F453949

General Info

Members Datasets Scaffolds Average Seq Length
490 210 488 219

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10200966|Ga0207694_102009662
Length 239
Sequence MPKRKSPLPAKKSKPEIMKTNFYRNYPLVALLLVATAALAQDKVPLKTQLPRPLFVGTPVPLNVPNLEPPMKGKRPDFMVPAGTVNLAKGKKVTASDNNPVTGTLDLVTDGDKAGDEGSWVELGPGKQWVQIDLAKNANIYAVLLWHFHSQARVYRDVAVQVSNDPTFKSGVTTIFNSDFKNELGLGAGKDLNYVETYQGKLIDAKGAKGRYVRLYSNGNTTNKLNDYIEVEVWGKPAA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 4.69
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10006584 3300001991 Unclassified 1986
2 rootH2_10119286 3300003320 Unclassified 4354
3 rootL2_10225822 3300003322 Unclassified 1696
4 Ga0065712_10133714 3300005290 Bacteria 1520
5 Ga0070658_10051222 3300005327 Unclassified 3346
6 Ga0070658_10125040 3300005327 Unclassified 2140
7 Ga0070658_10164823 3300005327 Bacteria 1860
8 Ga0070658_10704556 3300005327 Bacteria 876
9 Ga0070676_10096722 3300005328 Bacteria 1818
10 Ga0070683_100008326 3300005329 Bacteria 8810
11 Ga0070683_100088459 3300005329 Bacteria 2906
12 Ga0070683_100122206 3300005329 Bacteria 2460
13 Ga0070683_100151467 3300005329 Bacteria 2199
14 Ga0070683_100271879 3300005329 Bacteria 1612
15 Ga0070683_100288254 3300005329 Bacteria 1562
16 Ga0070683_100617384 3300005329 Unclassified 1038
17 Ga0070683_101131665 3300005329 Unclassified 752
18 Ga0070670_100002583 3300005331 Bacteria 14962
19 Ga0070670_100034307 3300005331 Bacteria 4367
20 Ga0068869_100002228 3300005334 Bacteria 11654
21 Ga0068869_100016516 3300005334 Bacteria 4978
22 Ga0070666_10046788 3300005335 Bacteria 2903
23 Ga0070680_100048820 3300005336 Bacteria 3449
24 Ga0070682_100035463 3300005337 Bacteria 3046
25 Ga0068868_100001421 3300005338 Bacteria 16502
26 Ga0068868_100050097 3300005338 Unclassified 3279
27 Ga0068868_100061403 3300005338 Bacteria 2977
28 Ga0070660_100024286 3300005339 Bacteria 4498
29 Ga0070660_100642837 3300005339 Bacteria 888
30 Ga0070691_10183159 3300005341 Unclassified 1091
31 Ga0070661_100097516 3300005344 Bacteria 2182
32 Ga0070668_100012388 3300005347 Bacteria 6350
33 Ga0070675_100042002 3300005354 Bacteria 3736
34 Ga0070671_100002112 3300005355 Bacteria 15331
35 Ga0070671_100010886 3300005355 Bacteria 7304
36 Ga0070671_100096889 3300005355 Bacteria 2474
37 Ga0070674_100272529 3300005356 Bacteria 1338
38 Ga0070673_100088318 3300005364 Unclassified 2528
39 Ga0070673_100770914 3300005364 Bacteria 887
40 Ga0070688_100245367 3300005365 Bacteria 1273
41 Ga0070667_100000953 3300005367 Bacteria 26609
42 Ga0070667_100147903 3300005367 Bacteria 2061
43 Ga0070714_100011194 3300005435 Bacteria 7112
44 Ga0070714_100050530 3300005435 Bacteria 3543
45 Ga0070713_100910800 3300005436 Unclassified 846
46 Ga0070662_100025223 3300005457 Bacteria 4103
47 Ga0070681_10027871 3300005458 Bacteria 5679
48 Ga0070681_10031907 3300005458 Bacteria 5289
49 Ga0068867_100067338 3300005459 Unclassified 2670
50 Ga0068867_100289872 3300005459 Bacteria 1345
51 Ga0070679_100080517 3300005530 Bacteria 3246
52 Ga0070684_100000877 3300005535 Bacteria 21233
53 Ga0070684_100050775 3300005535 Bacteria 3603
54 Ga0070684_100482500 3300005535 Unclassified 1147
55 Ga0070684_100587351 3300005535 Bacteria 1035
56 Ga0068853_100000123 3300005539 Bacteria 51593
57 Ga0068853_100016173 3300005539 Bacteria 6136
58 Ga0068853_100119095 3300005539 Bacteria 2353
59 Ga0068853_100194187 3300005539 Bacteria 1845
60 Ga0068853_100488437 3300005539 Unclassified 1161
61 Ga0070672_100117356 3300005543 Bacteria 2175
62 Ga0070672_100569987 3300005543 Bacteria 984
63 Ga0070686_100478864 3300005544 Unclassified 962
64 Ga0070665_100018290 3300005548 Bacteria 7027
65 Ga0070665_100085752 3300005548 Bacteria 3155
66 Ga0070665_100106534 3300005548 Bacteria 2805
67 Ga0068855_100001407 3300005563 Bacteria 29867
68 Ga0068855_100002968 3300005563 Bacteria 20742
69 Ga0068855_100009913 3300005563 Bacteria 11490
70 Ga0068855_100012307 3300005563 Bacteria 10337
71 Ga0068855_100015074 3300005563 Bacteria 9308
72 Ga0068855_100047061 3300005563 Bacteria 5096
73 Ga0068855_100108236 3300005563 Bacteria 3192
74 Ga0068855_100117401 3300005563 Unclassified 3048
75 Ga0068855_100412284 3300005563 Bacteria 1479
76 Ga0068855_100417573 3300005563 Unclassified 1468
77 Ga0070664_100039063 3300005564 Bacteria 3998
78 Ga0070664_100046430 3300005564 Bacteria 3668
79 Ga0070664_100216149 3300005564 Bacteria 1714
80 Ga0070664_100348412 3300005564 Bacteria 1347
81 Ga0068857_100003976 3300005577 Bacteria 12449
82 Ga0068857_100043603 3300005577 Bacteria 3979
83 Ga0068857_100055830 3300005577 Bacteria 3504
84 Ga0068857_100065590 3300005577 Bacteria 3229
85 Ga0068854_100021779 3300005578 Bacteria 4355
86 Ga0068854_100026618 3300005578 Bacteria 3977
87 Ga0068856_100001056 3300005614 Bacteria 29195
88 Ga0068856_100010439 3300005614 Bacteria 9014
89 Ga0068856_100013217 3300005614 Bacteria 7994
90 Ga0068856_100014034 3300005614 Bacteria 7746
91 Ga0068856_100032989 3300005614 Bacteria 5071
92 Ga0068856_100033950 3300005614 Bacteria 4996
93 Ga0068856_100223453 3300005614 Bacteria 1898
94 Ga0068856_100632836 3300005614 Unclassified 1090
95 Ga0068852_100000008 3300005616 Bacteria 154351
96 Ga0068852_100000293 3300005616 Bacteria 33519
97 Ga0068852_100009180 3300005616 Bacteria 7327
98 Ga0068852_100011266 3300005616 Bacteria 6722
99 Ga0068852_100061470 3300005616 Unclassified 3264
100 Ga0068852_100144787 3300005616 Bacteria 2203
101 Ga0068852_100370785 3300005616 Bacteria 1402
102 Ga0068852_100452549 3300005616 Bacteria 1271
103 Ga0068852_100790496 3300005616 Unclassified 963
104 Ga0068859_100007518 3300005617 Bacteria 11059
105 Ga0068859_100206195 3300005617 Unclassified 2051
106 Ga0068859_100225267 3300005617 Bacteria 1963
107 Ga0068864_100468240 3300005618 Bacteria 1208
108 Ga0068866_10040883 3300005718 Bacteria 2298
109 Ga0068861_100669593 3300005719 Bacteria 961
110 Ga0068851_10017970 3300005834 Bacteria 3404
111 Ga0068870_10443340 3300005840 Unclassified 854
112 Ga0068870_10705578 3300005840 Bacteria 696
113 Ga0068863_100000464 3300005841 Bacteria 41393
114 Ga0068858_100002614 3300005842 Bacteria 18147
115 Ga0068858_100181499 3300005842 Bacteria 1987
116 Ga0068860_100000665 3300005843 Bacteria 39791
117 Ga0068860_100052336 3300005843 Bacteria 3884
118 Ga0068862_100030788 3300005844 Bacteria 4524
119 Ga0070717_10004690 3300006028 Bacteria 9928
120 Ga0070717_10224178 3300006028 Bacteria 1653
121 Ga0075366_10033533 3300006195 Bacteria 3025
122 Ga0097621_100006450 3300006237 Bacteria 8331
123 Ga0097621_100044569 3300006237 Unclassified 3579
124 Ga0097621_100122337 3300006237 Bacteria 2208
125 Ga0097621_100495938 3300006237 Bacteria 1105
126 Ga0068871_100008504 3300006358 Bacteria 7381
127 Ga0068871_100015596 3300006358 Bacteria 5694
128 Ga0068871_100031076 3300006358 Unclassified 4208
129 Ga0068871_100060600 3300006358 Bacteria 3087
130 Ga0068865_100754796 3300006881 Unclassified 836
131 Ga0097620_100007518 3300006931 Bacteria 11059
132 Ga0097620_100206202 3300006931 Unclassified 2051
133 Ga0097620_100225258 3300006931 Bacteria 1963
134 Ga0105240_10000038 3300009093 Bacteria 270341
135 Ga0105240_10000042 3300009093 Bacteria 263795
136 Ga0105240_10000758 3300009093 Bacteria 58931
137 Ga0105240_10001148 3300009093 Bacteria 46340
138 Ga0105240_10004262 3300009093 Bacteria 21868
139 Ga0105240_10014303 3300009093 Bacteria 10837
140 Ga0105240_10015924 3300009093 Bacteria 10199
141 Ga0105240_10016102 3300009093 Bacteria 10132
142 Ga0105240_10017702 3300009093 Bacteria 9594
143 Ga0105240_10094170 3300009093 Bacteria 3654
144 Ga0105240_10205371 3300009093 Unclassified 2306
145 Ga0105240_10239012 3300009093 Bacteria 2107
146 Ga0105240_10360618 3300009093 Bacteria 1646
147 Ga0105245_10010785 3300009098 Bacteria 7952
148 Ga0105245_10013280 3300009098 Bacteria 7175
149 Ga0105245_10028796 3300009098 Bacteria 4902
150 Ga0105245_10352713 3300009098 Unclassified 1458
151 Ga0105245_10417595 3300009098 Bacteria 1344
152 Ga0105247_10001890 3300009101 Bacteria 14627
153 Ga0105247_10139368 3300009101 Bacteria 1588
154 Ga0105243_10015982 3300009148 Bacteria 5676
155 Ga0105243_10292234 3300009148 Unclassified 1473
156 Ga0105241_10001039 3300009174 Bacteria 21115
157 Ga0105241_10001931 3300009174 Bacteria 15684
158 Ga0105241_10013633 3300009174 Bacteria 5956
159 Ga0105241_10066684 3300009174 Bacteria 2784
160 Ga0105241_10114228 3300009174 Unclassified 2166
161 Ga0105241_10124584 3300009174 Bacteria 2079
162 Ga0105241_10154079 3300009174 Bacteria 1883
163 Ga0105241_10253086 3300009174 Bacteria 1494
164 Ga0105241_11063018 3300009174 Unclassified 760
165 Ga0105242_10021541 3300009176 Bacteria 5063
166 Ga0105248_10002701 3300009177 Bacteria 19706
167 Ga0105248_10042096 3300009177 Bacteria 5122
168 Ga0105237_10001502 3300009545 Bacteria 30698
169 Ga0105237_10011880 3300009545 Bacteria 9208
170 Ga0105237_10023988 3300009545 Bacteria 6241
171 Ga0105237_10032425 3300009545 Bacteria 5290
172 Ga0105237_10158379 3300009545 Bacteria 2262
173 Ga0105237_10398622 3300009545 Unclassified 1381
174 Ga0105237_10593224 3300009545 Bacteria 1115
175 Ga0105237_10681891 3300009545 Unclassified 1034
176 Ga0105238_10000395 3300009551 Bacteria 46439
177 Ga0105238_10005084 3300009551 Bacteria 13004
178 Ga0105238_10005180 3300009551 Bacteria 12884
179 Ga0105238_10006997 3300009551 Bacteria 11278
180 Ga0105238_10011762 3300009551 Bacteria 8819
181 Ga0105238_10028743 3300009551 Bacteria 5663
182 Ga0105238_10054833 3300009551 Bacteria 4002
183 Ga0105238_10080300 3300009551 Bacteria 3251
184 Ga0105238_10145834 3300009551 Bacteria 2343
185 Ga0105238_10184535 3300009551 Bacteria 2063
186 Ga0105249_10094535 3300009553 Bacteria 2801
187 Ga0105239_10012087 3300010375 Bacteria 9628
188 Ga0105239_10012121 3300010375 Bacteria 9611
189 Ga0105239_10036963 3300010375 Bacteria 5357
190 Ga0105239_10042329 3300010375 Bacteria 4992
191 Ga0105239_10178785 3300010375 Bacteria 2373
192 Ga0105239_10293015 3300010375 Bacteria 1832
193 Ga0105246_10000786 3300011119 Bacteria 18010
194 Ga0105246_10164492 3300011119 Bacteria 1693
195 Ga0105246_10230985 3300011119 Unclassified 1457
196 Ga0105246_10235417 3300011119 Unclassified 1444
197 Ga0105246_10300095 3300011119 Unclassified 1296
198 Ga0157371_10067626 3300013102 Bacteria 2529
199 Ga0157371_10138708 3300013102 Bacteria 1732
200 Ga0157370_10000130 3300013104 Bacteria 89817
201 Ga0157370_10037751 3300013104 Archaea 4679
202 Ga0157370_10089065 3300013104 Bacteria 2899
203 Ga0157370_10246085 3300013104 Bacteria 1654
204 Ga0157369_10000058 3300013105 Bacteria 154342
205 Ga0157369_10007369 3300013105 Bacteria 12665
206 Ga0157369_10008970 3300013105 Bacteria 11455
207 Ga0157369_10013098 3300013105 Bacteria 9386
208 Ga0157369_10015590 3300013105 Bacteria 8564
209 Ga0157369_10045787 3300013105 Bacteria 4756
210 Ga0157369_10100124 3300013105 Bacteria 3089
211 Ga0157369_10246935 3300013105 Bacteria 1863
212 Ga0157369_10284086 3300013105 Bacteria 1723
213 Ga0157369_10604362 3300013105 Unclassified 1132
214 Ga0157374_10001434 3300013296 Bacteria 20150
215 Ga0157374_10027016 3300013296 Bacteria 5171
216 Ga0157374_10030256 3300013296 Bacteria 4913
217 Ga0157374_10063702 3300013296 Bacteria 3458
218 Ga0157374_10552100 3300013296 Unclassified 1160
219 Ga0157378_10029402 3300013297 Bacteria 4850
220 Ga0157378_10050996 3300013297 Bacteria 3682
221 Ga0157378_10261557 3300013297 Unclassified 1660
222 Ga0157378_10513066 3300013297 Unclassified 1199
223 Ga0157378_10702122 3300013297 Unclassified 1031
224 Ga0157378_10847364 3300013297 Unclassified 942
225 Ga0163162_10011140 3300013306 Bacteria 8759
226 Ga0163162_10157090 3300013306 Bacteria 2395
227 Ga0157372_10000163 3300013307 Bacteria 73216
228 Ga0157372_10001214 3300013307 Bacteria 27878
229 Ga0157372_10027192 3300013307 Bacteria 6227
230 Ga0157372_10040007 3300013307 Bacteria 5177
231 Ga0157372_10053305 3300013307 Bacteria 4508
232 Ga0157372_10133977 3300013307 Bacteria 2852
233 Ga0157372_10325469 3300013307 Bacteria 1790
234 Ga0157375_10000006 3300013308 Bacteria 384086
235 Ga0157375_10003296 3300013308 Bacteria 13977
236 Ga0157375_10074189 3300013308 Unclassified 3423
237 Ga0157375_10333645 3300013308 Bacteria 1682
238 Ga0163163_10001004 3300014325 Bacteria 23871
239 Ga0163163_11314277 3300014325 Unclassified 785
240 Ga0157377_10282824 3300014745 Unclassified 1088
241 Ga0157379_10000286 3300014968 Bacteria 39982
242 Ga0157379_10029172 3300014968 Bacteria 4907
243 Ga0157379_10304056 3300014968 Bacteria 1454
244 Ga0157376_10003948 3300014969 Bacteria 10260
245 Ga0157376_10874381 3300014969 Unclassified 915
246 Ga0163161_10183695 3300017792 Bacteria 1605
247 Ga0207656_10045163 3300025321 Unclassified 1884
248 Ga0207656_10186199 3300025321 Bacteria 998
249 Ga0207642_10028375 3300025899 Bacteria 2304
250 Ga0207710_10003489 3300025900 Bacteria 7001
251 Ga0207710_10123096 3300025900 Bacteria 1240
252 Ga0207688_10099042 3300025901 Bacteria 1681
253 Ga0207647_10011217 3300025904 Bacteria 6292
254 Ga0207645_10083113 3300025907 Bacteria 2053
255 Ga0207643_10169709 3300025908 Bacteria 1316
256 Ga0207705_10022087 3300025909 Bacteria 4540
257 Ga0207705_10067731 3300025909 Bacteria 2584
258 Ga0207654_10000017 3300025911 Bacteria 201589
259 Ga0207654_10000301 3300025911 Bacteria 30010
260 Ga0207654_10003602 3300025911 Bacteria 7822
261 Ga0207654_10018918 3300025911 Bacteria 3623
262 Ga0207654_10095656 3300025911 Unclassified 1820
263 Ga0207654_10104326 3300025911 Bacteria 1752
264 Ga0207707_10097802 3300025912 Bacteria 2565
265 Ga0207707_10329033 3300025912 Bacteria 1318
266 Ga0207695_10000002 3300025913 Bacteria 2188391
267 Ga0207695_10000070 3300025913 Bacteria 318111
268 Ga0207695_10000108 3300025913 Bacteria 252306
269 Ga0207695_10000253 3300025913 Bacteria 139044
270 Ga0207695_10000345 3300025913 Bacteria 107062
271 Ga0207695_10001120 3300025913 Bacteria 46589
272 Ga0207695_10020129 3300025913 Bacteria 7654
273 Ga0207695_10026325 3300025913 Bacteria 6493
274 Ga0207695_10047389 3300025913 Bacteria 4549
275 Ga0207695_10109400 3300025913 Bacteria 2746
276 Ga0207695_10165920 3300025913 Bacteria 2137
277 Ga0207695_10297776 3300025913 Bacteria 1505
278 Ga0207671_10000081 3300025914 Bacteria 148476
279 Ga0207671_10001179 3300025914 Bacteria 31089
280 Ga0207671_10085004 3300025914 Unclassified 2377
281 Ga0207671_10283372 3300025914 Bacteria 1307
282 Ga0207663_10218308 3300025916 Bacteria 1386
283 Ga0207657_10020432 3300025919 Bacteria 6258
284 Ga0207649_10035706 3300025920 Bacteria 2989
285 Ga0207652_10565501 3300025921 Unclassified 1021
286 Ga0207694_10000029 3300025924 Bacteria 239107
287 Ga0207694_10000313 3300025924 Bacteria 45627
288 Ga0207694_10001638 3300025924 Bacteria 18838
289 Ga0207694_10008698 3300025924 Bacteria 7664
290 Ga0207694_10018101 3300025924 Bacteria 5325
291 Ga0207694_10035252 3300025924 Bacteria 3838
292 Ga0207694_10058958 3300025924 Bacteria 2985
293 Ga0207694_10175776 3300025924 Bacteria 1735
294 Ga0207694_10200966 3300025924 Unclassified 1621
295 Ga0207650_10006691 3300025925 Bacteria 7859
296 Ga0207659_10787629 3300025926 Bacteria 816
297 Ga0207687_10009319 3300025927 Bacteria 6421
298 Ga0207687_10053309 3300025927 Bacteria 2825
299 Ga0207687_10259413 3300025927 Unclassified 1385
300 Ga0207700_10760695 3300025928 Unclassified 866
301 Ga0207700_10979831 3300025928 Bacteria 757
302 Ga0207644_10005161 3300025931 Bacteria 8530
303 Ga0207644_10018737 3300025931 Bacteria 4686
304 Ga0207644_10041169 3300025931 Bacteria 3267
305 Ga0207706_10028265 3300025933 Bacteria 5009
306 Ga0207686_10003382 3300025934 Bacteria 8567
307 Ga0207686_10015777 3300025934 Unclassified 4233
308 Ga0207709_10026924 3300025935 Bacteria 3307
309 Ga0207709_10245724 3300025935 Unclassified 1304
310 Ga0207691_10077929 3300025940 Bacteria 2984
311 Ga0207691_10571112 3300025940 Bacteria 958
312 Ga0207711_10002056 3300025941 Bacteria 18204
313 Ga0207689_10016130 3300025942 Bacteria 6325
314 Ga0207689_10196563 3300025942 Bacteria 1665
315 Ga0207661_10000229 3300025944 Bacteria 36779
316 Ga0207661_10067020 3300025944 Bacteria 2918
317 Ga0207661_10189332 3300025944 Bacteria 1803
318 Ga0207661_10198121 3300025944 Bacteria 1764
319 Ga0207661_10725666 3300025944 Bacteria 914
320 Ga0207679_10942251 3300025945 Bacteria 791
321 Ga0207667_10000259 3300025949 Bacteria 74230
322 Ga0207667_10000360 3300025949 Bacteria 61923
323 Ga0207667_10000385 3300025949 Bacteria 59674
324 Ga0207667_10003542 3300025949 Bacteria 19311
325 Ga0207667_10007288 3300025949 Bacteria 13329
326 Ga0207667_10053335 3300025949 Bacteria 4255
327 Ga0207667_10077121 3300025949 Bacteria 3457
328 Ga0207667_10094507 3300025949 Unclassified 3086
329 Ga0207667_10118221 3300025949 Bacteria 2732
330 Ga0207667_10143574 3300025949 Bacteria 2457
331 Ga0207667_10231594 3300025949 Bacteria 1891
332 Ga0207667_10565189 3300025949 Bacteria 1149
333 Ga0207651_10125163 3300025960 Unclassified 1957
334 Ga0207651_10187503 3300025960 Bacteria 1647
335 Ga0207712_10239799 3300025961 Bacteria 1460
336 Ga0207640_10016194 3300025981 Bacteria 4332
337 Ga0207640_10321543 3300025981 Bacteria 1232
338 Ga0207658_10007733 3300025986 Bacteria 7324
339 Ga0207677_10000025 3300026023 Bacteria 127400
340 Ga0207677_10000049 3300026023 Bacteria 101470
341 Ga0207677_10306516 3300026023 Unclassified 1314
342 Ga0207703_10000516 3300026035 Bacteria 39968
343 Ga0207703_10183031 3300026035 Bacteria 1850
344 Ga0207639_10000055 3300026041 Bacteria 110260
345 Ga0207639_10098204 3300026041 Bacteria 2360
346 Ga0207639_10102719 3300026041 Unclassified 2314
347 Ga0207639_10109615 3300026041 Bacteria 2247
348 Ga0207639_10136334 3300026041 Bacteria 2039
349 Ga0207678_10174465 3300026067 Bacteria 1836
350 Ga0207702_10000839 3300026078 Bacteria 32184
351 Ga0207702_10003455 3300026078 Bacteria 14421
352 Ga0207702_10004574 3300026078 Bacteria 12259
353 Ga0207702_10025243 3300026078 Bacteria 4931
354 Ga0207702_10032983 3300026078 Bacteria 4323
355 Ga0207702_10121142 3300026078 Bacteria 2342
356 Ga0207702_10307925 3300026078 Unclassified 1505
357 Ga0207702_10387050 3300026078 Bacteria 1346
358 Ga0207641_10000806 3300026088 Bacteria 33538
359 Ga0207641_10096843 3300026088 Bacteria 2592
360 Ga0207648_10115812 3300026089 Unclassified 2355
361 Ga0207648_10231011 3300026089 Bacteria 1645
362 Ga0207676_10414892 3300026095 Bacteria 1261
363 Ga0207674_10000340 3300026116 Bacteria 60032
364 Ga0207674_10001426 3300026116 Bacteria 30868
365 Ga0207674_10012783 3300026116 Bacteria 9376
366 Ga0207674_10227460 3300026116 Bacteria 1813
367 Ga0207674_10569413 3300026116 Bacteria 1094
368 Ga0207675_100176642 3300026118 Bacteria 2043
369 Ga0207683_10015421 3300026121 Bacteria 6508
370 Ga0207698_10000010 3300026142 Bacteria 270583
371 Ga0207698_10000215 3300026142 Bacteria 36031
372 Ga0207698_10033407 3300026142 Bacteria 3738
373 Ga0207698_10400795 3300026142 Bacteria 1311
374 Ga0207698_11037173 3300026142 Unclassified 832
375 Ga0209813_10035580 3300027866 Bacteria 1492
376 Ga0268266_10008409 3300028379 Bacteria 9176
377 Ga0268266_10023777 3300028379 Bacteria 5215
378 Ga0268266_10060881 3300028379 Bacteria 3255
379 Ga0268266_10067031 3300028379 Bacteria 3106
380 Ga0268265_10225105 3300028380 Unclassified 1644
381 Ga0268264_10000086 3300028381 Bacteria 239021
382 Ga0268264_10004838 3300028381 Bacteria 11413
383 Ga0268264_10447813 3300028381 Bacteria 1250
384 Ga0265337_1000547 3300028556 Bacteria 19990
385 Ga0265322_10064276 3300028654 Unclassified 1040
386 Ga0265336_10004711 3300028666 Bacteria 5117
387 Ga0265336_10012524 3300028666 Unclassified 2852
388 Ga0265338_10003396 3300028800 Bacteria 22475
389 Ga0265338_10018178 3300028800 Bacteria 7536
390 Ga0265338_10173463 3300028800 Unclassified 1651
391 Ga0265324_10010642 3300029957 Bacteria 3536
392 Ga0265324_10040159 3300029957 Bacteria 1621
393 Ga0265330_10084154 3300031235 Unclassified 1369
394 Ga0265332_10115225 3300031238 Unclassified 1130
395 Ga0265320_10044683 3300031240 Bacteria 2181
396 Ga0265340_10009522 3300031247 Bacteria 5210
397 Ga0265339_10008730 3300031249 Bacteria 6426
398 Ga0265339_10052752 3300031249 Bacteria 2214
399 Ga0265327_10000571 3300031251 Bacteria 62622
400 Ga0265316_10001164 3300031344 Bacteria 28432
401 Ga0265316_10282699 3300031344 Bacteria 1212
402 Ga0265314_10007268 3300031711 Bacteria 9621
403 Ga0265314_10055317 3300031711 Bacteria 2740
404 Ga0265342_10021681 3300031712 Bacteria 4097
405 Ga0265342_10086924 3300031712 Unclassified 1797
406 Ga0265342_10159258 3300031712 Bacteria 1249
407 Ga0316578_10145015 3300031728 Bacteria 1430
408 Ga0307405_10194131 3300031731 Unclassified 1469
409 Ga0307410_10345114 3300031852 Bacteria 1188
410 Ga0307416_100177121 3300032002 Bacteria 1994
411 Ga0373948_0014008 3300034817 Bacteria 1456
412 Ga0373935_0025012 3300035692 Bacteria 3679
413 Ga0373933_0095203 3300035724 Bacteria 1842
414 Ga0395901_0214779 3300038443 Bacteria 2012
415 Ga0451807_0255555 3300041486 Bacteria 1425
416 Ga0451853_1584390 3300041512 Bacteria 844
417 Ga0451577_0002994 3300042876 Bacteria 19247
418 Ga0451577_0357660 3300042876 Bacteria 1324
419 Ga0451577_0996063 3300042876 Bacteria 753
420 Ga0466961_0085530 3300044693 Bacteria 1994
421 Ga0466963_0012081 3300044694 Bacteria 5277
422 Ga0453684_0000027 3300044712 Bacteria 778857
423 Ga0451576_0590894 3300045051 Unclassified 1167
424 Ga0466967_0004075 3300045976 Bacteria 9753
425 Ga0495592_0000186 3300046454 Bacteria 54708
426 Ga0495629_0180906 3300046459 Unclassified 1461
427 Ga0495580_0206798 3300046472 Unclassified 1351
428 Ga0495582_0351421 3300046473 Unclassified 849
429 Ga0495662_0010459 3300046476 Bacteria 4543
430 Ga0495618_0011870 3300046514 Bacteria 5287
431 Ga0495628_0001101 3300046516 Bacteria 24666
432 Ga0495630_0072503 3300046517 Unclassified 2592
433 Ga0495652_0148352 3300046529 Unclassified 1835
434 Ga0495586_0007465 3300046535 Bacteria 5834
435 Ga0495587_0084272 3300046536 Bacteria 1841
436 Ga0495587_0127280 3300046536 Bacteria 1457
437 Ga0495645_0001522 3300046543 Bacteria 15640
438 Ga0495599_0007298 3300046678 Bacteria 6695
439 Ga0495658_0296399 3300046683 Unclassified 1022
440 Ga0495613_0284785 3300046689 Bacteria 1147
441 Ga0495624_0026299 3300046690 Bacteria 3815
442 Ga0495684_0497207 3300047471 Unclassified 839
443 Ga0495602_0107502 3300048088 Bacteria 2273
444 Ga0496100_0135543 3300048903 Bacteria 1739
445 Ga0496100_0445697 3300048903 Bacteria 992
446 Ga0496104_0027474 3300048907 Bacteria 5266
447 Ga0496104_0484625 3300048907 Bacteria 1148
448 Ga0496104_0887460 3300048907 Bacteria 797
449 Ga0496104_1139768 3300048907 Bacteria 683
450 Ga0496105_0018704 3300048908 Bacteria 5577
451 Ga0496105_0189918 3300048908 Bacteria 1680
452 Ga0496105_0370411 3300048908 Bacteria 1141
453 Ga0496106_0036311 3300048909 Bacteria 3687
454 Ga0496106_0170230 3300048909 Bacteria 1726
455 Ga0496108_0772593 3300048911 Bacteria 830
456 Ga0496109_0539744 3300048912 Unclassified 1100
457 Ga0496111_0381929 3300048914 Unclassified 1042
458 Ga0496112_0429946 3300048915 Bacteria 1259
459 Ga0496114_0291229 3300048917 Bacteria 1440
460 Ga0496114_0335087 3300048917 Bacteria 1338
461 Ga0496114_0401397 3300048917 Bacteria 1214
462 Ga0496115_0244265 3300048918 Bacteria 1479
463 Ga0496115_0312680 3300048918 Bacteria 1286
464 Ga0496115_0350246 3300048918 Bacteria 1204
465 Ga0496115_0540371 3300048918 Bacteria 932
466 Ga0501306_030216 3300049127 Unclassified 802
467 Ga0501033_0024461 3300049570 Unclassified 4556
468 Ga0501036_0240758 3300049572 Unclassified 1517
469 Ga0501037_0275909 3300049573 Unclassified 1172
470 Ga0501042_0081161 3300049578 Unclassified 2324
471 Ga0501048_0113176 3300049582 Unclassified 1917
472 Ga0501072_0071818 3300049588 Bacteria 2735
473 Ga0501073_0043625 3300049589 Bacteria 3163
474 Ga0501075_0026639 3300049591 Bacteria 4258
475 Ga0501076_0226400 3300049592 Unclassified 1528
476 Ga0501076_0427624 3300049592 Bacteria 1090
477 Ga0501080_0418275 3300049742 Unclassified 1204
478 Ga0501081_0220579 3300049743 Unclassified 1379
479 Ga0501044_0122481 3300049823 Unclassified 2600
480 nmdc:mga00v17_22027_c1 3300050491 Bacteria 3673
481 nmdc:mga0k408_30493_c1 3300050493 Bacteria 3075
482 nmdc:mga0k408_4959_c2 3300050493 Bacteria 4686
483 nmdc:mga06z11_103189_c1 3300050494 Bacteria 1568
484 nmdc:mga06z11_161839_c1 3300050494 Bacteria 1280
485 nmdc:mga07m45_228456_c1 3300050496 Bacteria 1083
486 nmdc:mga05p37_11836_c1 3300050507 Bacteria 10396
487 Ga0587077_033948 3300059493 Bacteria 989
488 Ga0587091_010120 3300059511 Bacteria 1436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0370411 Ga0496105_0370411_540_1097 185
2 3300049592 Ga0501076_0226400 Ga0501076_0226400_15_575 186
3 3300049742 Ga0501080_0418275 Ga0501080_0418275_31_591 186
4 3300046459 Ga0495629_0180906 Ga0495629_0180906_146_730 194
5 3300046473 Ga0495582_0351421 Ga0495582_0351421_247_831 194
6 3300048907 Ga0496104_1139768 Ga0496104_1139768_78_668 196
7 3300048903 Ga0496100_0445697 Ga0496100_0445697_311_979 197
8 3300048907 Ga0496104_0484625 Ga0496104_0484625_104_772 197
9 3300048912 Ga0496109_0539744 Ga0496109_0539744_158_826 197
10 3300049592 Ga0501076_0427624 Ga0501076_0427624_316_984 197
11 3300031251 Ga0265327_10000571 Ga0265327_100005715 199
12 3300044694 Ga0466963_0012081 Ga0466963_0012081_4662_5264 200
13 3300005290 Ga0065712_10133714 Ga0065712_101337142 204
14 3300005364 Ga0070673_100770914 Ga0070673_1007709141 204
15 3300005544 Ga0070686_100478864 Ga0070686_1004788641 204
16 3300005548 Ga0070665_100085752 Ga0070665_1000857522 204
17 3300025960 Ga0207651_10187503 Ga0207651_101875032 204
18 3300026067 Ga0207678_10174465 Ga0207678_101744653 204
19 3300026118 Ga0207675_100176642 Ga0207675_1001766422 204
20 3300028379 Ga0268266_10060881 Ga0268266_100608813 204
21 3300045051 Ga0451576_0590894 Ga0451576_0590894_443_1150 204
22 3300047471 Ga0495684_0497207 Ga0495684_0497207_19_633 204
23 3300050507 nmdc:mga05p37_11836_c1 nmdc:mga05p37_11836_c1_2455_3123 204
24 3300005367 Ga0070667_100147903 Ga0070667_1001479033 207
25 3300026116 Ga0207674_10569413 Ga0207674_105694132 207
26 3300027866 Ga0209813_10035580 Ga0209813_100355802 207
27 3300050491 nmdc:mga00v17_22027_c1 nmdc:mga00v17_22027_c1_2641_3312 207
28 3300050493 nmdc:mga0k408_30493_c1 nmdc:mga0k408_30493_c1_2232_2870 207
29 3300050493 nmdc:mga0k408_4959_c2 nmdc:mga0k408_4959_c2_1368_2039 207
30 3300050494 nmdc:mga06z11_103189_c1 nmdc:mga06z11_103189_c1_558_1229 207
31 3300050494 nmdc:mga06z11_161839_c1 nmdc:mga06z11_161839_c1_75_746 207
32 3300050496 nmdc:mga07m45_228456_c1 nmdc:mga07m45_228456_c1_386_1057 207
33 3300046536 Ga0495587_0127280 Ga0495587_0127280_809_1435 208
34 3300048911 Ga0496108_0772593 Ga0496108_0772593_25_651 208
35 3300029957 Ga0265324_10010642 Ga0265324_100106424 209
36 3300003322 rootL2_10225822 rootL2_102258222 210
37 3300009148 Ga0105243_10292234 Ga0105243_102922343 210
38 3300011119 Ga0105246_10235417 Ga0105246_102354171 210
39 3300034817 Ga0373948_0014008 Ga0373948_0014008_316_948 210
40 3300049572 Ga0501036_0240758 Ga0501036_0240758_817_1461 210
41 3300049578 Ga0501042_0081161 Ga0501042_0081161_796_1440 210
42 3300049582 Ga0501048_0113176 Ga0501048_0113176_659_1303 210
43 3300049588 Ga0501072_0071818 Ga0501072_0071818_1503_2147 210
44 3300049591 Ga0501075_0026639 Ga0501075_0026639_2645_3289 210
45 3300049743 Ga0501081_0220579 Ga0501081_0220579_678_1322 210
46 3300013308 Ga0157375_10333645 Ga0157375_103336452 211
47 3300046689 Ga0495613_0284785 Ga0495613_0284785_19_654 211
48 3300048907 Ga0496104_0027474 Ga0496104_0027474_1958_2593 211
49 3300048908 Ga0496105_0018704 Ga0496105_0018704_2300_2935 211
50 3300048909 Ga0496106_0170230 Ga0496106_0170230_32_667 211
51 3300048914 Ga0496111_0381929 Ga0496111_0381929_284_919 211
52 3300048917 Ga0496114_0291229 Ga0496114_0291229_38_673 211
53 3300005335 Ga0070666_10046788 Ga0070666_100467882 212
54 3300005364 Ga0070673_100088318 Ga0070673_1000883182 212
55 3300013308 Ga0157375_10000006 Ga0157375_10000006341 212
56 3300025934 Ga0207686_10003382 Ga0207686_100033822 212
57 3300025960 Ga0207651_10125163 Ga0207651_101251632 212
58 3300026078 Ga0207702_10121142 Ga0207702_101211422 212
59 3300028379 Ga0268266_10008409 Ga0268266_100084096 212
60 3300003320 rootH2_10119286 rootH2_101192862 213
61 3300009551 Ga0105238_10080300 Ga0105238_100803002 213
62 3300029957 Ga0265324_10040159 Ga0265324_100401592 213
63 3300031251 Ga0265327_10000571 Ga0265327_100005716 213
64 3300044712 Ga0453684_0000027 Ga0453684_0000027_40008_40685 213
65 3300005459 Ga0068867_100067338 Ga0068867_1000673382 214
66 3300005543 Ga0070672_100569987 Ga0070672_1005699872 214
67 3300005617 Ga0068859_100206195 Ga0068859_1002061951 214
68 3300005840 Ga0068870_10443340 Ga0068870_104433401 214
69 3300006881 Ga0068865_100754796 Ga0068865_1007547961 214
70 3300006931 Ga0097620_100206202 Ga0097620_1002062023 214
71 3300009148 Ga0105243_10015982 Ga0105243_100159823 214
72 3300009551 Ga0105238_10054833 Ga0105238_100548333 214
73 3300014325 Ga0163163_11314277 Ga0163163_113142771 214
74 3300025908 Ga0207643_10169709 Ga0207643_101697092 214
75 3300025924 Ga0207694_10058958 Ga0207694_100589583 214
76 3300025927 Ga0207687_10259413 Ga0207687_102594132 214
77 3300025935 Ga0207709_10026924 Ga0207709_100269242 214
78 3300025940 Ga0207691_10571112 Ga0207691_105711121 214
79 3300026088 Ga0207641_10096843 Ga0207641_100968432 214
80 3300026089 Ga0207648_10115812 Ga0207648_101158122 214
81 3300028381 Ga0268264_10447813 Ga0268264_104478131 214
82 3300006237 Ga0097621_100044569 Ga0097621_1000445693 215
83 3300006358 Ga0068871_100031076 Ga0068871_1000310763 215
84 3300009098 Ga0105245_10352713 Ga0105245_103527132 215
85 3300009174 Ga0105241_11063018 Ga0105241_110630181 215
86 3300011119 Ga0105246_10230985 Ga0105246_102309852 215
87 3300013297 Ga0157378_10513066 Ga0157378_105130661 215
88 3300025935 Ga0207709_10245724 Ga0207709_102457241 215
89 3300026023 Ga0207677_10306516 Ga0207677_103065161 215
90 3300028381 Ga0268264_10004838 Ga0268264_100048386 215
91 3300059493 Ga0587077_033948 Ga0587077_033948_170_979 215
92 3300005719 Ga0068861_100669593 Ga0068861_1006695931 216
93 3300035692 Ga0373935_0025012 Ga0373935_0025012_2915_3574 216
94 3300035724 Ga0373933_0095203 Ga0373933_0095203_229_888 216
95 3300041486 Ga0451807_0255555 Ga0451807_0255555_621_1286 216
96 3300041512 Ga0451853_1584390 Ga0451853_1584390_109_774 216
97 3300049127 Ga0501306_030216 Ga0501306_030216_132_782 216
98 3300005535 Ga0070684_100587351 Ga0070684_1005873511 217
99 3300005563 Ga0068855_100015074 Ga0068855_1000150749 217
100 3300005614 Ga0068856_100001056 Ga0068856_10000105624 217
101 3300006195 Ga0075366_10033533 Ga0075366_100335332 217
102 3300009093 Ga0105240_10094170 Ga0105240_100941702 217
103 3300025913 Ga0207695_10000002 Ga0207695_100000021520 217
104 3300025913 Ga0207695_10165920 Ga0207695_101659202 217
105 3300025949 Ga0207667_10143574 Ga0207667_101435742 217
106 3300026078 Ga0207702_10025243 Ga0207702_100252434 217
107 3300031238 Ga0265332_10115225 Ga0265332_101152251 217
108 3300031711 Ga0265314_10055317 Ga0265314_100553172 217
109 3300031712 Ga0265342_10021681 Ga0265342_100216812 217
110 3300031712 Ga0265342_10086924 Ga0265342_100869243 217
111 3300031731 Ga0307405_10194131 Ga0307405_101941312 217
112 3300031852 Ga0307410_10345114 Ga0307410_103451142 217
113 3300032002 Ga0307416_100177121 Ga0307416_1001771212 217
114 3300049573 Ga0501037_0275909 Ga0501037_0275909_102_755 217
115 3300049589 Ga0501073_0043625 Ga0501073_0043625_2251_3033 217
116 3300049823 Ga0501044_0122481 Ga0501044_0122481_400_1053 217
117 3300025928 Ga0207700_10979831 Ga0207700_109798312 218
118 3300005329 Ga0070683_101131665 Ga0070683_1011316651 219
119 3300005539 Ga0068853_100194187 Ga0068853_1001941872 219
120 3300005563 Ga0068855_100412284 Ga0068855_1004122842 219
121 3300005614 Ga0068856_100010439 Ga0068856_1000104396 219
122 3300005718 Ga0068866_10040883 Ga0068866_100408832 219
123 3300009093 Ga0105240_10000042 Ga0105240_10000042207 219
124 3300009093 Ga0105240_10017702 Ga0105240_100177023 219
125 3300009174 Ga0105241_10154079 Ga0105241_101540792 219
126 3300009551 Ga0105238_10006997 Ga0105238_1000699710 219
127 3300025899 Ga0207642_10028375 Ga0207642_100283753 219
128 3300025911 Ga0207654_10104326 Ga0207654_101043262 219
129 3300025913 Ga0207695_10047389 Ga0207695_100473894 219
130 3300025924 Ga0207694_10018101 Ga0207694_100181014 219
131 3300025934 Ga0207686_10015777 Ga0207686_100157774 219
132 3300025949 Ga0207667_10118221 Ga0207667_101182213 219
133 3300025949 Ga0207667_10231594 Ga0207667_102315942 219
134 3300026078 Ga0207702_10004574 Ga0207702_100045745 219
135 3300031728 Ga0316578_10145015 Ga0316578_101450151 219
136 3300042876 Ga0451577_0002994 Ga0451577_0002994_2969_3694 219
137 3300005329 Ga0070683_100151467 Ga0070683_1001514672 220
138 3300005341 Ga0070691_10183159 Ga0070691_101831591 220
139 3300005458 Ga0070681_10031907 Ga0070681_100319075 220
140 3300005563 Ga0068855_100012307 Ga0068855_1000123074 220
141 3300005563 Ga0068855_100117401 Ga0068855_1001174013 220
142 3300009093 Ga0105240_10205371 Ga0105240_102053712 220
143 3300013104 Ga0157370_10246085 Ga0157370_102460852 220
144 3300013105 Ga0157369_10007369 Ga0157369_100073698 220
145 3300013296 Ga0157374_10552100 Ga0157374_105521001 220
146 3300013297 Ga0157378_10847364 Ga0157378_108473642 220
147 3300025912 Ga0207707_10329033 Ga0207707_103290332 220
148 3300025944 Ga0207661_10189332 Ga0207661_101893322 220
149 3300025949 Ga0207667_10077121 Ga0207667_100771213 220
150 3300025949 Ga0207667_10094507 Ga0207667_100945072 220
151 3300031247 Ga0265340_10009522 Ga0265340_100095222 220
152 3300044693 Ga0466961_0085530 Ga0466961_0085530_1048_1710 220
153 3300049570 Ga0501033_0024461 Ga0501033_0024461_3160_3822 220
154 3300005327 Ga0070658_10704556 Ga0070658_107045561 221
155 3300005328 Ga0070676_10096722 Ga0070676_100967222 221
156 3300005329 Ga0070683_100088459 Ga0070683_1000884592 221
157 3300005329 Ga0070683_100271879 Ga0070683_1002718792 221
158 3300005329 Ga0070683_100288254 Ga0070683_1002882542 221
159 3300005331 Ga0070670_100034307 Ga0070670_1000343072 221
160 3300005334 Ga0068869_100016516 Ga0068869_1000165162 221
161 3300005336 Ga0070680_100048820 Ga0070680_1000488202 221
162 3300005338 Ga0068868_100061403 Ga0068868_1000614033 221
163 3300005339 Ga0070660_100024286 Ga0070660_1000242865 221
164 3300005347 Ga0070668_100012388 Ga0070668_1000123882 221
165 3300005354 Ga0070675_100042002 Ga0070675_1000420021 221
166 3300005355 Ga0070671_100096889 Ga0070671_1000968892 221
167 3300005356 Ga0070674_100272529 Ga0070674_1002725292 221
168 3300005365 Ga0070688_100245367 Ga0070688_1002453672 221
169 3300005435 Ga0070714_100011194 Ga0070714_1000111945 221
170 3300005436 Ga0070713_100910800 Ga0070713_1009108001 221
171 3300005457 Ga0070662_100025223 Ga0070662_1000252233 221
172 3300005458 Ga0070681_10027871 Ga0070681_100278712 221
173 3300005459 Ga0068867_100289872 Ga0068867_1002898722 221
174 3300005530 Ga0070679_100080517 Ga0070679_1000805172 221
175 3300005535 Ga0070684_100050775 Ga0070684_1000507753 221
176 3300005543 Ga0070672_100117356 Ga0070672_1001173562 221
177 3300005548 Ga0070665_100106534 Ga0070665_1001065343 221
178 3300005563 Ga0068855_100002968 Ga0068855_1000029686 221
179 3300005563 Ga0068855_100047061 Ga0068855_1000470612 221
180 3300005564 Ga0070664_100348412 Ga0070664_1003484122 221
181 3300005577 Ga0068857_100043603 Ga0068857_1000436032 221
182 3300005614 Ga0068856_100032989 Ga0068856_1000329892 221
183 3300005614 Ga0068856_100632836 Ga0068856_1006328362 221
184 3300005616 Ga0068852_100000008 Ga0068852_100000008109 221
185 3300005616 Ga0068852_100011266 Ga0068852_1000112662 221
186 3300005616 Ga0068852_100790496 Ga0068852_1007904961 221
187 3300005617 Ga0068859_100225267 Ga0068859_1002252672 221
188 3300005618 Ga0068864_100468240 Ga0068864_1004682402 221
189 3300005834 Ga0068851_10017970 Ga0068851_100179702 221
190 3300005840 Ga0068870_10705578 Ga0068870_107055781 221
191 3300005842 Ga0068858_100181499 Ga0068858_1001814992 221
192 3300005843 Ga0068860_100052336 Ga0068860_1000523362 221
193 3300006028 Ga0070717_10224178 Ga0070717_102241782 221
194 3300006237 Ga0097621_100495938 Ga0097621_1004959381 221
195 3300006358 Ga0068871_100060600 Ga0068871_1000606002 221
196 3300006931 Ga0097620_100225258 Ga0097620_1002252582 221
197 3300009093 Ga0105240_10000038 Ga0105240_1000003826 221
198 3300009093 Ga0105240_10239012 Ga0105240_102390122 221
199 3300009098 Ga0105245_10028796 Ga0105245_100287965 221
200 3300009101 Ga0105247_10139368 Ga0105247_101393682 221
201 3300009174 Ga0105241_10124584 Ga0105241_101245842 221
202 3300009176 Ga0105242_10021541 Ga0105242_100215412 221
203 3300009545 Ga0105237_10023988 Ga0105237_100239886 221
204 3300009545 Ga0105237_10032425 Ga0105237_100324251 221
205 3300009545 Ga0105237_10681891 Ga0105237_106818912 221
206 3300009551 Ga0105238_10011762 Ga0105238_100117622 221
207 3300010375 Ga0105239_10178785 Ga0105239_101787852 221
208 3300011119 Ga0105246_10164492 Ga0105246_101644922 221
209 3300013102 Ga0157371_10067626 Ga0157371_100676263 221
210 3300013104 Ga0157370_10000130 Ga0157370_1000013050 221
211 3300013104 Ga0157370_10037751 Ga0157370_100377514 221
212 3300013104 Ga0157370_10089065 Ga0157370_100890653 221
213 3300013105 Ga0157369_10000058 Ga0157369_10000058111 221
214 3300013105 Ga0157369_10008970 Ga0157369_100089707 221
215 3300013105 Ga0157369_10604362 Ga0157369_106043622 221
216 3300013296 Ga0157374_10030256 Ga0157374_100302565 221
217 3300013297 Ga0157378_10029402 Ga0157378_100294022 221
218 3300013306 Ga0163162_10157090 Ga0163162_101570902 221
219 3300013307 Ga0157372_10000163 Ga0157372_1000016321 221
220 3300013307 Ga0157372_10325469 Ga0157372_103254692 221
221 3300014968 Ga0157379_10029172 Ga0157379_100291723 221
222 3300017792 Ga0163161_10183695 Ga0163161_101836952 221
223 3300025321 Ga0207656_10045163 Ga0207656_100451632 221
224 3300025900 Ga0207710_10123096 Ga0207710_101230962 221
225 3300025901 Ga0207688_10099042 Ga0207688_100990422 221
226 3300025904 Ga0207647_10011217 Ga0207647_100112173 221
227 3300025907 Ga0207645_10083113 Ga0207645_100831132 221
228 3300025911 Ga0207654_10000017 Ga0207654_10000017153 221
229 3300025912 Ga0207707_10097802 Ga0207707_100978023 221
230 3300025913 Ga0207695_10000070 Ga0207695_1000007029 221
231 3300025913 Ga0207695_10109400 Ga0207695_101094003 221
232 3300025913 Ga0207695_10297776 Ga0207695_102977762 221
233 3300025914 Ga0207671_10283372 Ga0207671_102833722 221
234 3300025916 Ga0207663_10218308 Ga0207663_102183082 221
235 3300025919 Ga0207657_10020432 Ga0207657_100204324 221
236 3300025921 Ga0207652_10565501 Ga0207652_105655011 221
237 3300025924 Ga0207694_10008698 Ga0207694_100086986 221
238 3300025926 Ga0207659_10787629 Ga0207659_107876292 221
239 3300025928 Ga0207700_10760695 Ga0207700_107606952 221
240 3300025931 Ga0207644_10041169 Ga0207644_100411693 221
241 3300025933 Ga0207706_10028265 Ga0207706_100282652 221
242 3300025940 Ga0207691_10077929 Ga0207691_100779292 221
243 3300025942 Ga0207689_10196563 Ga0207689_101965632 221
244 3300025944 Ga0207661_10067020 Ga0207661_100670202 221
245 3300025945 Ga0207679_10942251 Ga0207679_109422512 221
246 3300025949 Ga0207667_10000259 Ga0207667_1000025913 221
247 3300025949 Ga0207667_10000360 Ga0207667_1000036058 221
248 3300025949 Ga0207667_10000385 Ga0207667_1000038556 221
249 3300025949 Ga0207667_10003542 Ga0207667_100035426 221
250 3300026035 Ga0207703_10183031 Ga0207703_101830312 221
251 3300026041 Ga0207639_10109615 Ga0207639_101096152 221
252 3300026078 Ga0207702_10307925 Ga0207702_103079252 221
253 3300026089 Ga0207648_10231011 Ga0207648_102310112 221
254 3300026095 Ga0207676_10414892 Ga0207676_104148921 221
255 3300026116 Ga0207674_10227460 Ga0207674_102274602 221
256 3300026121 Ga0207683_10015421 Ga0207683_100154214 221
257 3300026142 Ga0207698_10000010 Ga0207698_1000001027 221
258 3300026142 Ga0207698_10400795 Ga0207698_104007952 221
259 3300028379 Ga0268266_10067031 Ga0268266_100670312 221
260 3300028556 Ga0265337_1000547 Ga0265337_10005473 221
261 3300028654 Ga0265322_10064276 Ga0265322_100642762 221
262 3300028666 Ga0265336_10004711 Ga0265336_100047112 221
263 3300028666 Ga0265336_10012524 Ga0265336_100125242 221
264 3300028800 Ga0265338_10003396 Ga0265338_1000339611 221
265 3300028800 Ga0265338_10018178 Ga0265338_100181783 221
266 3300028800 Ga0265338_10173463 Ga0265338_101734632 221
267 3300031235 Ga0265330_10084154 Ga0265330_100841542 221
268 3300031240 Ga0265320_10044683 Ga0265320_100446832 221
269 3300031249 Ga0265339_10008730 Ga0265339_100087302 221
270 3300031249 Ga0265339_10052752 Ga0265339_100527522 221
271 3300031344 Ga0265316_10001164 Ga0265316_1000116418 221
272 3300031344 Ga0265316_10282699 Ga0265316_102826992 221
273 3300031711 Ga0265314_10007268 Ga0265314_100072685 221
274 3300031712 Ga0265342_10159258 Ga0265342_101592582 221
275 3300038443 Ga0395901_0214779 Ga0395901_0214779_53_718 221
276 3300042876 Ga0451577_0996063 Ga0451577_0996063_40_705 221
277 3300045976 Ga0466967_0004075 Ga0466967_0004075_4857_5522 221
278 3300046454 Ga0495592_0000186 Ga0495592_0000186_48668_49354 221
279 3300046476 Ga0495662_0010459 Ga0495662_0010459_1182_1868 221
280 3300046514 Ga0495618_0011870 Ga0495618_0011870_4472_5158 221
281 3300046516 Ga0495628_0001101 Ga0495628_0001101_13591_14277 221
282 3300046517 Ga0495630_0072503 Ga0495630_0072503_1395_2081 221
283 3300046529 Ga0495652_0148352 Ga0495652_0148352_630_1316 221
284 3300046535 Ga0495586_0007465 Ga0495586_0007465_707_1393 221
285 3300046543 Ga0495645_0001522 Ga0495645_0001522_2299_2985 221
286 3300046678 Ga0495599_0007298 Ga0495599_0007298_821_1507 221
287 3300046683 Ga0495658_0296399 Ga0495658_0296399_56_742 221
288 3300046690 Ga0495624_0026299 Ga0495624_0026299_2138_2824 221
289 3300048903 Ga0496100_0135543 Ga0496100_0135543_943_1608 221
290 3300048908 Ga0496105_0189918 Ga0496105_0189918_217_882 221
291 3300048909 Ga0496106_0036311 Ga0496106_0036311_2538_3203 221
292 3300048915 Ga0496112_0429946 Ga0496112_0429946_309_974 221
293 3300048917 Ga0496114_0401397 Ga0496114_0401397_381_1046 221
294 3300048918 Ga0496115_0312680 Ga0496115_0312680_176_841 221
295 3300001991 JGI24743J22301_10006584 JGI24743J22301_100065842 222
296 3300005327 Ga0070658_10051222 Ga0070658_100512222 222
297 3300005327 Ga0070658_10125040 Ga0070658_101250401 222
298 3300005327 Ga0070658_10164823 Ga0070658_101648232 222
299 3300005329 Ga0070683_100008326 Ga0070683_1000083266 222
300 3300005329 Ga0070683_100122206 Ga0070683_1001222062 222
301 3300005329 Ga0070683_100617384 Ga0070683_1006173841 222
302 3300005331 Ga0070670_100002583 Ga0070670_1000025838 222
303 3300005334 Ga0068869_100002228 Ga0068869_1000022287 222
304 3300005337 Ga0070682_100035463 Ga0070682_1000354633 222
305 3300005338 Ga0068868_100001421 Ga0068868_1000014216 222
306 3300005338 Ga0068868_100050097 Ga0068868_1000500972 222
307 3300005339 Ga0070660_100642837 Ga0070660_1006428371 222
308 3300005344 Ga0070661_100097516 Ga0070661_1000975162 222
309 3300005355 Ga0070671_100002112 Ga0070671_10000211210 222
310 3300005355 Ga0070671_100010886 Ga0070671_1000108862 222
311 3300005367 Ga0070667_100000953 Ga0070667_1000009538 222
312 3300005435 Ga0070714_100050530 Ga0070714_1000505302 222
313 3300005535 Ga0070684_100000877 Ga0070684_1000008778 222
314 3300005535 Ga0070684_100482500 Ga0070684_1004825001 222
315 3300005539 Ga0068853_100000123 Ga0068853_10000012323 222
316 3300005539 Ga0068853_100016173 Ga0068853_1000161733 222
317 3300005539 Ga0068853_100119095 Ga0068853_1001190952 222
318 3300005539 Ga0068853_100488437 Ga0068853_1004884372 222
319 3300005548 Ga0070665_100018290 Ga0070665_1000182906 222
320 3300005563 Ga0068855_100001407 Ga0068855_10000140721 222
321 3300005563 Ga0068855_100009913 Ga0068855_1000099134 222
322 3300005563 Ga0068855_100108236 Ga0068855_1001082363 222
323 3300005563 Ga0068855_100417573 Ga0068855_1004175732 222
324 3300005564 Ga0070664_100039063 Ga0070664_1000390632 222
325 3300005564 Ga0070664_100046430 Ga0070664_1000464301 222
326 3300005564 Ga0070664_100216149 Ga0070664_1002161492 222
327 3300005577 Ga0068857_100003976 Ga0068857_10000397610 222
328 3300005577 Ga0068857_100055830 Ga0068857_1000558302 222
329 3300005577 Ga0068857_100065590 Ga0068857_1000655902 222
330 3300005578 Ga0068854_100021779 Ga0068854_1000217792 222
331 3300005578 Ga0068854_100026618 Ga0068854_1000266184 222
332 3300005614 Ga0068856_100013217 Ga0068856_1000132172 222
333 3300005614 Ga0068856_100014034 Ga0068856_1000140346 222
334 3300005614 Ga0068856_100033950 Ga0068856_1000339503 222
335 3300005614 Ga0068856_100223453 Ga0068856_1002234532 222
336 3300005616 Ga0068852_100000293 Ga0068852_1000002935 222
337 3300005616 Ga0068852_100009180 Ga0068852_1000091805 222
338 3300005616 Ga0068852_100061470 Ga0068852_1000614702 222
339 3300005616 Ga0068852_100144787 Ga0068852_1001447872 222
340 3300005616 Ga0068852_100370785 Ga0068852_1003707852 222
341 3300005616 Ga0068852_100452549 Ga0068852_1004525492 222
342 3300005617 Ga0068859_100007518 Ga0068859_1000075183 222
343 3300005841 Ga0068863_100000464 Ga0068863_1000004648 222
344 3300005842 Ga0068858_100002614 Ga0068858_1000026148 222
345 3300005843 Ga0068860_100000665 Ga0068860_1000006654 222
346 3300005844 Ga0068862_100030788 Ga0068862_1000307882 222
347 3300006028 Ga0070717_10004690 Ga0070717_100046906 222
348 3300006237 Ga0097621_100006450 Ga0097621_1000064506 222
349 3300006237 Ga0097621_100122337 Ga0097621_1001223372 222
350 3300006358 Ga0068871_100008504 Ga0068871_1000085045 222
351 3300006358 Ga0068871_100015596 Ga0068871_1000155962 222
352 3300006931 Ga0097620_100007518 Ga0097620_1000075183 222
353 3300009093 Ga0105240_10000758 Ga0105240_1000075814 222
354 3300009093 Ga0105240_10001148 Ga0105240_1000114833 222
355 3300009093 Ga0105240_10004262 Ga0105240_100042626 222
356 3300009093 Ga0105240_10014303 Ga0105240_100143037 222
357 3300009093 Ga0105240_10015924 Ga0105240_100159245 222
358 3300009093 Ga0105240_10016102 Ga0105240_100161022 222
359 3300009093 Ga0105240_10360618 Ga0105240_103606182 222
360 3300009098 Ga0105245_10010785 Ga0105245_100107855 222
361 3300009098 Ga0105245_10013280 Ga0105245_100132805 222
362 3300009098 Ga0105245_10417595 Ga0105245_104175952 222
363 3300009101 Ga0105247_10001890 Ga0105247_100018907 222
364 3300009174 Ga0105241_10001039 Ga0105241_1000103913 222
365 3300009174 Ga0105241_10001931 Ga0105241_100019314 222
366 3300009174 Ga0105241_10013633 Ga0105241_100136332 222
367 3300009174 Ga0105241_10066684 Ga0105241_100666842 222
368 3300009174 Ga0105241_10114228 Ga0105241_101142282 222
369 3300009174 Ga0105241_10253086 Ga0105241_102530862 222
370 3300009177 Ga0105248_10002701 Ga0105248_1000270112 222
371 3300009177 Ga0105248_10042096 Ga0105248_100420965 222
372 3300009545 Ga0105237_10001502 Ga0105237_100015024 222
373 3300009545 Ga0105237_10011880 Ga0105237_100118806 222
374 3300009545 Ga0105237_10158379 Ga0105237_101583792 222
375 3300009545 Ga0105237_10398622 Ga0105237_103986222 222
376 3300009545 Ga0105237_10593224 Ga0105237_105932242 222
377 3300009551 Ga0105238_10000395 Ga0105238_1000039533 222
378 3300009551 Ga0105238_10005084 Ga0105238_100050847 222
379 3300009551 Ga0105238_10005180 Ga0105238_100051803 222
380 3300009551 Ga0105238_10028743 Ga0105238_100287432 222
381 3300009551 Ga0105238_10145834 Ga0105238_101458342 222
382 3300009551 Ga0105238_10184535 Ga0105238_101845352 222
383 3300009553 Ga0105249_10094535 Ga0105249_100945353 222
384 3300010375 Ga0105239_10012087 Ga0105239_100120879 222
385 3300010375 Ga0105239_10012121 Ga0105239_100121217 222
386 3300010375 Ga0105239_10036963 Ga0105239_100369635 222
387 3300010375 Ga0105239_10042329 Ga0105239_100423293 222
388 3300010375 Ga0105239_10293015 Ga0105239_102930152 222
389 3300011119 Ga0105246_10000786 Ga0105246_100007868 222
390 3300011119 Ga0105246_10300095 Ga0105246_103000952 222
391 3300013102 Ga0157371_10138708 Ga0157371_101387082 222
392 3300013105 Ga0157369_10013098 Ga0157369_100130987 222
393 3300013105 Ga0157369_10015590 Ga0157369_100155906 222
394 3300013105 Ga0157369_10045787 Ga0157369_100457872 222
395 3300013105 Ga0157369_10100124 Ga0157369_101001242 222
396 3300013105 Ga0157369_10246935 Ga0157369_102469352 222
397 3300013105 Ga0157369_10284086 Ga0157369_102840862 222
398 3300013296 Ga0157374_10001434 Ga0157374_1000143412 222
399 3300013296 Ga0157374_10027016 Ga0157374_100270164 222
400 3300013296 Ga0157374_10063702 Ga0157374_100637025 222
401 3300013297 Ga0157378_10050996 Ga0157378_100509964 222
402 3300013297 Ga0157378_10261557 Ga0157378_102615572 222
403 3300013297 Ga0157378_10702122 Ga0157378_107021222 222
404 3300013306 Ga0163162_10011140 Ga0163162_100111402 222
405 3300013307 Ga0157372_10001214 Ga0157372_100012143 222
406 3300013307 Ga0157372_10027192 Ga0157372_100271922 222
407 3300013307 Ga0157372_10040007 Ga0157372_100400074 222
408 3300013307 Ga0157372_10053305 Ga0157372_100533053 222
409 3300013307 Ga0157372_10133977 Ga0157372_101339772 222
410 3300013308 Ga0157375_10003296 Ga0157375_100032963 222
411 3300013308 Ga0157375_10074189 Ga0157375_100741893 222
412 3300014325 Ga0163163_10001004 Ga0163163_100010049 222
413 3300014745 Ga0157377_10282824 Ga0157377_102828241 222
414 3300014968 Ga0157379_10000286 Ga0157379_100002864 222
415 3300014968 Ga0157379_10304056 Ga0157379_103040561 222
416 3300014969 Ga0157376_10003948 Ga0157376_100039485 222
417 3300014969 Ga0157376_10874381 Ga0157376_108743811 222
418 3300025321 Ga0207656_10186199 Ga0207656_101861992 222
419 3300025900 Ga0207710_10003489 Ga0207710_100034897 222
420 3300025909 Ga0207705_10022087 Ga0207705_100220873 222
421 3300025909 Ga0207705_10067731 Ga0207705_100677312 222
422 3300025911 Ga0207654_10000301 Ga0207654_1000030121 222
423 3300025911 Ga0207654_10003602 Ga0207654_100036023 222
424 3300025911 Ga0207654_10018918 Ga0207654_100189184 222
425 3300025911 Ga0207654_10095656 Ga0207654_100956562 222
426 3300025913 Ga0207695_10000108 Ga0207695_1000010854 222
427 3300025913 Ga0207695_10000253 Ga0207695_1000025391 222
428 3300025913 Ga0207695_10000345 Ga0207695_1000034554 222
429 3300025913 Ga0207695_10001120 Ga0207695_100011205 222
430 3300025913 Ga0207695_10020129 Ga0207695_100201292 222
431 3300025913 Ga0207695_10026325 Ga0207695_100263254 222
432 3300025914 Ga0207671_10000081 Ga0207671_1000008122 222
433 3300025914 Ga0207671_10001179 Ga0207671_100011794 222
434 3300025914 Ga0207671_10085004 Ga0207671_100850042 222
435 3300025920 Ga0207649_10035706 Ga0207649_100357062 222
436 3300025924 Ga0207694_10000029 Ga0207694_10000029162 222
437 3300025924 Ga0207694_10000313 Ga0207694_100003135 222
438 3300025924 Ga0207694_10001638 Ga0207694_1000163811 222
439 3300025924 Ga0207694_10035252 Ga0207694_100352522 222
440 3300025924 Ga0207694_10175776 Ga0207694_101757762 222
441 3300025924 Ga0207694_10200966 Ga0207694_102009662 222
442 3300025925 Ga0207650_10006691 Ga0207650_100066915 222
443 3300025927 Ga0207687_10009319 Ga0207687_100093195 222
444 3300025927 Ga0207687_10053309 Ga0207687_100533092 222
445 3300025931 Ga0207644_10005161 Ga0207644_100051612 222
446 3300025931 Ga0207644_10018737 Ga0207644_100187372 222
447 3300025941 Ga0207711_10002056 Ga0207711_100020566 222
448 3300025942 Ga0207689_10016130 Ga0207689_100161305 222
449 3300025944 Ga0207661_10000229 Ga0207661_1000022924 222
450 3300025944 Ga0207661_10198121 Ga0207661_101981212 222
451 3300025944 Ga0207661_10725666 Ga0207661_107256661 222
452 3300025949 Ga0207667_10007288 Ga0207667_1000728810 222
453 3300025949 Ga0207667_10053335 Ga0207667_100533354 222
454 3300025949 Ga0207667_10565189 Ga0207667_105651892 222
455 3300025961 Ga0207712_10239799 Ga0207712_102397992 222
456 3300025981 Ga0207640_10016194 Ga0207640_100161942 222
457 3300025981 Ga0207640_10321543 Ga0207640_103215432 222
458 3300025986 Ga0207658_10007733 Ga0207658_100077338 222
459 3300026023 Ga0207677_10000025 Ga0207677_1000002596 222
460 3300026023 Ga0207677_10000049 Ga0207677_1000004946 222
461 3300026035 Ga0207703_10000516 Ga0207703_1000051624 222
462 3300026041 Ga0207639_10000055 Ga0207639_1000005533 222
463 3300026041 Ga0207639_10098204 Ga0207639_100982042 222
464 3300026041 Ga0207639_10102719 Ga0207639_101027193 222
465 3300026041 Ga0207639_10136334 Ga0207639_101363342 222
466 3300026078 Ga0207702_10000839 Ga0207702_100008394 222
467 3300026078 Ga0207702_10003455 Ga0207702_100034552 222
468 3300026078 Ga0207702_10032983 Ga0207702_100329833 222
469 3300026078 Ga0207702_10387050 Ga0207702_103870501 222
470 3300026088 Ga0207641_10000806 Ga0207641_1000080619 222
471 3300026116 Ga0207674_10000340 Ga0207674_1000034016 222
472 3300026116 Ga0207674_10001426 Ga0207674_1000142620 222
473 3300026116 Ga0207674_10012783 Ga0207674_100127832 222
474 3300026142 Ga0207698_10000215 Ga0207698_100002155 222
475 3300026142 Ga0207698_10033407 Ga0207698_100334073 222
476 3300026142 Ga0207698_11037173 Ga0207698_110371731 222
477 3300028379 Ga0268266_10023777 Ga0268266_100237774 222
478 3300028380 Ga0268265_10225105 Ga0268265_102251052 222
479 3300028381 Ga0268264_10000086 Ga0268264_1000008632 222
480 3300042876 Ga0451577_0357660 Ga0451577_0357660_213_890 222
481 3300044712 Ga0453684_0000027 Ga0453684_0000027_39244_39921 222
482 3300046472 Ga0495580_0206798 Ga0495580_0206798_543_1211 222
483 3300046536 Ga0495587_0084272 Ga0495587_0084272_314_982 222
484 3300048088 Ga0495602_0107502 Ga0495602_0107502_1502_2170 222
485 3300048907 Ga0496104_0887460 Ga0496104_0887460_110_778 222
486 3300048917 Ga0496114_0335087 Ga0496114_0335087_570_1238 222
487 3300048918 Ga0496115_0244265 Ga0496115_0244265_74_742 222
488 3300048918 Ga0496115_0350246 Ga0496115_0350246_436_1104 222
489 3300048918 Ga0496115_0540371 Ga0496115_0540371_115_783 222
490 3300059511 Ga0587091_010120 Ga0587091_010120_354_1022 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00754

F5_F8_type_C

F5/8 type C domain

92

231

0.79

PF22633

F5_F8_type_C_2

NedA-like, galactose-binding domain

107

215

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d2a-assembly1.cif.gz_A cbm32 of alyq in complex with 4,5-unsaturated mannuronic acid 0.8613 75 216
7mfk-assembly1.cif.gz_A structure of the clostridium perfringens gh89 in complex with alpha-hnjnac 0.8508 68 221
4a4a-assembly1.cif.gz_A cpgh89 (e483q, e601q), from clostridium perfringens, in complex with its substrate glcnac-alpha-1,4-galactose 0.8387 68 221
2vcb-assembly1.cif.gz_A family 89 glycoside hydrolase from clostridium perfringens in complex with pugnac 0.8197 68 221
5xnr-assembly1.cif.gz_A truncated alyq with cbm32 and alginate lyase domains 0.8139 67 221
ID Description Score Start End Superfamily
af_A0A0P0W853_2_106_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8229 103 221 2.60.120.260
2vcbA01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8197 68 221 2.60.120.260
af_A0A0N4STS3_24_155_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8169 69 218 2.60.120.260
af_A0A0N4STS3_24_155_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7944 69 218 2.60.120.260
2vcbA01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7925 68 221 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A7V2IPQ0-F1-model_v4 F5/8 type C domain-containing protein 0.9905 112 219
AF-A0A7X7U1Z8-F1-model_v4 Discoidin domain-containing protein 0.9854 24 222 GO:0016020
AF-A0A520QIE1-F1-model_v4 Discoidin domain-containing protein 0.9841 26 219
AF-X1RDT8-F1-model_v4 F5/8 type C domain-containing protein 0.9833 83 222
AF-X1GV02-F1-model_v4 F5/8 type C domain-containing protein 0.9829 25 222

Feature Viewer

pLDDT pTM Quality
89.45 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map