
181 Ga0157371_10029962 3300013102 Bacteria 3928
182 Ga0157371_10030732 3300013102 Bacteria 3873
183 Ga0157371_10139498 3300013102 Bacteria 1727
184 Ga0157371_10155575 3300013102 Unclassified 1631
185 Ga0157370_10000795 3300013104 Bacteria 39727
186 Ga0157370_10001240 3300013104 Bacteria 31893
187 Ga0157370_10002386 3300013104 Bacteria 22657
188 Ga0157370_10007153 3300013104 Bacteria 12177
189 Ga0157370_10019578 3300013104 Bacteria 6783
190 Ga0157369_10010751 3300013105 Bacteria 10420
191 Ga0157369_10015466 3300013105 Bacteria 8598
192 Ga0157369_10044911 3300013105 Bacteria 4807
193 Ga0157369_10068407 3300013105 Bacteria 3815
194 Ga0157369_10090334 3300013105 Bacteria 3270
195 Ga0157369_10262077 3300013105 Bacteria 1803
196 Ga0157374_10046150 3300013296 Bacteria 4034
197 Ga0157374_10059556 3300013296 Bacteria 3571
198 Ga0157378_10004750 3300013297 Bacteria 11909
199 Ga0157378_10006518 3300013297 Bacteria 10203
200 Ga0157378_10008259 3300013297 Bacteria 9076
201 Ga0157378_10064856 3300013297 Unclassified 3268
202 Ga0157378_10065912 3300013297 Bacteria 3242
203 Ga0163162_10000531 3300013306 Bacteria 35292
204 Ga0163162_10024316 3300013306 Bacteria 5978
205 Ga0163162_10029614 3300013306 Bacteria 5419
206 Ga0163162_10198148 3300013306 Unclassified 2137
207 Ga0157372_10000891 3300013307 Bacteria 32419
208 Ga0157372_10002466 3300013307 Bacteria 20053
209 Ga0157372_10013318 3300013307 Bacteria 8778
210 Ga0157372_10015360 3300013307 Bacteria 8205
211 Ga0157372_10025864 3300013307 Bacteria 6383
212 Ga0157372_10066036 3300013307 Bacteria 4064
213 Ga0157372_10087961 3300013307 Bacteria 3526
214 Ga0157372_10113387 3300013307 Bacteria 3107
215 Ga0157372_10154508 3300013307 Bacteria 2650
216 Ga0157372_10160838 3300013307 Unclassified 2595
217 Ga0157372_10292473 3300013307 Bacteria 1894
218 Ga0157372_10303658 3300013307 Unclassified 1857
219 Ga0157372_10326623 3300013307 Bacteria 1786
220 Ga0157372_10385123 3300013307 Bacteria 1634
221 Ga0157372_10482626 3300013307 Bacteria 1445
222 Ga0157375_10000230 3300013308 Bacteria 52234
223 Ga0157375_10131387 3300013308 Bacteria 2623
224 Ga0157375_10564857 3300013308 Unclassified 1299
225 Ga0157375_11013161 3300013308 Bacteria 970
226 Ga0163163_10066149 3300014325 Bacteria 3589
227 Ga0163163_10311187 3300014325 Unclassified 1628
228 Ga0157380_10074391 3300014326 Bacteria 2758
229 Ga0157380_10081873 3300014326 Unclassified 2641
230 Ga0157377_10007825 3300014745 Bacteria 5179
231 Ga0157377_10018018 3300014745 Bacteria 3664
232 Ga0157377_10050481 3300014745 Bacteria 2343
233 Ga0157379_10068374 3300014968 Bacteria 3176
234 Ga0157379_10156111 3300014968 Bacteria 2059
235 Ga0157376_10000514 3300014969 Bacteria 24959
236 Ga0157376_10106073 3300014969 Bacteria 2465
237 Ga0157376_10149134 3300014969 Bacteria 2107
238 Ga0157376_10160294 3300014969 Bacteria 2038
239 Ga0157376_10472780 3300014969 Bacteria 1227
240 Ga0182005_1000087 3300015265 Bacteria 70160
241 Ga0163161_10004873 3300017792 Bacteria 9350
242 Ga0209436_104610 3300025208 Bacteria 3368
243 Ga0209673_1000263 3300025273 Bacteria 99337
244 Ga0209564_1013346 3300025295 Bacteria 3500
245 Ga0209564_1032861 3300025295 Bacteria 1553
246 Ga0209758_1030248 3300025297 Bacteria 2246
247 Ga0209050_1000323 3300025298 Bacteria 96020
248 Ga0207426_1000002 3300025302 Bacteria 1249660
249 Ga0207426_1000137 3300025302 Bacteria 199010
250 Ga0207426_1000363 3300025302 Bacteria 81330
251 Ga0207426_1001254 3300025302 Bacteria 22188
252 Ga0209257_1001211 3300025304 Bacteria 32394
253 Ga0207682_10052557 3300025893 Bacteria 1688
254 Ga0207647_10001835 3300025904 Bacteria 16292
255 Ga0207647_10059735 3300025904 Bacteria 2332
256 Ga0207647_10134387 3300025904 Bacteria 1452
257 Ga0207645_10008336 3300025907 Bacteria 7236
258 Ga0207705_10016899 3300025909 Bacteria 5226
259 Ga0207705_10136577 3300025909 Bacteria 1828
260 Ga0207654_10028106 3300025911 Bacteria 3064
261 Ga0207654_10060332 3300025911 Bacteria 2215
262 Ga0207654_10321994 3300025911 Bacteria 1057
263 Ga0207707_10046295 3300025912 Bacteria 3788
264 Ga0207707_10081061 3300025912 Bacteria 2833
265 Ga0207695_10000073 3300025913 Bacteria 312565
266 Ga0207695_10000092 3300025913 Bacteria 270514
267 Ga0207695_10016776 3300025913 Bacteria 8550
268 Ga0207695_10023267 3300025913 Bacteria 7007
269 Ga0207695_10034212 3300025913 Bacteria 5531
270 Ga0207671_10158650 3300025914 Bacteria 1751
271 Ga0207671_10365823 3300025914 Bacteria 1145
272 Ga0207660_10006054 3300025917 Bacteria 7850
273 Ga0207660_10061598 3300025917 Bacteria 2700
274 Ga0207662_10029338 3300025918 Bacteria 3187
275 Ga0207662_10124422 3300025918 Bacteria 1620
276 Ga0207657_10012812 3300025919 Bacteria 8253
277 Ga0207657_10025421 3300025919 Bacteria 5462
278 Ga0207657_10047995 3300025919 Bacteria 3729
279 Ga0207657_10139413 3300025919 Bacteria 1982
280 Ga0207657_10215962 3300025919 Bacteria 1538
281 Ga0207652_10000387 3300025921 Bacteria 45946
282 Ga0207652_10000831 3300025921 Bacteria 29402
283 Ga0207681_10008917 3300025923 Bacteria 6123
284 Ga0207681_10059815 3300025923 Bacteria 2613
285 Ga0207681_10128372 3300025923 Bacteria 1871
286 Ga0207650_10012075 3300025925 Bacteria 5955
287 Ga0207650_10020414 3300025925 Bacteria 4672
288 Ga0207650_10024000 3300025925 Unclassified 4330
289 Ga0207650_10356106 3300025925 Bacteria 1205
290 Ga0207659_10238754 3300025926 Bacteria 1469
291 Ga0207644_10037808 3300025931 Bacteria 3398
292 Ga0207644_10084977 3300025931 Bacteria 2347
293 Ga0207690_10106819 3300025932 Unclassified 2009
294 Ga0207690_10422220 3300025932 Bacteria 1067
295 Ga0207706_10010460 3300025933 Bacteria 8477
296 Ga0207706_10041973 3300025933 Bacteria 4053
297 Ga0207706_10188883 3300025933 Unclassified 1809
298 Ga0207686_10000632 3300025934 Bacteria 21858
299 Ga0207686_10058104 3300025934 Unclassified 2437
300 Ga0207686_10108311 3300025934 Bacteria 1869
301 Ga0207670_10072721 3300025936 Bacteria 2382
302 Ga0207669_10355607 3300025937 Bacteria 1133
303 Ga0207691_10041333 3300025940 Bacteria 4257
304 Ga0207711_10081611 3300025941 Bacteria 2826
305 Ga0207689_10016483 3300025942 Bacteria 6254
306 Ga0207689_10030945 3300025942 Unclassified 4459
307 Ga0207689_10034308 3300025942 Bacteria 4215
308 Ga0207689_10060518 3300025942 Bacteria 3114
309 Ga0207689_10078116 3300025942 Bacteria 2720
310 Ga0207661_10047778 3300025944 Bacteria 3399
311 Ga0207661_10149027 3300025944 Bacteria 2021
312 Ga0207679_10065341 3300025945 Bacteria 2722
313 Ga0207667_10000745 3300025949 Bacteria 42269
314 Ga0207667_10001687 3300025949 Bacteria 27830
315 Ga0207667_10005165 3300025949 Bacteria 15949
316 Ga0207667_10005263 3300025949 Bacteria 15781
317 Ga0207651_10043115 3300025960 Bacteria 3009
318 Ga0207651_10056194 3300025960 Unclassified 2708
319 Ga0207651_10121115 3300025960 Bacteria 1984
320 Ga0207712_10007819 3300025961 Bacteria 6756
321 Ga0207712_10011087 3300025961 Bacteria 5740
322 Ga0207712_10154546 3300025961 Bacteria 1776
323 Ga0207712_10161131 3300025961 Bacteria 1743
324 Ga0207712_10376044 3300025961 Bacteria 1187
325 Ga0207668_10032885 3300025972 Bacteria 3433
326 Ga0207640_10018181 3300025981 Bacteria 4126
327 Ga0207640_10109934 3300025981 Bacteria 1951
328 Ga0207658_10110943 3300025986 Bacteria 2168
329 Ga0207677_10018538 3300026023 Bacteria 4179
330 Ga0207677_10023583 3300026023 Bacteria 3805
331 Ga0207677_10043218 3300026023 Bacteria 2994
332 Ga0207703_10168064 3300026035 Bacteria 1927
333 Ga0207703_10329820 3300026035 Unclassified 1400
334 Ga0207639_10020142 3300026041 Bacteria 4773
335 Ga0207639_10127081 3300026041 Bacteria 2104
336 Ga0207639_10180101 3300026041 Bacteria 1797
337 Ga0207678_10016122 3300026067 Bacteria 6562
338 Ga0207708_10359468 3300026075 Bacteria 1196
339 Ga0207702_10096111 3300026078 Bacteria 2605
340 Ga0207641_10011172 3300026088 Bacteria 7365
341 Ga0207641_10533190 3300026088 Bacteria 1143
342 Ga0207648_10003269 3300026089 Bacteria 17039
343 Ga0207648_10089373 3300026089 Bacteria 2691
344 Ga0207648_10354945 3300026089 Bacteria 1322
345 Ga0207676_10099996 3300026095 Bacteria 2402
346 Ga0207676_10145314 3300026095 Bacteria 2036
347 Ga0207674_10023595 3300026116 Bacteria 6587
348 Ga0207674_10144684 3300026116 Bacteria 2336
349 Ga0207674_10209109 3300026116 Bacteria 1900
350 Ga0207674_10215160 3300026116 Unclassified 1870
351 Ga0207674_10387523 3300026116 Bacteria 1351
352 Ga0207675_100003516 3300026118 Bacteria 15294
353 Ga0207683_10062922 3300026121 Bacteria 3268
354 Ga0207683_10131343 3300026121 Bacteria 2253
355 Ga0207698_10173897 3300026142 Bacteria 1899
356 Ga0207698_10390872 3300026142 Bacteria 1326
357 Ga0207428_10069060 3300027907 Bacteria 2778
358 Ga0268264_10008752 3300028381 Bacteria 8402
359 Ga0268264_10043067 3300028381 Bacteria 3739
360 Ga0268264_10046039 3300028381 Bacteria 3623
361 Ga0268264_10050791 3300028381 Bacteria 3454
362 Ga0265334_10014652 3300028573 Bacteria 3266
363 Ga0265334_10056852 3300028573 Bacteria 1484
364 Ga0265338_10168926 3300028800 Unclassified 1680
365 Ga0265331_10029109 3300031250 Bacteria 2759
366 Ga0265327_10000084 3300031251 Bacteria 204433
367 Ga0265327_10000648 3300031251 Bacteria 56244
368 Ga0265314_10088089 3300031711 Bacteria 2028
369 Ga0316576_10021669 3300031727 Bacteria 4449
370 Ga0307510_10004045 3300033180 Bacteria 17204
371 Ga0373937_0235574 3300036401 Unclassified 1724
372 Ga0395899_0000174 3300037312 Bacteria 96065
373 Ga0395899_0009618 3300037312 Bacteria 7419
374 Ga0395899_0010967 3300037312 Bacteria 6941
375 Ga0395899_0023199 3300037312 Bacteria 4703
376 Ga0395899_0055696 3300037312 Bacteria 2924
377 Ga0395899_0062082 3300037312 Bacteria 2751
378 Ga0395900_0000203 3300037418 Bacteria 93536
379 Ga0395900_0027824 3300037418 Bacteria 5792
380 Ga0395900_0043373 3300037418 Bacteria 4636
381 Ga0395900_0142991 3300037418 Unclassified 2448
382 Ga0395900_0166306 3300037418 Bacteria 2247
383 Ga0395900_0195286 3300037418 Bacteria 2051
384 Ga0395898_0001285 3300037466 Bacteria 36916
385 Ga0395898_0011961 3300037466 Bacteria 8983
386 Ga0395898_0015964 3300037466 Bacteria 7694
387 Ga0395905_0000208 3300037471 Bacteria 91236
388 Ga0395905_0257780 3300037471 Bacteria 1628
389 Ga0395901_0002230 3300038443 Bacteria 19784
390 Ga0395901_0002261 3300038443 Bacteria 19652
391 Ga0395901_0053672 3300038443 Bacteria 4188
392 Ga0395901_0277921 3300038443 Bacteria 1740
393 Ga0400489_42594 3300039093 Unclassified 2084
394 Ga0436365_0716887 3300039437 Bacteria 1974
395 Ga0436365_1892627 3300039437 Bacteria 12715
396 Ga0439465_0022841 3300041413 Bacteria 1966
397 Ga0451789_0642936 3300041443 Bacteria 1844
398 Ga0451795_0891554 3300041456 Bacteria 1463
399 Ga0451833_0468790 3300041491 Bacteria 1018
400 Ga0451855_1562750 3300041511 Bacteria 1201
401 Ga0439431_0023155 3300041997 Bacteria 1501
402 Ga0439431_0028214 3300041997 Bacteria 1382
403 Ga0439445_0031379 3300042004 Bacteria 1381
404 Ga0451577_0000169 3300042876 Bacteria 144088
405 Ga0451577_0027013 3300042876 Bacteria 5196
406 Ga0451577_0135639 3300042876 Bacteria 2210
407 Ga0451577_0267255 3300042876 Bacteria 1549
408 Ga0466969_0000167 3300044656 Bacteria 35385
409 Ga0466972_0011666 3300044658 Bacteria 4413
410 Ga0453683_0000217 3300044673 Bacteria 76362
411 Ga0466965_0118520 3300044683 Bacteria 1365
412 Ga0466966_0000161 3300044684 Bacteria 43671
413 Ga0453684_0000536 3300044712 Bacteria 144088
414 Ga0453684_0000651 3300044712 Bacteria 125123
415 Ga0453684_0039344 3300044712 Bacteria 6447
416 Ga0453684_0689092 3300044712 Bacteria 1111
417 Ga0466968_0057674 3300044735 Bacteria 1670
418 Ga0466957_0000551 3300044842 Bacteria 18906
419 Ga0466959_0000005 3300045049 Bacteria 213958
420 Ga0451576_0000080 3300045051 Bacteria 242782
421 Ga0451576_0000215 3300045051 Bacteria 144088
422 Ga0451576_0031321 3300045051 Bacteria 5672
423 Ga0495606_0008239 3300046507 Bacteria 9104
424 Ga0495668_0002821 3300046616 Bacteria 13817
425 Ga0495636_0000095 3300047318 Bacteria 37484
426 Ga0495674_0162379 3300047319 Bacteria 1869
427 Ga0496100_0011901 3300048903 Bacteria 4969
428 Ga0496101_0016539 3300048904 Bacteria 4987
429 Ga0496114_0009383 3300048917 Bacteria 7770
430 Ga0501298_002337 3300049521 Bacteria 2859
431 Ga0501299_010541 3300049522 Bacteria 1545
432 Ga0501033_0022261 3300049570 Bacteria 4783
433 Ga0501033_0246928 3300049570 Bacteria 1266
434 Ga0501034_0000043 3300049571 Bacteria 229049
435 Ga0501034_0078283 3300049571 Bacteria 3311
436 Ga0501036_0085222 3300049572 Bacteria 2671
437 Ga0501037_0156892 3300049573 Bacteria 1624
438 Ga0501037_0193763 3300049573 Bacteria 1438
439 Ga0501038_0115207 3300049574 Bacteria 2222
440 Ga0501043_0028370 3300049579 Bacteria 4394
441 Ga0501047_0098606 3300049581 Bacteria 2800
442 Ga0501070_0014249 3300049586 Bacteria 6691
443 Ga0501074_0003119 3300049590 Bacteria 11685
444 Ga0501201_000180 3300049651 Bacteria 5586
445 Ga0501202_003943 3300049652 Bacteria 2570
446 Ga0501217_003838 3300049661 Unclassified 3057
447 Ga0501217_010701 3300049661 Bacteria 2015
448 Ga0501222_000476 3300049662 Bacteria 5975
449 Ga0501224_002165 3300049664 Bacteria 2664
450 Ga0501228_001449 3300049666 Bacteria 1734
451 Ga0501235_002557 3300049669 Bacteria 3916
452 Ga0501243_004021 3300049675 Bacteria 2196
453 Ga0501257_036371 3300049686 Bacteria 1199
454 Ga0501259_000937 3300049688 Bacteria 4806
455 Ga0501261_002640 3300049690 Bacteria 2200
456 Ga0501219_000530 3300049703 Bacteria 5702
457 Ga0501221_000102 3300049704 Bacteria 10239
458 Ga0501225_0000356 3300049705 Bacteria 14440
459 Ga0501225_0012028 3300049705 Unclassified 2432
460 Ga0501241_000187 3300049758 Bacteria 13984
461 Ga0501270_009581 3300049767 Unclassified 1255
462 Ga0501035_0007663 3300049822 Bacteria 10086
463 Ga0501035_0061821 3300049822 Bacteria 3332
464 Ga0501044_0032934 3300049823 Bacteria 5447
465 Ga0501044_0042192 3300049823 Bacteria 4747
466 Ga0501044_0084640 3300049823 Bacteria 3205
467 Ga0501212_007011 3300049851 Bacteria 1534
468 Ga0501284_00003 3300050005 Bacteria 212116
469 nmdc:mga09592_227112_c1 3300050508 Bacteria 1617
470 nmdc:mga09592_59541_c1 3300050508 Unclassified 3229
471 nmdc:mga09592_65655_c1 3300050508 Unclassified 3075
472 nmdc:mga0qj67_110865_c1 3300050509 Unclassified 2215
473 nmdc:mga08y16_104765_c1 3300050511 Bacteria 2944
474 nmdc:mga08y16_50484_c1 3300050511 Unclassified 4353
475 Ga0500578_0000718 3300053086 Bacteria 39295
476 Ga0500583_0042277 3300053092 Bacteria 2076
477 Ga0500569_000201 3300053109 Bacteria 9511
478 Ga0500572_009594 3300053111 Bacteria 2293
479 Ga0500652_000995 3300053131 Bacteria 9286
480 Ga0500658_0003388 3300053134 Bacteria 6030
481 Ga0500568_0087758 3300053139 Bacteria 1175
482 Ga0500577_0003024 3300053142 Bacteria 4342
483 Ga0500639_069663 3300053163 Bacteria 1795
484 2819575624 2818991442 Bacteria 8318214
485 2819588751 2818991444 Bacteria 6968812
486 2819678382 2818991460 Bacteria 7595395
487 2881957781 2881955468 Bacteria 3545609
488 2884793168 2884791551 Bacteria 8511252
489 2896089689 2896085136 Bacteria 6129793
490 2914763832 2914759650 Bacteria 4701441
491 2929925510 2929921140 Bacteria 8649150
492 Ga0070659_100015370
493 SwRhRL2b_contig_1762647
494 JGI24740J21852_10006389
495 JGI24739J22299_10055840
496 JGI24751J29686_10006201
497 JGI25406J46586_10007985
498 rootL2_10027437
499 rootL2_10036715
500 rootL2_10331046
501 rootH1_10029767
502 rootH1_10046815
503 rootH1_10081256
504 rootH1_10115930
505 JGI25160J50197_1003536
506 JGI25160J50197_1005975
507 Ga0055526_1017447
508 Ga0055528_1003719
509 Ga0055530_10000583
510 Ga0055531_10049635
511 Ga0065165_1000657
512 Ga0065704_10070151
513 Ga0065704_10078469
514 Ga0065712_10128342
515 Ga0070683_100132515
516 Ga0070683_100235937
517 Ga0070670_100013660
518 Ga0070670_100025054
519 Ga0070670_100030103
520 Ga0070670_100104998
521 Ga0070670_100162100
522 Ga0068869_100002043
523 Ga0068869_100059139
524 Ga0070680_100056959
525 Ga0068868_100025038
526 Ga0068868_100060148
527 Ga0068868_100114319
528 Ga0068868_100413854
529 Ga0070660_100008582
530 Ga0070660_100010817
531 Ga0070660_100110870
532 Ga0070660_100264885
533 Ga0070660_100318208
534 Ga0070689_100002230
535 Ga0070689_100020658
536 Ga0070689_100022104
537 Ga0070687_100027377
538 Ga0070661_100016397
539 Ga0070661_100043146
540 Ga0070668_100008360
541 Ga0070675_100004073
542 Ga0070675_100115560
543 Ga0070674_100161600
544 Ga0070673_100004376
545 Ga0070673_100014656
546 Ga0070673_100028374
547 Ga0070673_100061505
548 Ga0070673_100128200
549 Ga0070673_100380768
550 Ga0070688_100043238
551 Ga0070688_100050404
552 Ga0070688_100080749
553 Ga0070659_100002698
554 Ga0070659_100071524
555 Ga0070667_100104542
556 Ga0070663_100068810
557 Ga0070678_100050085
558 Ga0070662_100135747
559 Ga0070681_10033300
560 Ga0070681_10046548
561 Ga0070681_10131224
562 Ga0070681_10242119
563 Ga0068867_100014573
564 Ga0068867_100037650
565 Ga0070685_10033505
566 Ga0070685_10057301
567 Ga0070679_100005166
568 Ga0070679_100013309
569 Ga0070679_100060943
570 Ga0070679_100104569
571 Ga0070679_100298976
572 Ga0068853_100051252
573 Ga0068853_100098011
574 Ga0070672_100065720
575 Ga0070686_100005927
576 Ga0070686_100298531
577 Ga0070665_100124213
578 Ga0068855_100000454
579 Ga0068855_100005142
580 Ga0068855_100047499
581 Ga0068855_100048054
582 Ga0068855_100134778
583 Ga0070664_100193221
584 Ga0068857_100105633
585 Ga0068857_100184401
586 Ga0068857_100421867
587 Ga0068854_100063389
588 Ga0068854_100125930
589 Ga0068856_100038663
590 Ga0068856_100124363
591 Ga0068856_100279363
592 Ga0068852_100011063
593 Ga0068852_100078707
594 Ga0068859_100017814
595 Ga0068859_100051471
596 Ga0068859_100360016
597 Ga0068859_100443041
598 Ga0068864_100039378
599 Ga0068864_100097022
600 Ga0068864_100168436
601 Ga0068861_100001097
602 Ga0068861_100088162
603 Ga0068851_10097028
604 Ga0068863_100092283
605 Ga0068863_100153112
606 Ga0068863_100424227
607 Ga0068858_100442914
608 Ga0068858_100510792
609 Ga0068860_100004295
610 Ga0068860_100016616
611 Ga0068860_100056518
612 Ga0068862_100036131
613 Ga0068862_100200796
614 Ga0081539_10001220
615 Ga0097621_100162380
616 Ga0097621_100278162
617 Ga0097621_100309597
618 Ga0075428_100018437
619 Ga0075428_100041851
620 Ga0075430_100135164
621 Ga0075431_100023784
622 Ga0075429_100004950
623 Ga0075429_100235970
624 Ga0075429_100313074
625 Ga0068865_100030544
626 Ga0097620_100002930
627 Ga0097620_100017814
628 Ga0097620_100051471
629 Ga0097620_100094936
630 Ga0097620_100360007
631 Ga0097620_100442995
632 Ga0105240_10019673
633 Ga0105240_10044686
634 Ga0105240_10060066
635 Ga0105240_10060871
636 Ga0111539_10036535
637 Ga0111539_10303914
638 Ga0111539_10437031
639 Ga0114129_10334743
640 Ga0105241_10004396
641 Ga0105242_10031023
642 Ga0105242_10060912
643 Ga0105242_10120592
644 Ga0105242_10135015
645 Ga0105248_10106170
646 Ga0105248_10499059
647 Ga0105237_10009302
648 Ga0105237_10027081
649 Ga0105237_10078748
650 Ga0105237_10146114
651 Ga0105238_10108616
652 Ga0105249_10012020
653 Ga0105249_10014397
654 Ga0105239_10005001
655 Ga0105239_10011812
656 Ga0105239_10012617
657 Ga0105239_10024882
658 Ga0105239_10030625
659 Ga0105239_10048628
660 Ga0105239_10219494
661 Ga0157373_10007196
662 Ga0157373_10035115
663 Ga0157373_10161653
664 Ga0157371_10000596
665 Ga0157371_10002123
666 Ga0157371_10002924
667 Ga0157371_10008508
668 Ga0157371_10014887
669 Ga0157371_10021886
670 Ga0157371_10026759
671 Ga0157371_10029167
672 Ga0157371_10029962
673 Ga0157371_10030732
674 Ga0157371_10139498
675 Ga0157371_10155575
676 Ga0157370_10000795
677 Ga0157370_10001240
678 Ga0157370_10002386
679 Ga0157370_10007153
680 Ga0157370_10019578
681 Ga0157369_10010751
682 Ga0157369_10015466
683 Ga0157369_10044911
684 Ga0157369_10068407
685 Ga0157369_10090334
686 Ga0157369_10262077
687 Ga0157374_10046150
688 Ga0157374_10059556
689 Ga0157378_10004750
690 Ga0157378_10006518
691 Ga0157378_10008259
692 Ga0157378_10064856
693 Ga0157378_10065912
694 Ga0163162_10000531
695 Ga0163162_10024316
696 Ga0163162_10029614
697 Ga0163162_10198148
698 Ga0157372_10000891
699 Ga0157372_10002466
700 Ga0157372_10013318
701 Ga0157372_10015360
702 Ga0157372_10025864
703 Ga0157372_10066036
704 Ga0157372_10087961
705 Ga0157372_10113387
706 Ga0157372_10154508
707 Ga0157372_10160838
708 Ga0157372_10292473
709 Ga0157372_10303658
710 Ga0157372_10326623
711 Ga0157372_10385123
712 Ga0157372_10482626
713 Ga0157375_10000230
714 Ga0157375_10131387
715 Ga0157375_10564857
716 Ga0157375_11013161
717 Ga0163163_10066149
718 Ga0163163_10311187
719 Ga0157380_10074391
720 Ga0157380_10081873
721 Ga0157377_10007825
722 Ga0157377_10018018
723 Ga0157377_10050481
724 Ga0157379_10068374
725 Ga0157379_10156111
726 Ga0157376_10000514
727 Ga0157376_10106073
728 Ga0157376_10149134
729 Ga0157376_10160294
730 Ga0157376_10472780
731 Ga0182005_1000087
732 Ga0163161_10004873
733 Ga0209436_104610
734 Ga0209673_1000263
735 Ga0209564_1013346
736 Ga0209564_1032861
737 Ga0209758_1030248
738 Ga0209050_1000323
739 Ga0207426_1000002
740 Ga0207426_1000137
741 Ga0207426_1000363
742 Ga0207426_1001254
743 Ga0209257_1001211
744 Ga0207682_10052557
745 Ga0207647_10001835
746 Ga0207647_10059735
747 Ga0207647_10134387
748 Ga0207645_10008336
749 Ga0207705_10016899
750 Ga0207705_10136577
751 Ga0207654_10028106
752 Ga0207654_10060332
753 Ga0207654_10321994
754 Ga0207707_10046295
755 Ga0207707_10081061
756 Ga0207695_10000073
757 Ga0207695_10000092
758 Ga0207695_10016776
759 Ga0207695_10023267
760 Ga0207695_10034212
761 Ga0207671_10158650
762 Ga0207671_10365823
763 Ga0207660_10006054
764 Ga0207660_10061598
765 Ga0207662_10029338
766 Ga0207662_10124422
767 Ga0207657_10012812
768 Ga0207657_10025421
769 Ga0207657_10047995
770 Ga0207657_10139413
771 Ga0207657_10215962
772 Ga0207652_10000387
773 Ga0207652_10000831
774 Ga0207681_10008917
775 Ga0207681_10059815
776 Ga0207681_10128372
777 Ga0207650_10012075
778 Ga0207650_10020414
779 Ga0207650_10024000
780 Ga0207650_10356106
781 Ga0207659_10238754
782 Ga0207644_10037808
783 Ga0207644_10084977
784 Ga0207690_10106819
785 Ga0207690_10422220
786 Ga0207706_10010460
787 Ga0207706_10041973
788 Ga0207706_10188883
789 Ga0207686_10000632
790 Ga0207686_10058104
791 Ga0207686_10108311
792 Ga0207670_10072721
793 Ga0207669_10355607
794 Ga0207691_10041333
795 Ga0207711_10081611
796 Ga0207689_10016483
797 Ga0207689_10030945
798 Ga0207689_10034308
799 Ga0207689_10060518
800 Ga0207689_10078116
801 Ga0207661_10047778
802 Ga0207661_10149027
803 Ga0207679_10065341
804 Ga0207667_10000745
805 Ga0207667_10001687
806 Ga0207667_10005165
807 Ga0207667_10005263
808 Ga0207651_10043115
809 Ga0207651_10056194
810 Ga0207651_10121115
811 Ga0207712_10007819
812 Ga0207712_10011087
813 Ga0207712_10154546
814 Ga0207712_10161131
815 Ga0207712_10376044
816 Ga0207668_10032885
817 Ga0207640_10018181
818 Ga0207640_10109934
819 Ga0207658_10110943
820 Ga0207677_10018538
821 Ga0207677_10023583
822 Ga0207677_10043218
823 Ga0207703_10168064
824 Ga0207703_10329820
825 Ga0207639_10020142
826 Ga0207639_10127081
827 Ga0207639_10180101
828 Ga0207678_10016122
829 Ga0207708_10359468
830 Ga0207702_10096111
831 Ga0207641_10011172
832 Ga0207641_10533190
833 Ga0207648_10003269
834 Ga0207648_10089373
835 Ga0207648_10354945
836 Ga0207676_10099996
837 Ga0207676_10145314
838 Ga0207674_10023595
839 Ga0207674_10144684
840 Ga0207674_10209109
841 Ga0207674_10215160
842 Ga0207674_10387523
843 Ga0207675_100003516
844 Ga0207683_10062922
845 Ga0207683_10131343
846 Ga0207698_10173897
847 Ga0207698_10390872
848 Ga0207428_10069060
849 Ga0268264_10008752
850 Ga0268264_10043067
851 Ga0268264_10046039
852 Ga0268264_10050791
853 Ga0265334_10014652
854 Ga0265334_10056852
855 Ga0265338_10168926
856 Ga0265331_10029109
857 Ga0265327_10000084
858 Ga0265327_10000648
859 Ga0265314_10088089
860 Ga0316576_10021669
861 Ga0307510_10004045
862 Ga0373937_0235574
863 Ga0395899_0000174
864 Ga0395899_0009618
865 Ga0395899_0010967
866 Ga0395899_0023199
867 Ga0395899_0055696
868 Ga0395899_0062082
869 Ga0395900_0000203
870 Ga0395900_0027824
871 Ga0395900_0043373
872 Ga0395900_0142991
873 Ga0395900_0166306
874 Ga0395900_0195286
875 Ga0395898_0001285
876 Ga0395898_0011961
877 Ga0395898_0015964
878 Ga0395905_0000208
879 Ga0395905_0257780
880 Ga0395901_0002230
881 Ga0395901_0002261
882 Ga0395901_0053672
883 Ga0395901_0277921
884 Ga0400489_42594
885 Ga0436365_0716887
886 Ga0436365_1892627
887 Ga0439465_0022841
888 Ga0451789_0642936
889 Ga0451795_0891554
890 Ga0451833_0468790
891 Ga0451855_1562750
892 Ga0439431_0023155
893 Ga0439431_0028214
894 Ga0439445_0031379
895 Ga0451577_0000169
896 Ga0451577_0027013
897 Ga0451577_0135639
898 Ga0451577_0267255
899 Ga0466969_0000167
900 Ga0466972_0011666
901 Ga0453683_0000217
902 Ga0466965_0118520
903 Ga0466966_0000161
904 Ga0453684_0000536
905 Ga0453684_0000651
906 Ga0453684_0039344
907 Ga0453684_0689092
908 Ga0466968_0057674
909 Ga0466957_0000551
910 Ga0466959_0000005
911 Ga0451576_0000080
912 Ga0451576_0000215
913 Ga0451576_0031321
914 Ga0495606_0008239
915 Ga0495668_0002821
916 Ga0495636_0000095
917 Ga0495674_0162379
918 Ga0496100_0011901
919 Ga0496101_0016539
920 Ga0496114_0009383
921 Ga0501298_002337
922 Ga0501299_010541
923 Ga0501033_0022261
924 Ga0501033_0246928
925 Ga0501034_0000043
926 Ga0501034_0078283
927 Ga0501036_0085222
928 Ga0501037_0156892
929 Ga0501037_0193763
930 Ga0501038_0115207
931 Ga0501043_0028370
932 Ga0501047_0098606
933 Ga0501070_0014249
934 Ga0501074_0003119
935 Ga0501201_000180
936 Ga0501202_003943
937 Ga0501217_003838
938 Ga0501217_010701
939 Ga0501222_000476
940 Ga0501224_002165
941 Ga0501228_001449
942 Ga0501235_002557
943 Ga0501243_004021
944 Ga0501257_036371
945 Ga0501259_000937
946 Ga0501261_002640
947 Ga0501219_000530
948 Ga0501221_000102
949 Ga0501225_0000356
950 Ga0501225_0012028
951 Ga0501241_000187
952 Ga0501270_009581
953 Ga0501035_0007663
954 Ga0501035_0061821
955 Ga0501044_0032934
956 Ga0501044_0042192
957 Ga0501044_0084640
958 Ga0501212_007011
959 Ga0501284_00003
960 nmdc:mga09592_227112_c1
961 nmdc:mga09592_59541_c1
962 nmdc:mga09592_65655_c1
963 nmdc:mga0qj67_110865_c1
964 nmdc:mga08y16_104765_c1
965 nmdc:mga08y16_50484_c1
966 Ga0500578_0000718
967 Ga0500583_0042277
968 Ga0500569_000201
969 Ga0500572_009594
970 Ga0500652_000995
971 Ga0500658_0003388
972 Ga0500568_0087758
973 Ga0500577_0003024
974 Ga0500639_069663
975 2819575624
976 2819588751
977 2819678382
978 2881957781
979 2884793168
980 2896089689
981 2914763832
982 2929925510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

66

315

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u54-assembly1.cif.gz_A crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3 0.9053 16 285
2z02-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazolesuccinocarboxamide synthase wit atp from methanocaldococcus jannaschii 0.9045 11 281
2yzl-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii 0.8989 11 281
4o7n-assembly1.cif.gz_A saicar synthetase (type-2) in complex with adp 0.896 9 285
3u54-assembly1.cif.gz_A crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3 0.8939 16 285
ID Description Score Start End Superfamily
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9638 88 228 3.30.470.20
af_P38025_96_184_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9427 5 86 3.30.200.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9252 88 228 3.30.470.20
af_Q58987_12_90_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9093 11 84 3.30.200.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.906 86 219 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A258L8A8-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9958 1 80 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A522DW44-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9956 27 303 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A1J5SX90-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.995 1 305 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A662C9Y8-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.994 1 106 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A4Q5SW24-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9927 2 302 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map