F453931
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 490 | 246 | 490 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10140286|Ga0114129_101402862 |
| Length | 179 |
| Sequence | VRVTGTNNGGLSKKENKSDGAEYQCKGENIMTKTNDLAEPIIVERTFDAPVGRVWTALTDVNEMRQWYFDLKEFKPQVGFEFEFIVEHEGNSYHHLCRVTEVVPQKKIAYSWRYKGEPGDSLVTIELSPEGEKTHLKLTHSGIETFPKTPAYARKNFEAGWTAIVGTELKQFVEQKQKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 95 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 181 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 182 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 183 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 184 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.73 |
| Rhizosphere | 92.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1298596 | 2162886007 | Bacteria | 1328 |
| 2 | SwRhRL2b_contig_2531808 | 2162886007 | Bacteria | 1116 |
| 3 | SwRhRL2b_contig_3073330 | 2162886007 | Bacteria | 820 |
| 4 | JGI24743J22301_10009542 | 3300001991 | Bacteria | 1721 |
| 5 | JGI24035J26624_1001177 | 3300002126 | Bacteria | 2482 |
| 6 | JGI25406J46586_10000005 | 3300003203 | Bacteria | 118289 |
| 7 | JGI25406J46586_10240930 | 3300003203 | Unclassified | 531 |
| 8 | JGI25405J52794_10153732 | 3300003911 | Unclassified | 525 |
| 9 | Ga0065714_10127204 | 3300005288 | Bacteria | 1284 |
| 10 | Ga0065704_10044063 | 3300005289 | Bacteria | 904 |
| 11 | Ga0065704_10393187 | 3300005289 | Bacteria | 760 |
| 12 | Ga0065704_10455190 | 3300005289 | Unclassified | 702 |
| 13 | Ga0065712_10001986 | 3300005290 | Bacteria | 13447 |
| 14 | Ga0065712_10003070 | 3300005290 | Bacteria | 10088 |
| 15 | Ga0065712_10008286 | 3300005290 | Bacteria | 2738 |
| 16 | Ga0065712_10010351 | 3300005290 | Bacteria | 3193 |
| 17 | Ga0065712_10207420 | 3300005290 | Bacteria | 1085 |
| 18 | Ga0065712_10313863 | 3300005290 | Bacteria | 820 |
| 19 | Ga0065712_10423776 | 3300005290 | Unclassified | 688 |
| 20 | Ga0065715_10002225 | 3300005293 | Bacteria | 12258 |
| 21 | Ga0065715_10008128 | 3300005293 | Bacteria | 4970 |
| 22 | Ga0065715_10095299 | 3300005293 | Bacteria | 4117 |
| 23 | Ga0065715_10104559 | 3300005293 | Bacteria | 2950 |
| 24 | Ga0065715_10245587 | 3300005293 | Bacteria | 1184 |
| 25 | Ga0065715_10251641 | 3300005293 | Bacteria | 1165 |
| 26 | Ga0065707_10000986 | 3300005295 | Bacteria | 8919 |
| 27 | Ga0065707_10197703 | 3300005295 | Unclassified | 1327 |
| 28 | Ga0065707_11025741 | 3300005295 | Unclassified | 533 |
| 29 | Ga0065707_11141255 | 3300005295 | Bacteria | 507 |
| 30 | Ga0070658_10197883 | 3300005327 | Bacteria | 1695 |
| 31 | Ga0070676_10266277 | 3300005328 | Unclassified | 1149 |
| 32 | Ga0070676_10521905 | 3300005328 | Unclassified | 846 |
| 33 | Ga0070683_100016071 | 3300005329 | Bacteria | 6587 |
| 34 | Ga0070683_100257033 | 3300005329 | Bacteria | 1661 |
| 35 | Ga0070683_100298340 | 3300005329 | Bacteria | 1533 |
| 36 | Ga0070690_100125605 | 3300005330 | Bacteria | 1727 |
| 37 | Ga0070670_101170903 | 3300005331 | Unclassified | 702 |
| 38 | Ga0070666_10047952 | 3300005335 | Bacteria | 2869 |
| 39 | Ga0070666_10230446 | 3300005335 | Bacteria | 1308 |
| 40 | Ga0070680_100036859 | 3300005336 | Bacteria | 3951 |
| 41 | Ga0070682_100274712 | 3300005337 | Bacteria | 1226 |
| 42 | Ga0070682_100380571 | 3300005337 | Bacteria | 1061 |
| 43 | Ga0070682_100829150 | 3300005337 | Unclassified | 754 |
| 44 | Ga0068868_100192461 | 3300005338 | Bacteria | 1696 |
| 45 | Ga0068868_100352890 | 3300005338 | Bacteria | 1260 |
| 46 | Ga0070660_100533670 | 3300005339 | Bacteria | 978 |
| 47 | Ga0070660_100660209 | 3300005339 | Unclassified | 876 |
| 48 | Ga0070689_100058807 | 3300005340 | Bacteria | 2986 |
| 49 | Ga0070689_100267926 | 3300005340 | Bacteria | 1413 |
| 50 | Ga0070687_100044097 | 3300005343 | Bacteria | 2270 |
| 51 | Ga0070687_100366108 | 3300005343 | Bacteria | 935 |
| 52 | Ga0070661_100035685 | 3300005344 | Bacteria | 3612 |
| 53 | Ga0070661_100051358 | 3300005344 | Bacteria | 3017 |
| 54 | Ga0070661_100706171 | 3300005344 | Bacteria | 822 |
| 55 | Ga0070668_100032496 | 3300005347 | Bacteria | 3971 |
| 56 | Ga0070668_100694734 | 3300005347 | Bacteria | 897 |
| 57 | Ga0070669_100021292 | 3300005353 | Bacteria | 4635 |
| 58 | Ga0070669_100644662 | 3300005353 | Bacteria | 891 |
| 59 | Ga0070675_100047008 | 3300005354 | Bacteria | 3535 |
| 60 | Ga0070675_100058494 | 3300005354 | Bacteria | 3179 |
| 61 | Ga0070675_100205149 | 3300005354 | Bacteria | 1712 |
| 62 | Ga0070675_100346512 | 3300005354 | Bacteria | 1317 |
| 63 | Ga0070675_101359315 | 3300005354 | Bacteria | 655 |
| 64 | Ga0070671_100228507 | 3300005355 | Bacteria | 1579 |
| 65 | Ga0070671_100704999 | 3300005355 | Bacteria | 876 |
| 66 | Ga0070673_100298548 | 3300005364 | Bacteria | 1417 |
| 67 | Ga0070673_101327376 | 3300005364 | Unclassified | 676 |
| 68 | Ga0070673_101895253 | 3300005364 | Unclassified | 565 |
| 69 | Ga0070688_100018024 | 3300005365 | Bacteria | 4065 |
| 70 | Ga0070688_100046793 | 3300005365 | Bacteria | 2680 |
| 71 | Ga0070688_100061581 | 3300005365 | Bacteria | 2373 |
| 72 | Ga0070659_100002685 | 3300005366 | Bacteria | 12644 |
| 73 | Ga0070659_100290011 | 3300005366 | Bacteria | 1363 |
| 74 | Ga0070667_100302667 | 3300005367 | Bacteria | 1440 |
| 75 | Ga0070709_10092908 | 3300005434 | Bacteria | 1993 |
| 76 | Ga0070709_10621554 | 3300005434 | Bacteria | 834 |
| 77 | Ga0070714_100108519 | 3300005435 | Bacteria | 2454 |
| 78 | Ga0070714_100235077 | 3300005435 | Bacteria | 1690 |
| 79 | Ga0070713_100073337 | 3300005436 | Bacteria | 2897 |
| 80 | Ga0070710_10454869 | 3300005437 | Unclassified | 868 |
| 81 | Ga0070710_10700303 | 3300005437 | Unclassified | 715 |
| 82 | Ga0070701_10032536 | 3300005438 | Bacteria | 2598 |
| 83 | Ga0070711_100017632 | 3300005439 | Bacteria | 4549 |
| 84 | Ga0070711_100108591 | 3300005439 | Bacteria | 2033 |
| 85 | Ga0070711_100237604 | 3300005439 | Bacteria | 1423 |
| 86 | Ga0070711_101578197 | 3300005439 | Bacteria | 574 |
| 87 | Ga0070705_100041828 | 3300005440 | Unclassified | 2616 |
| 88 | Ga0070705_100141657 | 3300005440 | Bacteria | 1583 |
| 89 | Ga0070700_100064071 | 3300005441 | Bacteria | 2327 |
| 90 | Ga0070694_100085835 | 3300005444 | Bacteria | 2199 |
| 91 | Ga0070708_100019967 | 3300005445 | Bacteria | 5641 |
| 92 | Ga0070708_100036148 | 3300005445 | Bacteria | 4307 |
| 93 | Ga0070708_100193057 | 3300005445 | Bacteria | 1905 |
| 94 | Ga0070708_100249690 | 3300005445 | Unclassified | 1667 |
| 95 | Ga0070708_101615989 | 3300005445 | Bacteria | 603 |
| 96 | Ga0070663_100048566 | 3300005455 | Bacteria | 3010 |
| 97 | Ga0070663_100633945 | 3300005455 | Bacteria | 902 |
| 98 | Ga0070678_100079673 | 3300005456 | Bacteria | 2478 |
| 99 | Ga0070678_100215059 | 3300005456 | Bacteria | 1595 |
| 100 | Ga0070678_100973604 | 3300005456 | Unclassified | 779 |
| 101 | Ga0070662_100139986 | 3300005457 | Bacteria | 1874 |
| 102 | Ga0070662_100378082 | 3300005457 | Bacteria | 1165 |
| 103 | Ga0070681_10013048 | 3300005458 | Bacteria | 8250 |
| 104 | Ga0070685_10002918 | 3300005466 | Bacteria | 8738 |
| 105 | Ga0070685_10234773 | 3300005466 | Unclassified | 1208 |
| 106 | Ga0070685_10306022 | 3300005466 | Bacteria | 1073 |
| 107 | Ga0070706_100032564 | 3300005467 | Bacteria | 4808 |
| 108 | Ga0070706_100048900 | 3300005467 | Bacteria | 3902 |
| 109 | Ga0070706_100180367 | 3300005467 | Bacteria | 1972 |
| 110 | Ga0070706_100224719 | 3300005467 | Unclassified | 1752 |
| 111 | Ga0070706_100846029 | 3300005467 | Bacteria | 846 |
| 112 | Ga0070706_101371105 | 3300005467 | Unclassified | 648 |
| 113 | Ga0070707_100007862 | 3300005468 | Bacteria | 9901 |
| 114 | Ga0070707_100347103 | 3300005468 | Bacteria | 1442 |
| 115 | Ga0070698_100006750 | 3300005471 | Bacteria | 12441 |
| 116 | Ga0070698_100575820 | 3300005471 | Unclassified | 1066 |
| 117 | Ga0070698_100905225 | 3300005471 | Unclassified | 828 |
| 118 | Ga0070699_100707366 | 3300005518 | Unclassified | 921 |
| 119 | Ga0070699_101251460 | 3300005518 | Unclassified | 681 |
| 120 | Ga0070679_100038018 | 3300005530 | Bacteria | 4783 |
| 121 | Ga0070684_100002414 | 3300005535 | Bacteria | 13776 |
| 122 | Ga0070684_100032889 | 3300005535 | Bacteria | 4424 |
| 123 | Ga0070684_100077513 | 3300005535 | Bacteria | 2935 |
| 124 | Ga0070684_100738406 | 3300005535 | Bacteria | 919 |
| 125 | Ga0070684_101400266 | 3300005535 | Bacteria | 658 |
| 126 | Ga0070697_100005127 | 3300005536 | Bacteria | 10060 |
| 127 | Ga0070697_100228151 | 3300005536 | Bacteria | 1588 |
| 128 | Ga0070697_100236379 | 3300005536 | Bacteria | 1560 |
| 129 | Ga0070697_100268979 | 3300005536 | Unclassified | 1461 |
| 130 | Ga0070697_100300940 | 3300005536 | Unclassified | 1379 |
| 131 | Ga0070697_100613106 | 3300005536 | Bacteria | 957 |
| 132 | Ga0070697_101116269 | 3300005536 | Unclassified | 702 |
| 133 | Ga0070672_100040678 | 3300005543 | Bacteria | 3568 |
| 134 | Ga0070672_100603692 | 3300005543 | Bacteria | 956 |
| 135 | Ga0070686_100016744 | 3300005544 | Bacteria | 4270 |
| 136 | Ga0070686_100042514 | 3300005544 | Bacteria | 2847 |
| 137 | Ga0070695_100037100 | 3300005545 | Bacteria | 3070 |
| 138 | Ga0070665_100028026 | 3300005548 | Bacteria | 5673 |
| 139 | Ga0070665_100063641 | 3300005548 | Bacteria | 3698 |
| 140 | Ga0070665_101588076 | 3300005548 | Bacteria | 662 |
| 141 | Ga0070704_100393090 | 3300005549 | Unclassified | 1181 |
| 142 | Ga0070704_101524229 | 3300005549 | Unclassified | 615 |
| 143 | Ga0068855_100773895 | 3300005563 | Bacteria | 1022 |
| 144 | Ga0070664_100203268 | 3300005564 | Bacteria | 1768 |
| 145 | Ga0070664_100792022 | 3300005564 | Bacteria | 886 |
| 146 | Ga0068857_100022369 | 3300005577 | Bacteria | 5562 |
| 147 | Ga0068857_100536495 | 3300005577 | Bacteria | 1101 |
| 148 | Ga0068857_100568895 | 3300005577 | Bacteria | 1069 |
| 149 | Ga0068856_100086333 | 3300005614 | Bacteria | 3118 |
| 150 | Ga0068856_100706219 | 3300005614 | Bacteria | 1029 |
| 151 | Ga0068856_100735089 | 3300005614 | Bacteria | 1007 |
| 152 | Ga0068852_101280297 | 3300005616 | Bacteria | 755 |
| 153 | Ga0068859_100056621 | 3300005617 | Bacteria | 3947 |
| 154 | Ga0068870_10713563 | 3300005840 | Bacteria | 693 |
| 155 | Ga0068863_100059451 | 3300005841 | Bacteria | 3616 |
| 156 | Ga0068863_100074687 | 3300005841 | Bacteria | 3207 |
| 157 | Ga0068863_101067514 | 3300005841 | Bacteria | 812 |
| 158 | Ga0068858_100021640 | 3300005842 | Bacteria | 6011 |
| 159 | Ga0068858_100759315 | 3300005842 | Bacteria | 945 |
| 160 | Ga0081455_10006446 | 3300005937 | Bacteria | 12576 |
| 161 | Ga0081455_10010873 | 3300005937 | Bacteria | 9187 |
| 162 | Ga0081455_10021810 | 3300005937 | Bacteria | 5999 |
| 163 | Ga0081455_10517902 | 3300005937 | Bacteria | 797 |
| 164 | Ga0081540_1069915 | 3300005983 | Bacteria | 1628 |
| 165 | Ga0081539_10000026 | 3300005985 | Bacteria | 330830 |
| 166 | Ga0081539_10008376 | 3300005985 | Bacteria | 9028 |
| 167 | Ga0081539_10099835 | 3300005985 | Bacteria | 1482 |
| 168 | Ga0070717_10006689 | 3300006028 | Bacteria | 8503 |
| 169 | Ga0070717_10022168 | 3300006028 | Bacteria | 5016 |
| 170 | Ga0070717_10390069 | 3300006028 | Bacteria | 1250 |
| 171 | Ga0070715_10040498 | 3300006163 | Bacteria | 1947 |
| 172 | Ga0070716_101536883 | 3300006173 | Bacteria | 545 |
| 173 | Ga0070712_100014030 | 3300006175 | Bacteria | 5135 |
| 174 | Ga0070712_100336331 | 3300006175 | Unclassified | 1232 |
| 175 | Ga0070712_100445372 | 3300006175 | Unclassified | 1077 |
| 176 | Ga0097621_100591235 | 3300006237 | Bacteria | 1014 |
| 177 | Ga0068871_100106190 | 3300006358 | Bacteria | 2357 |
| 178 | Ga0068871_101324066 | 3300006358 | Bacteria | 678 |
| 179 | Ga0075433_10169623 | 3300006852 | Bacteria | 1942 |
| 180 | Ga0075434_100183270 | 3300006871 | Bacteria | 2114 |
| 181 | Ga0068865_100486120 | 3300006881 | Bacteria | 1027 |
| 182 | Ga0068865_101345582 | 3300006881 | Bacteria | 636 |
| 183 | Ga0097620_100056623 | 3300006931 | Bacteria | 3947 |
| 184 | Ga0099795_10001863 | 3300007788 | Bacteria | 4772 |
| 185 | Ga0099795_10594662 | 3300007788 | Bacteria | 526 |
| 186 | Ga0111539_10248008 | 3300009094 | Unclassified | 2073 |
| 187 | Ga0105245_10160675 | 3300009098 | Bacteria | 2132 |
| 188 | Ga0105245_10325073 | 3300009098 | Bacteria | 1516 |
| 189 | Ga0105245_13068283 | 3300009098 | Bacteria | 518 |
| 190 | Ga0105247_10154042 | 3300009101 | Bacteria | 1517 |
| 191 | Ga0114129_10140286 | 3300009147 | Bacteria | 3314 |
| 192 | Ga0105241_10839342 | 3300009174 | Bacteria | 849 |
| 193 | Ga0105241_11246235 | 3300009174 | Bacteria | 706 |
| 194 | Ga0105242_10118817 | 3300009176 | Bacteria | 2265 |
| 195 | Ga0105248_10177786 | 3300009177 | Bacteria | 2398 |
| 196 | Ga0105248_10449262 | 3300009177 | Bacteria | 1452 |
| 197 | Ga0105248_10611241 | 3300009177 | Bacteria | 1230 |
| 198 | Ga0105237_10086135 | 3300009545 | Bacteria | 3132 |
| 199 | Ga0105249_10017208 | 3300009553 | Bacteria | 6418 |
| 200 | Ga0105249_10137538 | 3300009553 | Bacteria | 2340 |
| 201 | Ga0105249_10350990 | 3300009553 | Bacteria | 1494 |
| 202 | Ga0099796_10021985 | 3300010159 | Bacteria | 1973 |
| 203 | Ga0099796_10127312 | 3300010159 | Bacteria | 984 |
| 204 | Ga0099796_10267695 | 3300010159 | Unclassified | 715 |
| 205 | Ga0099796_10436347 | 3300010159 | Bacteria | 580 |
| 206 | Ga0105239_10439762 | 3300010375 | Bacteria | 1479 |
| 207 | Ga0105239_10671889 | 3300010375 | Bacteria | 1184 |
| 208 | Ga0105239_11191133 | 3300010375 | Unclassified | 878 |
| 209 | Ga0105246_10125509 | 3300011119 | Bacteria | 1909 |
| 210 | Ga0105246_10565137 | 3300011119 | Bacteria | 977 |
| 211 | Ga0157328_1021225 | 3300012478 | Unclassified | 550 |
| 212 | Ga0157339_1050135 | 3300012505 | Bacteria | 550 |
| 213 | Ga0157371_10166480 | 3300013102 | Bacteria | 1574 |
| 214 | Ga0157370_10847024 | 3300013104 | Bacteria | 831 |
| 215 | Ga0157369_10322983 | 3300013105 | Bacteria | 1604 |
| 216 | Ga0157374_10089386 | 3300013296 | Bacteria | 2935 |
| 217 | Ga0157374_10126041 | 3300013296 | Bacteria | 2475 |
| 218 | Ga0157374_10132105 | 3300013296 | Bacteria | 2416 |
| 219 | Ga0157374_10404682 | 3300013296 | Bacteria | 1362 |
| 220 | Ga0157374_10631584 | 3300013296 | Bacteria | 1082 |
| 221 | Ga0157374_10652667 | 3300013296 | Bacteria | 1064 |
| 222 | Ga0157374_12338001 | 3300013296 | Unclassified | 562 |
| 223 | Ga0157378_10016502 | 3300013297 | Bacteria | 6468 |
| 224 | Ga0157378_10026782 | 3300013297 | Bacteria | 5084 |
| 225 | Ga0157378_10165834 | 3300013297 | Bacteria | 2069 |
| 226 | Ga0157378_10266414 | 3300013297 | Bacteria | 1646 |
| 227 | Ga0157378_10282552 | 3300013297 | Bacteria | 1600 |
| 228 | Ga0157378_10590495 | 3300013297 | Bacteria | 1121 |
| 229 | Ga0157378_10797283 | 3300013297 | Bacteria | 970 |
| 230 | Ga0157378_11132654 | 3300013297 | Bacteria | 820 |
| 231 | Ga0163162_10237800 | 3300013306 | Bacteria | 1952 |
| 232 | Ga0163162_10396151 | 3300013306 | Bacteria | 1513 |
| 233 | Ga0163162_11664141 | 3300013306 | Unclassified | 728 |
| 234 | Ga0163162_11857613 | 3300013306 | Unclassified | 689 |
| 235 | Ga0157372_10438836 | 3300013307 | Bacteria | 1522 |
| 236 | Ga0157375_10033405 | 3300013308 | Bacteria | 4888 |
| 237 | Ga0157375_10154772 | 3300013308 | Bacteria | 2431 |
| 238 | Ga0157375_10302946 | 3300013308 | Unclassified | 1762 |
| 239 | Ga0157375_10800363 | 3300013308 | Bacteria | 1091 |
| 240 | Ga0163163_10376579 | 3300014325 | Bacteria | 1477 |
| 241 | Ga0163163_10763526 | 3300014325 | Unclassified | 1030 |
| 242 | Ga0163163_10901763 | 3300014325 | Bacteria | 947 |
| 243 | Ga0157377_10021695 | 3300014745 | Bacteria | 3382 |
| 244 | Ga0157377_10109672 | 3300014745 | Bacteria | 1657 |
| 245 | Ga0157377_11520522 | 3300014745 | Unclassified | 533 |
| 246 | Ga0157377_11604160 | 3300014745 | Bacteria | 521 |
| 247 | Ga0157379_10007258 | 3300014968 | Bacteria | 9589 |
| 248 | Ga0157376_10038475 | 3300014969 | Bacteria | 3893 |
| 249 | Ga0157376_10439082 | 3300014969 | Bacteria | 1270 |
| 250 | Ga0157376_10683488 | 3300014969 | Bacteria | 1030 |
| 251 | Ga0157376_11328554 | 3300014969 | Bacteria | 749 |
| 252 | Ga0182006_1042580 | 3300015261 | Bacteria | 1778 |
| 253 | Ga0163161_10680101 | 3300017792 | Unclassified | 855 |
| 254 | Ga0163161_11000703 | 3300017792 | Bacteria | 714 |
| 255 | Ga0163161_11231178 | 3300017792 | Unclassified | 648 |
| 256 | Ga0163161_12091909 | 3300017792 | Unclassified | 503 |
| 257 | Ga0207666_1000279 | 3300025271 | Bacteria | 7292 |
| 258 | Ga0207673_1003496 | 3300025290 | Bacteria | 1840 |
| 259 | Ga0207673_1003587 | 3300025290 | Bacteria | 1823 |
| 260 | Ga0207673_1003690 | 3300025290 | Bacteria | 1802 |
| 261 | Ga0207697_10002160 | 3300025315 | Bacteria | 10298 |
| 262 | Ga0207697_10003050 | 3300025315 | Bacteria | 8398 |
| 263 | Ga0207697_10011161 | 3300025315 | Bacteria | 3807 |
| 264 | Ga0207697_10012565 | 3300025315 | Bacteria | 3548 |
| 265 | Ga0207697_10116820 | 3300025315 | Bacteria | 1146 |
| 266 | Ga0207697_10315536 | 3300025315 | Unclassified | 694 |
| 267 | Ga0207653_10054709 | 3300025885 | Bacteria | 1335 |
| 268 | Ga0207710_10146991 | 3300025900 | Unclassified | 1141 |
| 269 | Ga0207680_10049384 | 3300025903 | Bacteria | 2504 |
| 270 | Ga0207647_10015620 | 3300025904 | Bacteria | 5199 |
| 271 | Ga0207685_10115617 | 3300025905 | Bacteria | 1170 |
| 272 | Ga0207699_10121973 | 3300025906 | Bacteria | 1687 |
| 273 | Ga0207699_10238075 | 3300025906 | Bacteria | 1249 |
| 274 | Ga0207699_10656535 | 3300025906 | Unclassified | 766 |
| 275 | Ga0207645_10109188 | 3300025907 | Bacteria | 1790 |
| 276 | Ga0207645_10594919 | 3300025907 | Unclassified | 751 |
| 277 | Ga0207684_10003031 | 3300025910 | Bacteria | 16647 |
| 278 | Ga0207684_10099222 | 3300025910 | Bacteria | 2487 |
| 279 | Ga0207684_10141736 | 3300025910 | Bacteria | 2066 |
| 280 | Ga0207684_10819916 | 3300025910 | Unclassified | 786 |
| 281 | Ga0207654_10377543 | 3300025911 | Bacteria | 981 |
| 282 | Ga0207707_10009207 | 3300025912 | Bacteria | 8571 |
| 283 | Ga0207707_11088716 | 3300025912 | Bacteria | 652 |
| 284 | Ga0207693_10009927 | 3300025915 | Bacteria | 7739 |
| 285 | Ga0207693_10033176 | 3300025915 | Bacteria | 4074 |
| 286 | Ga0207693_10287012 | 3300025915 | Unclassified | 1289 |
| 287 | Ga0207663_10180101 | 3300025916 | Bacteria | 1508 |
| 288 | Ga0207663_10487925 | 3300025916 | Unclassified | 955 |
| 289 | Ga0207660_10033371 | 3300025917 | Bacteria | 3560 |
| 290 | Ga0207662_10054942 | 3300025918 | Bacteria | 2375 |
| 291 | Ga0207662_10131357 | 3300025918 | Bacteria | 1579 |
| 292 | Ga0207657_10095412 | 3300025919 | Bacteria | 2475 |
| 293 | Ga0207649_10029582 | 3300025920 | Bacteria | 3236 |
| 294 | Ga0207652_10219588 | 3300025921 | Bacteria | 1712 |
| 295 | Ga0207646_10030718 | 3300025922 | Unclassified | 4868 |
| 296 | Ga0207646_10060905 | 3300025922 | Bacteria | 3369 |
| 297 | Ga0207646_10367265 | 3300025922 | Unclassified | 1300 |
| 298 | Ga0207646_10475438 | 3300025922 | Bacteria | 1127 |
| 299 | Ga0207646_10598911 | 3300025922 | Bacteria | 989 |
| 300 | Ga0207681_10052599 | 3300025923 | Bacteria | 2762 |
| 301 | Ga0207650_10795974 | 3300025925 | Unclassified | 801 |
| 302 | Ga0207659_10020462 | 3300025926 | Bacteria | 4376 |
| 303 | Ga0207659_10046276 | 3300025926 | Bacteria | 3071 |
| 304 | Ga0207659_10071841 | 3300025926 | Bacteria | 2528 |
| 305 | Ga0207659_11218790 | 3300025926 | Unclassified | 647 |
| 306 | Ga0207700_10022036 | 3300025928 | Bacteria | 4364 |
| 307 | Ga0207700_10033804 | 3300025928 | Bacteria | 3662 |
| 308 | Ga0207644_10041764 | 3300025931 | Bacteria | 3247 |
| 309 | Ga0207644_10062264 | 3300025931 | Bacteria | 2705 |
| 310 | Ga0207690_10020793 | 3300025932 | Bacteria | 4060 |
| 311 | Ga0207690_10207131 | 3300025932 | Bacteria | 1493 |
| 312 | Ga0207690_10786797 | 3300025932 | Bacteria | 786 |
| 313 | Ga0207706_10213282 | 3300025933 | Bacteria | 1692 |
| 314 | Ga0207706_10439148 | 3300025933 | Bacteria | 1130 |
| 315 | Ga0207686_10228456 | 3300025934 | Bacteria | 1348 |
| 316 | Ga0207670_10126342 | 3300025936 | Bacteria | 1867 |
| 317 | Ga0207670_10420392 | 3300025936 | Bacteria | 1072 |
| 318 | Ga0207670_10897520 | 3300025936 | Bacteria | 742 |
| 319 | Ga0207669_11002167 | 3300025937 | Unclassified | 702 |
| 320 | Ga0207704_11159312 | 3300025938 | Bacteria | 658 |
| 321 | Ga0207665_10183063 | 3300025939 | Bacteria | 1518 |
| 322 | Ga0207691_10041645 | 3300025940 | Bacteria | 4239 |
| 323 | Ga0207691_10234615 | 3300025940 | Bacteria | 1588 |
| 324 | Ga0207691_10474906 | 3300025940 | Bacteria | 1063 |
| 325 | Ga0207711_10148805 | 3300025941 | Bacteria | 2112 |
| 326 | Ga0207711_10361471 | 3300025941 | Bacteria | 1345 |
| 327 | Ga0207711_10368750 | 3300025941 | Bacteria | 1331 |
| 328 | Ga0207689_10250270 | 3300025942 | Bacteria | 1465 |
| 329 | Ga0207661_10031091 | 3300025944 | Bacteria | 4119 |
| 330 | Ga0207661_10273088 | 3300025944 | Bacteria | 1509 |
| 331 | Ga0207679_10752705 | 3300025945 | Bacteria | 886 |
| 332 | Ga0207679_11023061 | 3300025945 | Bacteria | 757 |
| 333 | Ga0207651_10046799 | 3300025960 | Bacteria | 2912 |
| 334 | Ga0207651_11032082 | 3300025960 | Bacteria | 735 |
| 335 | Ga0207712_10006240 | 3300025961 | Bacteria | 7512 |
| 336 | Ga0207712_10134322 | 3300025961 | Bacteria | 1890 |
| 337 | Ga0207668_10020331 | 3300025972 | Bacteria | 4216 |
| 338 | Ga0207677_10046961 | 3300026023 | Bacteria | 2895 |
| 339 | Ga0207703_10016561 | 3300026035 | Bacteria | 5749 |
| 340 | Ga0207703_10576713 | 3300026035 | Bacteria | 1063 |
| 341 | Ga0207703_10656276 | 3300026035 | Bacteria | 995 |
| 342 | Ga0207703_11422454 | 3300026035 | Unclassified | 667 |
| 343 | Ga0207678_10009753 | 3300026067 | Bacteria | 8444 |
| 344 | Ga0207678_10059942 | 3300026067 | Bacteria | 3274 |
| 345 | Ga0207708_10015316 | 3300026075 | Bacteria | 5749 |
| 346 | Ga0207702_10086182 | 3300026078 | Bacteria | 2738 |
| 347 | Ga0207702_10704887 | 3300026078 | Bacteria | 995 |
| 348 | Ga0207641_10028509 | 3300026088 | Bacteria | 4614 |
| 349 | Ga0207641_10242020 | 3300026088 | Bacteria | 1682 |
| 350 | Ga0207676_10081849 | 3300026095 | Bacteria | 2624 |
| 351 | Ga0207676_10865195 | 3300026095 | Unclassified | 885 |
| 352 | Ga0207674_10022663 | 3300026116 | Bacteria | 6740 |
| 353 | Ga0207683_10100256 | 3300026121 | Bacteria | 2585 |
| 354 | Ga0207683_10179139 | 3300026121 | Bacteria | 1921 |
| 355 | Ga0207683_11204749 | 3300026121 | Unclassified | 702 |
| 356 | Ga0268266_10017597 | 3300028379 | Bacteria | 6095 |
| 357 | Ga0268266_10028113 | 3300028379 | Bacteria | 4781 |
| 358 | Ga0268264_10036890 | 3300028381 | Bacteria | 4028 |
| 359 | Ga0373944_0037848 | 3300035089 | Bacteria | 1480 |
| 360 | Ga0373944_0220672 | 3300035089 | Unclassified | 692 |
| 361 | Ga0373949_0170828 | 3300035090 | Unclassified | 639 |
| 362 | Ga0373945_0073149 | 3300035116 | Bacteria | 1301 |
| 363 | Ga0373945_0138852 | 3300035116 | Bacteria | 979 |
| 364 | Ga0373953_0053261 | 3300035117 | Bacteria | 1640 |
| 365 | Ga0373943_0085853 | 3300035170 | Bacteria | 1622 |
| 366 | Ga0373943_0092084 | 3300035170 | Bacteria | 1572 |
| 367 | Ga0373943_0094167 | 3300035170 | Bacteria | 1556 |
| 368 | Ga0373946_0294051 | 3300035171 | Bacteria | 802 |
| 369 | Ga0373946_0583348 | 3300035171 | Unclassified | 579 |
| 370 | Ga0373935_0049354 | 3300035692 | Bacteria | 2667 |
| 371 | Ga0373935_0085920 | 3300035692 | Bacteria | 2052 |
| 372 | Ga0373935_0267283 | 3300035692 | Bacteria | 1201 |
| 373 | Ga0373927_0360090 | 3300035695 | Bacteria | 959 |
| 374 | Ga0373927_0749326 | 3300035695 | Bacteria | 645 |
| 375 | Ga0373933_0316418 | 3300035724 | Bacteria | 1012 |
| 376 | Ga0373933_0527668 | 3300035724 | Unclassified | 774 |
| 377 | Ga0373947_0117875 | 3300035725 | Bacteria | 1684 |
| 378 | Ga0373947_0359836 | 3300035725 | Bacteria | 977 |
| 379 | Ga0373947_0859258 | 3300035725 | Unclassified | 619 |
| 380 | Ga0373937_0506818 | 3300036401 | Bacteria | 1147 |
| 381 | Ga0373925_0104927 | 3300037068 | Bacteria | 2177 |
| 382 | Ga0373925_0596356 | 3300037068 | Bacteria | 910 |
| 383 | Ga0373925_1031277 | 3300037068 | Bacteria | 677 |
| 384 | Ga0395899_0142991 | 3300037312 | Bacteria | 1701 |
| 385 | Ga0395900_0040671 | 3300037418 | Bacteria | 4791 |
| 386 | Ga0395900_0105451 | 3300037418 | Bacteria | 2896 |
| 387 | Ga0395900_0552510 | 3300037418 | Bacteria | 1096 |
| 388 | Ga0395900_0702342 | 3300037418 | Unclassified | 945 |
| 389 | Ga0395900_1057540 | 3300037418 | Bacteria | 730 |
| 390 | Ga0395900_1779021 | 3300037418 | Unclassified | 527 |
| 391 | Ga0395898_0653873 | 3300037466 | Bacteria | 994 |
| 392 | Ga0395905_0707049 | 3300037471 | Unclassified | 910 |
| 393 | Ga0395901_0023891 | 3300038443 | Bacteria | 6270 |
| 394 | Ga0395901_0254323 | 3300038443 | Bacteria | 1830 |
| 395 | Ga0451787_832899 | 3300041441 | Unclassified | 676 |
| 396 | Ga0451839_1382909 | 3300041496 | Unclassified | 605 |
| 397 | Ga0451847_0043840 | 3300041503 | Unclassified | 678 |
| 398 | Ga0439464_0111144 | 3300042439 | Unclassified | 839 |
| 399 | Ga0439460_0229869 | 3300042461 | Unclassified | 637 |
| 400 | Ga0439440_0109171 | 3300042993 | Bacteria | 760 |
| 401 | Ga0466964_0071168 | 3300044706 | Bacteria | 1471 |
| 402 | Ga0451576_0209162 | 3300045051 | Bacteria | 2037 |
| 403 | Ga0495603_0129676 | 3300046455 | Bacteria | 1469 |
| 404 | Ga0495629_0028413 | 3300046459 | Bacteria | 3971 |
| 405 | Ga0495651_0490482 | 3300046462 | Bacteria | 788 |
| 406 | Ga0495580_0191959 | 3300046472 | Bacteria | 1409 |
| 407 | Ga0495639_0049013 | 3300046475 | Bacteria | 1917 |
| 408 | Ga0495664_0044459 | 3300046477 | Bacteria | 2632 |
| 409 | Ga0495664_0270040 | 3300046477 | Bacteria | 1028 |
| 410 | Ga0495594_0358526 | 3300046499 | Bacteria | 830 |
| 411 | Ga0495608_0509963 | 3300046511 | Bacteria | 728 |
| 412 | Ga0495628_0058212 | 3300046516 | Bacteria | 3037 |
| 413 | Ga0495630_0064451 | 3300046517 | Bacteria | 2753 |
| 414 | Ga0495630_0178329 | 3300046517 | Bacteria | 1620 |
| 415 | Ga0495630_0475126 | 3300046517 | Bacteria | 958 |
| 416 | Ga0495666_0127671 | 3300046526 | Bacteria | 1189 |
| 417 | Ga0495642_0151944 | 3300046528 | Bacteria | 1002 |
| 418 | Ga0495652_0085453 | 3300046529 | Bacteria | 2592 |
| 419 | Ga0495665_0414483 | 3300046531 | Bacteria | 683 |
| 420 | Ga0495640_0071663 | 3300046533 | Bacteria | 2325 |
| 421 | Ga0495586_0160951 | 3300046535 | Bacteria | 1266 |
| 422 | Ga0495587_0057733 | 3300046536 | Bacteria | 2281 |
| 423 | Ga0495587_0194826 | 3300046536 | Bacteria | 1147 |
| 424 | Ga0495598_0039682 | 3300046537 | Bacteria | 1370 |
| 425 | Ga0495645_0147087 | 3300046543 | Bacteria | 1640 |
| 426 | Ga0495635_0129927 | 3300046663 | Bacteria | 1717 |
| 427 | Ga0495657_0380323 | 3300046675 | Unclassified | 833 |
| 428 | Ga0495657_0387066 | 3300046675 | Unclassified | 824 |
| 429 | Ga0495599_0023095 | 3300046678 | Bacteria | 3886 |
| 430 | Ga0495623_0033348 | 3300046679 | Bacteria | 3304 |
| 431 | Ga0495646_0014061 | 3300046680 | Bacteria | 5089 |
| 432 | Ga0495658_0188236 | 3300046683 | Bacteria | 1282 |
| 433 | Ga0495669_0241261 | 3300046684 | Unclassified | 867 |
| 434 | Ga0495613_0074007 | 3300046689 | Bacteria | 2481 |
| 435 | Ga0495613_0545007 | 3300046689 | Bacteria | 777 |
| 436 | Ga0495624_0390496 | 3300046690 | Bacteria | 836 |
| 437 | Ga0495670_0447717 | 3300046691 | Bacteria | 700 |
| 438 | Ga0495581_0230705 | 3300047315 | Bacteria | 1083 |
| 439 | Ga0495604_0191736 | 3300047317 | Unclassified | 1424 |
| 440 | Ga0495604_0269695 | 3300047317 | Bacteria | 1153 |
| 441 | Ga0495674_0134606 | 3300047319 | Bacteria | 2080 |
| 442 | Ga0495674_0187607 | 3300047319 | Bacteria | 1720 |
| 443 | Ga0495676_0115349 | 3300047321 | Bacteria | 1964 |
| 444 | Ga0495675_0325291 | 3300047444 | Bacteria | 909 |
| 445 | Ga0495679_154626 | 3300047446 | Bacteria | 615 |
| 446 | Ga0495684_0200892 | 3300047471 | Bacteria | 1470 |
| 447 | Ga0495684_0839449 | 3300047471 | Unclassified | 597 |
| 448 | Ga0495602_0047897 | 3300048088 | Bacteria | 3846 |
| 449 | Ga0496100_0161712 | 3300048903 | Bacteria | 1606 |
| 450 | Ga0496100_0772358 | 3300048903 | Bacteria | 752 |
| 451 | Ga0496101_0101046 | 3300048904 | Bacteria | 2159 |
| 452 | Ga0496101_0403397 | 3300048904 | Bacteria | 1077 |
| 453 | Ga0496102_0046761 | 3300048905 | Bacteria | 3931 |
| 454 | Ga0496102_0171915 | 3300048905 | Bacteria | 2040 |
| 455 | Ga0496102_0740600 | 3300048905 | Unclassified | 906 |
| 456 | Ga0496102_0861232 | 3300048905 | Bacteria | 828 |
| 457 | Ga0496103_0113423 | 3300048906 | Bacteria | 1723 |
| 458 | Ga0496104_0195153 | 3300048907 | Bacteria | 1937 |
| 459 | Ga0496104_1005614 | 3300048907 | Unclassified | 738 |
| 460 | Ga0496104_1429766 | 3300048907 | Unclassified | 595 |
| 461 | Ga0496106_1206584 | 3300048909 | Unclassified | 590 |
| 462 | Ga0496108_0032355 | 3300048911 | Unclassified | 4345 |
| 463 | Ga0496108_0132692 | 3300048911 | Unclassified | 2141 |
| 464 | Ga0496108_0903849 | 3300048911 | Bacteria | 758 |
| 465 | Ga0496109_0026304 | 3300048912 | Bacteria | 5188 |
| 466 | Ga0496109_0073767 | 3300048912 | Bacteria | 3136 |
| 467 | Ga0496109_0186322 | 3300048912 | Bacteria | 1950 |
| 468 | Ga0496109_0562107 | 3300048912 | Unclassified | 1076 |
| 469 | Ga0496110_0165372 | 3300048913 | Unclassified | 2006 |
| 470 | Ga0496110_0210911 | 3300048913 | Bacteria | 1766 |
| 471 | Ga0496111_0065476 | 3300048914 | Bacteria | 2638 |
| 472 | Ga0496111_1112241 | 3300048914 | Unclassified | 563 |
| 473 | Ga0496112_0017656 | 3300048915 | Bacteria | 6711 |
| 474 | Ga0496112_0109739 | 3300048915 | Bacteria | 2729 |
| 475 | Ga0496112_0578594 | 3300048915 | Bacteria | 1056 |
| 476 | Ga0496112_0754828 | 3300048915 | Bacteria | 899 |
| 477 | Ga0496113_0013643 | 3300048916 | Bacteria | 5515 |
| 478 | Ga0496114_0011578 | 3300048917 | Bacteria | 7049 |
| 479 | Ga0496115_0134167 | 3300048918 | Bacteria | 2041 |
| 480 | Ga0496115_0204507 | 3300048918 | Bacteria | 1631 |
| 481 | nmdc:mga05p37_442166_c1 | 3300050507 | Bacteria | 1507 |
| 482 | nmdc:mga06r32_1500395_c1 | 3300050510 | Unclassified | 614 |
| 483 | nmdc:mga08y16_361070_c1 | 3300050511 | Unclassified | 1491 |
| 484 | nmdc:mga0n895_112184_c1 | 3300050512 | Bacteria | 2743 |
| 485 | nmdc:mga0rr50_379147_c1 | 3300050513 | Unclassified | 1192 |
| 486 | nmdc:mga08x19_1341863_c1 | 3300050514 | Unclassified | 506 |
| 487 | nmdc:mga0a205_141552_c1 | 3300050515 | Bacteria | 2305 |
| 488 | nmdc:mga0a205_334582_c1 | 3300050515 | Bacteria | 1383 |
| 489 | Ga0495601_0267372 | 3300053077 | Bacteria | 1116 |
| 490 | Ga0495595_0120285 | 3300053084 | Bacteria | 1279 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100249690 | Ga0070708_1002496902 | 143 |
| 2 | 3300005518 | Ga0070699_100707366 | Ga0070699_1007073662 | 143 |
| 3 | 3300005536 | Ga0070697_100236379 | Ga0070697_1002363793 | 143 |
| 4 | 3300005289 | Ga0065704_10044063 | Ga0065704_100440632 | 146 |
| 5 | 3300005295 | Ga0065707_10000986 | Ga0065707_100009869 | 146 |
| 6 | 3300005347 | Ga0070668_100694734 | Ga0070668_1006947341 | 146 |
| 7 | 3300005434 | Ga0070709_10621554 | Ga0070709_106215541 | 146 |
| 8 | 3300005439 | Ga0070711_100017632 | Ga0070711_1000176326 | 146 |
| 9 | 3300005457 | Ga0070662_100139986 | Ga0070662_1001399862 | 146 |
| 10 | 3300005467 | Ga0070706_100180367 | Ga0070706_1001803673 | 146 |
| 11 | 3300005985 | Ga0081539_10008376 | Ga0081539_100083766 | 146 |
| 12 | 3300006175 | Ga0070712_100014030 | Ga0070712_1000140304 | 146 |
| 13 | 3300009094 | Ga0111539_10248008 | Ga0111539_102480082 | 146 |
| 14 | 3300013102 | Ga0157371_10166480 | Ga0157371_101664802 | 146 |
| 15 | 3300017792 | Ga0163161_12091909 | Ga0163161_120919091 | 146 |
| 16 | 3300025906 | Ga0207699_10121973 | Ga0207699_101219734 | 146 |
| 17 | 3300025915 | Ga0207693_10009927 | Ga0207693_100099278 | 146 |
| 18 | 3300025916 | Ga0207663_10180101 | Ga0207663_101801012 | 146 |
| 19 | 3300025926 | Ga0207659_11218790 | Ga0207659_112187901 | 146 |
| 20 | 3300025940 | Ga0207691_10234615 | Ga0207691_102346153 | 146 |
| 21 | 3300026121 | Ga0207683_11204749 | Ga0207683_112047492 | 146 |
| 22 | 3300035089 | Ga0373944_0220672 | Ga0373944_0220672_114_554 | 146 |
| 23 | 3300035170 | Ga0373943_0085853 | Ga0373943_0085853_733_1173 | 146 |
| 24 | 3300035171 | Ga0373946_0583348 | Ga0373946_0583348_53_493 | 146 |
| 25 | 3300035725 | Ga0373947_0859258 | Ga0373947_0859258_152_592 | 146 |
| 26 | 3300046472 | Ga0495580_0191959 | Ga0495580_0191959_260_700 | 146 |
| 27 | 3300046528 | Ga0495642_0151944 | Ga0495642_0151944_417_857 | 146 |
| 28 | 3300046537 | Ga0495598_0039682 | Ga0495598_0039682_192_632 | 146 |
| 29 | 3300048903 | Ga0496100_0161712 | Ga0496100_0161712_322_762 | 146 |
| 30 | 3300048905 | Ga0496102_0740600 | Ga0496102_0740600_14_454 | 146 |
| 31 | 3300050511 | nmdc:mga08y16_361070_c1 | nmdc:mga08y16_361070_c1_557_997 | 146 |
| 32 | 3300005289 | Ga0065704_10455190 | Ga0065704_104551901 | 147 |
| 33 | 3300005290 | Ga0065712_10313863 | Ga0065712_103138632 | 147 |
| 34 | 3300005293 | Ga0065715_10245587 | Ga0065715_102455872 | 147 |
| 35 | 3300005295 | Ga0065707_11025741 | Ga0065707_110257411 | 147 |
| 36 | 3300005340 | Ga0070689_100267926 | Ga0070689_1002679262 | 147 |
| 37 | 3300005353 | Ga0070669_100021292 | Ga0070669_1000212922 | 147 |
| 38 | 3300005354 | Ga0070675_100205149 | Ga0070675_1002051493 | 147 |
| 39 | 3300005364 | Ga0070673_101895253 | Ga0070673_1018952531 | 147 |
| 40 | 3300005435 | Ga0070714_100235077 | Ga0070714_1002350772 | 147 |
| 41 | 3300005436 | Ga0070713_100073337 | Ga0070713_1000733374 | 147 |
| 42 | 3300005440 | Ga0070705_100141657 | Ga0070705_1001416573 | 147 |
| 43 | 3300005467 | Ga0070706_100846029 | Ga0070706_1008460292 | 147 |
| 44 | 3300005468 | Ga0070707_100007862 | Ga0070707_1000078625 | 147 |
| 45 | 3300005471 | Ga0070698_100006750 | Ga0070698_1000067506 | 147 |
| 46 | 3300005536 | Ga0070697_100228151 | Ga0070697_1002281513 | 147 |
| 47 | 3300005536 | Ga0070697_100613106 | Ga0070697_1006131061 | 147 |
| 48 | 3300005543 | Ga0070672_100603692 | Ga0070672_1006036922 | 147 |
| 49 | 3300005545 | Ga0070695_100037100 | Ga0070695_1000371005 | 147 |
| 50 | 3300005577 | Ga0068857_100022369 | Ga0068857_1000223696 | 147 |
| 51 | 3300005577 | Ga0068857_100568895 | Ga0068857_1005688952 | 147 |
| 52 | 3300005614 | Ga0068856_100735089 | Ga0068856_1007350892 | 147 |
| 53 | 3300006028 | Ga0070717_10006689 | Ga0070717_1000668911 | 147 |
| 54 | 3300006028 | Ga0070717_10390069 | Ga0070717_103900693 | 147 |
| 55 | 3300006881 | Ga0068865_101345582 | Ga0068865_1013455821 | 147 |
| 56 | 3300009098 | Ga0105245_13068283 | Ga0105245_130682831 | 147 |
| 57 | 3300013296 | Ga0157374_12338001 | Ga0157374_123380011 | 147 |
| 58 | 3300013297 | Ga0157378_10797283 | Ga0157378_107972832 | 147 |
| 59 | 3300013306 | Ga0163162_10237800 | Ga0163162_102378001 | 147 |
| 60 | 3300013308 | Ga0157375_10800363 | Ga0157375_108003632 | 147 |
| 61 | 3300014745 | Ga0157377_11604160 | Ga0157377_116041601 | 147 |
| 62 | 3300025922 | Ga0207646_10060905 | Ga0207646_100609056 | 147 |
| 63 | 3300025923 | Ga0207681_10052599 | Ga0207681_100525994 | 147 |
| 64 | 3300025928 | Ga0207700_10033804 | Ga0207700_100338044 | 147 |
| 65 | 3300025938 | Ga0207704_11159312 | Ga0207704_111593122 | 147 |
| 66 | 3300025940 | Ga0207691_10474906 | Ga0207691_104749061 | 147 |
| 67 | 3300026035 | Ga0207703_10576713 | Ga0207703_105767132 | 147 |
| 68 | 3300026078 | Ga0207702_10704887 | Ga0207702_107048872 | 147 |
| 69 | 3300026116 | Ga0207674_10022663 | Ga0207674_100226635 | 147 |
| 70 | 3300035090 | Ga0373949_0170828 | Ga0373949_0170828_58_501 | 147 |
| 71 | 3300035170 | Ga0373943_0094167 | Ga0373943_0094167_77_520 | 147 |
| 72 | 3300035692 | Ga0373935_0049354 | Ga0373935_0049354_1823_2266 | 147 |
| 73 | 3300035692 | Ga0373935_0267283 | Ga0373935_0267283_52_495 | 147 |
| 74 | 3300035724 | Ga0373933_0527668 | Ga0373933_0527668_175_618 | 147 |
| 75 | 3300037068 | Ga0373925_1031277 | Ga0373925_1031277_83_526 | 147 |
| 76 | 3300037312 | Ga0395899_0142991 | Ga0395899_0142991_1082_1549 | 147 |
| 77 | 3300037418 | Ga0395900_0040671 | Ga0395900_0040671_2503_2970 | 147 |
| 78 | 3300037466 | Ga0395898_0653873 | Ga0395898_0653873_308_775 | 147 |
| 79 | 3300037471 | Ga0395905_0707049 | Ga0395905_0707049_258_725 | 147 |
| 80 | 3300038443 | Ga0395901_0023891 | Ga0395901_0023891_5735_6202 | 147 |
| 81 | 3300003911 | JGI25405J52794_10153732 | JGI25405J52794_101537321 | 148 |
| 82 | 3300005290 | Ga0065712_10423776 | Ga0065712_104237762 | 148 |
| 83 | 3300005328 | Ga0070676_10266277 | Ga0070676_102662772 | 148 |
| 84 | 3300005354 | Ga0070675_100346512 | Ga0070675_1003465123 | 148 |
| 85 | 3300005355 | Ga0070671_100228507 | Ga0070671_1002285072 | 148 |
| 86 | 3300005364 | Ga0070673_101327376 | Ga0070673_1013273761 | 148 |
| 87 | 3300005367 | Ga0070667_100302667 | Ga0070667_1003026672 | 148 |
| 88 | 3300005456 | Ga0070678_100973604 | Ga0070678_1009736042 | 148 |
| 89 | 3300005549 | Ga0070704_101524229 | Ga0070704_1015242292 | 148 |
| 90 | 3300005937 | Ga0081455_10006446 | Ga0081455_1000644615 | 148 |
| 91 | 3300005937 | Ga0081455_10010873 | Ga0081455_100108735 | 148 |
| 92 | 3300010159 | Ga0099796_10436347 | Ga0099796_104363471 | 148 |
| 93 | 3300013296 | Ga0157374_10631584 | Ga0157374_106315842 | 148 |
| 94 | 3300013296 | Ga0157374_10652667 | Ga0157374_106526672 | 148 |
| 95 | 3300013297 | Ga0157378_10282552 | Ga0157378_102825523 | 148 |
| 96 | 3300013297 | Ga0157378_11132654 | Ga0157378_111326542 | 148 |
| 97 | 3300013306 | Ga0163162_11857613 | Ga0163162_118576132 | 148 |
| 98 | 3300013308 | Ga0157375_10302946 | Ga0157375_103029461 | 148 |
| 99 | 3300025315 | Ga0207697_10116820 | Ga0207697_101168202 | 148 |
| 100 | 3300025925 | Ga0207650_10795974 | Ga0207650_107959742 | 148 |
| 101 | 3300025936 | Ga0207670_10897520 | Ga0207670_108975202 | 148 |
| 102 | 3300025945 | Ga0207679_11023061 | Ga0207679_110230612 | 148 |
| 103 | 3300026121 | Ga0207683_10100256 | Ga0207683_101002564 | 148 |
| 104 | 3300035116 | Ga0373945_0138852 | Ga0373945_0138852_278_724 | 148 |
| 105 | 3300035170 | Ga0373943_0092084 | Ga0373943_0092084_161_607 | 148 |
| 106 | 3300035692 | Ga0373935_0085920 | Ga0373935_0085920_1424_1870 | 148 |
| 107 | 3300035695 | Ga0373927_0360090 | Ga0373927_0360090_183_629 | 148 |
| 108 | 3300037068 | Ga0373925_0104927 | Ga0373925_0104927_387_833 | 148 |
| 109 | 3300037418 | Ga0395900_0702342 | Ga0395900_0702342_373_822 | 148 |
| 110 | 3300037418 | Ga0395900_1779021 | Ga0395900_1779021_36_485 | 148 |
| 111 | 3300038443 | Ga0395901_0254323 | Ga0395901_0254323_1070_1519 | 148 |
| 112 | 3300048907 | Ga0496104_1005614 | Ga0496104_1005614_70_519 | 148 |
| 113 | 3300048911 | Ga0496108_0132692 | Ga0496108_0132692_980_1429 | 148 |
| 114 | 3300048912 | Ga0496109_0186322 | Ga0496109_0186322_166_615 | 148 |
| 115 | 3300048914 | Ga0496111_1112241 | Ga0496111_1112241_25_474 | 148 |
| 116 | 3300048915 | Ga0496112_0017656 | Ga0496112_0017656_3854_4303 | 148 |
| 117 | 3300048915 | Ga0496112_0109739 | Ga0496112_0109739_1686_2135 | 148 |
| 118 | 3300050514 | nmdc:mga08x19_1341863_c1 | nmdc:mga08x19_1341863_c1_40_486 | 148 |
| 119 | 3300003203 | JGI25406J46586_10240930 | JGI25406J46586_102409301 | 149 |
| 120 | 3300005467 | Ga0070706_100224719 | Ga0070706_1002247194 | 149 |
| 121 | 3300005467 | Ga0070706_101371105 | Ga0070706_1013711052 | 149 |
| 122 | 3300005471 | Ga0070698_100575820 | Ga0070698_1005758202 | 149 |
| 123 | 3300005471 | Ga0070698_100905225 | Ga0070698_1009052251 | 149 |
| 124 | 3300005518 | Ga0070699_101251460 | Ga0070699_1012514601 | 149 |
| 125 | 3300005536 | Ga0070697_100300940 | Ga0070697_1003009403 | 149 |
| 126 | 3300005536 | Ga0070697_101116269 | Ga0070697_1011162692 | 149 |
| 127 | 3300005937 | Ga0081455_10021810 | Ga0081455_100218107 | 149 |
| 128 | 3300005983 | Ga0081540_1069915 | Ga0081540_10699152 | 149 |
| 129 | 3300005985 | Ga0081539_10099835 | Ga0081539_100998352 | 149 |
| 130 | 3300006852 | Ga0075433_10169623 | Ga0075433_101696234 | 149 |
| 131 | 3300006871 | Ga0075434_100183270 | Ga0075434_1001832702 | 149 |
| 132 | 3300009147 | Ga0114129_10140286 | Ga0114129_101402862 | 149 |
| 133 | 3300025910 | Ga0207684_10099222 | Ga0207684_100992223 | 149 |
| 134 | 3300025910 | Ga0207684_10819916 | Ga0207684_108199162 | 149 |
| 135 | 3300042439 | Ga0439464_0111144 | Ga0439464_0111144_319_768 | 149 |
| 136 | 3300042461 | Ga0439460_0229869 | Ga0439460_0229869_159_608 | 149 |
| 137 | 3300042993 | Ga0439440_0109171 | Ga0439440_0109171_158_607 | 149 |
| 138 | 3300050507 | nmdc:mga05p37_442166_c1 | nmdc:mga05p37_442166_c1_46_495 | 149 |
| 139 | 3300050512 | nmdc:mga0n895_112184_c1 | nmdc:mga0n895_112184_c1_2089_2628 | 149 |
| 140 | 3300050515 | nmdc:mga0a205_141552_c1 | nmdc:mga0a205_141552_c1_127_666 | 149 |
| 141 | 2162886007 | SwRhRL2b_contig_1298596 | SwRhRL2b_0211.00007770 | 150 |
| 142 | 2162886007 | SwRhRL2b_contig_2531808 | SwRhRL2b_0148.00002910 | 150 |
| 143 | 2162886007 | SwRhRL2b_contig_3073330 | SwRhRL2b_0998.00007780 | 150 |
| 144 | 3300001991 | JGI24743J22301_10009542 | JGI24743J22301_100095422 | 150 |
| 145 | 3300002126 | JGI24035J26624_1001177 | JGI24035J26624_10011772 | 150 |
| 146 | 3300003203 | JGI25406J46586_10000005 | JGI25406J46586_1000000549 | 150 |
| 147 | 3300005288 | Ga0065714_10127204 | Ga0065714_101272042 | 150 |
| 148 | 3300005289 | Ga0065704_10393187 | Ga0065704_103931871 | 150 |
| 149 | 3300005290 | Ga0065712_10001986 | Ga0065712_100019866 | 150 |
| 150 | 3300005290 | Ga0065712_10003070 | Ga0065712_100030708 | 150 |
| 151 | 3300005290 | Ga0065712_10008286 | Ga0065712_100082864 | 150 |
| 152 | 3300005290 | Ga0065712_10010351 | Ga0065712_100103515 | 150 |
| 153 | 3300005290 | Ga0065712_10207420 | Ga0065712_102074202 | 150 |
| 154 | 3300005293 | Ga0065715_10002225 | Ga0065715_1000222514 | 150 |
| 155 | 3300005293 | Ga0065715_10008128 | Ga0065715_100081286 | 150 |
| 156 | 3300005293 | Ga0065715_10095299 | Ga0065715_100952993 | 150 |
| 157 | 3300005293 | Ga0065715_10104559 | Ga0065715_101045593 | 150 |
| 158 | 3300005293 | Ga0065715_10251641 | Ga0065715_102516412 | 150 |
| 159 | 3300005295 | Ga0065707_10197703 | Ga0065707_101977031 | 150 |
| 160 | 3300005295 | Ga0065707_11141255 | Ga0065707_111412551 | 150 |
| 161 | 3300005327 | Ga0070658_10197883 | Ga0070658_101978833 | 150 |
| 162 | 3300005328 | Ga0070676_10521905 | Ga0070676_105219051 | 150 |
| 163 | 3300005329 | Ga0070683_100016071 | Ga0070683_1000160717 | 150 |
| 164 | 3300005329 | Ga0070683_100257033 | Ga0070683_1002570333 | 150 |
| 165 | 3300005329 | Ga0070683_100298340 | Ga0070683_1002983402 | 150 |
| 166 | 3300005330 | Ga0070690_100125605 | Ga0070690_1001256051 | 150 |
| 167 | 3300005331 | Ga0070670_101170903 | Ga0070670_1011709032 | 150 |
| 168 | 3300005335 | Ga0070666_10047952 | Ga0070666_100479524 | 150 |
| 169 | 3300005335 | Ga0070666_10230446 | Ga0070666_102304462 | 150 |
| 170 | 3300005336 | Ga0070680_100036859 | Ga0070680_1000368592 | 150 |
| 171 | 3300005337 | Ga0070682_100274712 | Ga0070682_1002747122 | 150 |
| 172 | 3300005337 | Ga0070682_100380571 | Ga0070682_1003805712 | 150 |
| 173 | 3300005337 | Ga0070682_100829150 | Ga0070682_1008291501 | 150 |
| 174 | 3300005338 | Ga0068868_100192461 | Ga0068868_1001924613 | 150 |
| 175 | 3300005338 | Ga0068868_100352890 | Ga0068868_1003528902 | 150 |
| 176 | 3300005339 | Ga0070660_100533670 | Ga0070660_1005336702 | 150 |
| 177 | 3300005339 | Ga0070660_100660209 | Ga0070660_1006602092 | 150 |
| 178 | 3300005340 | Ga0070689_100058807 | Ga0070689_1000588073 | 150 |
| 179 | 3300005343 | Ga0070687_100044097 | Ga0070687_1000440973 | 150 |
| 180 | 3300005343 | Ga0070687_100366108 | Ga0070687_1003661082 | 150 |
| 181 | 3300005344 | Ga0070661_100035685 | Ga0070661_1000356853 | 150 |
| 182 | 3300005344 | Ga0070661_100051358 | Ga0070661_1000513587 | 150 |
| 183 | 3300005344 | Ga0070661_100706171 | Ga0070661_1007061711 | 150 |
| 184 | 3300005347 | Ga0070668_100032496 | Ga0070668_1000324964 | 150 |
| 185 | 3300005353 | Ga0070669_100644662 | Ga0070669_1006446622 | 150 |
| 186 | 3300005354 | Ga0070675_100047008 | Ga0070675_1000470082 | 150 |
| 187 | 3300005354 | Ga0070675_100058494 | Ga0070675_1000584943 | 150 |
| 188 | 3300005354 | Ga0070675_101359315 | Ga0070675_1013593151 | 150 |
| 189 | 3300005355 | Ga0070671_100704999 | Ga0070671_1007049992 | 150 |
| 190 | 3300005364 | Ga0070673_100298548 | Ga0070673_1002985482 | 150 |
| 191 | 3300005365 | Ga0070688_100018024 | Ga0070688_1000180242 | 150 |
| 192 | 3300005365 | Ga0070688_100046793 | Ga0070688_1000467934 | 150 |
| 193 | 3300005365 | Ga0070688_100061581 | Ga0070688_1000615815 | 150 |
| 194 | 3300005366 | Ga0070659_100002685 | Ga0070659_1000026856 | 150 |
| 195 | 3300005366 | Ga0070659_100290011 | Ga0070659_1002900112 | 150 |
| 196 | 3300005434 | Ga0070709_10092908 | Ga0070709_100929083 | 150 |
| 197 | 3300005435 | Ga0070714_100108519 | Ga0070714_1001085192 | 150 |
| 198 | 3300005437 | Ga0070710_10454869 | Ga0070710_104548692 | 150 |
| 199 | 3300005437 | Ga0070710_10700303 | Ga0070710_107003031 | 150 |
| 200 | 3300005438 | Ga0070701_10032536 | Ga0070701_100325363 | 150 |
| 201 | 3300005439 | Ga0070711_100108591 | Ga0070711_1001085911 | 150 |
| 202 | 3300005439 | Ga0070711_100237604 | Ga0070711_1002376042 | 150 |
| 203 | 3300005439 | Ga0070711_101578197 | Ga0070711_1015781971 | 150 |
| 204 | 3300005440 | Ga0070705_100041828 | Ga0070705_1000418282 | 150 |
| 205 | 3300005441 | Ga0070700_100064071 | Ga0070700_1000640713 | 150 |
| 206 | 3300005444 | Ga0070694_100085835 | Ga0070694_1000858352 | 150 |
| 207 | 3300005445 | Ga0070708_100019967 | Ga0070708_1000199679 | 150 |
| 208 | 3300005445 | Ga0070708_100036148 | Ga0070708_1000361485 | 150 |
| 209 | 3300005445 | Ga0070708_100193057 | Ga0070708_1001930572 | 150 |
| 210 | 3300005445 | Ga0070708_101615989 | Ga0070708_1016159891 | 150 |
| 211 | 3300005455 | Ga0070663_100048566 | Ga0070663_1000485663 | 150 |
| 212 | 3300005455 | Ga0070663_100633945 | Ga0070663_1006339452 | 150 |
| 213 | 3300005456 | Ga0070678_100079673 | Ga0070678_1000796732 | 150 |
| 214 | 3300005456 | Ga0070678_100215059 | Ga0070678_1002150592 | 150 |
| 215 | 3300005457 | Ga0070662_100378082 | Ga0070662_1003780822 | 150 |
| 216 | 3300005458 | Ga0070681_10013048 | Ga0070681_100130487 | 150 |
| 217 | 3300005466 | Ga0070685_10002918 | Ga0070685_100029189 | 150 |
| 218 | 3300005466 | Ga0070685_10234773 | Ga0070685_102347731 | 150 |
| 219 | 3300005466 | Ga0070685_10306022 | Ga0070685_103060221 | 150 |
| 220 | 3300005467 | Ga0070706_100032564 | Ga0070706_1000325644 | 150 |
| 221 | 3300005467 | Ga0070706_100048900 | Ga0070706_1000489006 | 150 |
| 222 | 3300005468 | Ga0070707_100347103 | Ga0070707_1003471032 | 150 |
| 223 | 3300005530 | Ga0070679_100038018 | Ga0070679_1000380184 | 150 |
| 224 | 3300005535 | Ga0070684_100002414 | Ga0070684_1000024148 | 150 |
| 225 | 3300005535 | Ga0070684_100032889 | Ga0070684_1000328895 | 150 |
| 226 | 3300005535 | Ga0070684_100077513 | Ga0070684_1000775131 | 150 |
| 227 | 3300005535 | Ga0070684_100738406 | Ga0070684_1007384061 | 150 |
| 228 | 3300005535 | Ga0070684_101400266 | Ga0070684_1014002661 | 150 |
| 229 | 3300005536 | Ga0070697_100005127 | Ga0070697_10000512713 | 150 |
| 230 | 3300005536 | Ga0070697_100268979 | Ga0070697_1002689793 | 150 |
| 231 | 3300005543 | Ga0070672_100040678 | Ga0070672_1000406783 | 150 |
| 232 | 3300005544 | Ga0070686_100016744 | Ga0070686_1000167441 | 150 |
| 233 | 3300005544 | Ga0070686_100042514 | Ga0070686_1000425144 | 150 |
| 234 | 3300005548 | Ga0070665_100028026 | Ga0070665_1000280265 | 150 |
| 235 | 3300005548 | Ga0070665_100063641 | Ga0070665_1000636412 | 150 |
| 236 | 3300005548 | Ga0070665_101588076 | Ga0070665_1015880762 | 150 |
| 237 | 3300005549 | Ga0070704_100393090 | Ga0070704_1003930902 | 150 |
| 238 | 3300005563 | Ga0068855_100773895 | Ga0068855_1007738952 | 150 |
| 239 | 3300005564 | Ga0070664_100203268 | Ga0070664_1002032681 | 150 |
| 240 | 3300005564 | Ga0070664_100792022 | Ga0070664_1007920222 | 150 |
| 241 | 3300005577 | Ga0068857_100536495 | Ga0068857_1005364952 | 150 |
| 242 | 3300005614 | Ga0068856_100086333 | Ga0068856_1000863333 | 150 |
| 243 | 3300005614 | Ga0068856_100706219 | Ga0068856_1007062191 | 150 |
| 244 | 3300005616 | Ga0068852_101280297 | Ga0068852_1012802972 | 150 |
| 245 | 3300005617 | Ga0068859_100056621 | Ga0068859_1000566213 | 150 |
| 246 | 3300005840 | Ga0068870_10713563 | Ga0068870_107135632 | 150 |
| 247 | 3300005841 | Ga0068863_100059451 | Ga0068863_1000594514 | 150 |
| 248 | 3300005841 | Ga0068863_100074687 | Ga0068863_1000746877 | 150 |
| 249 | 3300005841 | Ga0068863_101067514 | Ga0068863_1010675142 | 150 |
| 250 | 3300005842 | Ga0068858_100021640 | Ga0068858_1000216405 | 150 |
| 251 | 3300005842 | Ga0068858_100759315 | Ga0068858_1007593152 | 150 |
| 252 | 3300005937 | Ga0081455_10517902 | Ga0081455_105179021 | 150 |
| 253 | 3300005985 | Ga0081539_10000026 | Ga0081539_10000026255 | 150 |
| 254 | 3300006028 | Ga0070717_10022168 | Ga0070717_100221684 | 150 |
| 255 | 3300006163 | Ga0070715_10040498 | Ga0070715_100404982 | 150 |
| 256 | 3300006173 | Ga0070716_101536883 | Ga0070716_1015368831 | 150 |
| 257 | 3300006175 | Ga0070712_100336331 | Ga0070712_1003363311 | 150 |
| 258 | 3300006175 | Ga0070712_100445372 | Ga0070712_1004453722 | 150 |
| 259 | 3300006237 | Ga0097621_100591235 | Ga0097621_1005912352 | 150 |
| 260 | 3300006358 | Ga0068871_100106190 | Ga0068871_1001061903 | 150 |
| 261 | 3300006358 | Ga0068871_101324066 | Ga0068871_1013240662 | 150 |
| 262 | 3300006881 | Ga0068865_100486120 | Ga0068865_1004861202 | 150 |
| 263 | 3300006931 | Ga0097620_100056623 | Ga0097620_1000566233 | 150 |
| 264 | 3300007788 | Ga0099795_10001863 | Ga0099795_100018635 | 150 |
| 265 | 3300007788 | Ga0099795_10594662 | Ga0099795_105946621 | 150 |
| 266 | 3300009098 | Ga0105245_10160675 | Ga0105245_101606752 | 150 |
| 267 | 3300009098 | Ga0105245_10325073 | Ga0105245_103250732 | 150 |
| 268 | 3300009101 | Ga0105247_10154042 | Ga0105247_101540423 | 150 |
| 269 | 3300009174 | Ga0105241_10839342 | Ga0105241_108393422 | 150 |
| 270 | 3300009174 | Ga0105241_11246235 | Ga0105241_112462351 | 150 |
| 271 | 3300009176 | Ga0105242_10118817 | Ga0105242_101188175 | 150 |
| 272 | 3300009177 | Ga0105248_10177786 | Ga0105248_101777863 | 150 |
| 273 | 3300009177 | Ga0105248_10449262 | Ga0105248_104492622 | 150 |
| 274 | 3300009177 | Ga0105248_10611241 | Ga0105248_106112412 | 150 |
| 275 | 3300009545 | Ga0105237_10086135 | Ga0105237_100861353 | 150 |
| 276 | 3300009553 | Ga0105249_10017208 | Ga0105249_100172082 | 150 |
| 277 | 3300009553 | Ga0105249_10137538 | Ga0105249_101375383 | 150 |
| 278 | 3300009553 | Ga0105249_10350990 | Ga0105249_103509902 | 150 |
| 279 | 3300010159 | Ga0099796_10021985 | Ga0099796_100219852 | 150 |
| 280 | 3300010159 | Ga0099796_10127312 | Ga0099796_101273122 | 150 |
| 281 | 3300010159 | Ga0099796_10267695 | Ga0099796_102676952 | 150 |
| 282 | 3300010375 | Ga0105239_10439762 | Ga0105239_104397622 | 150 |
| 283 | 3300010375 | Ga0105239_10671889 | Ga0105239_106718892 | 150 |
| 284 | 3300010375 | Ga0105239_11191133 | Ga0105239_111911331 | 150 |
| 285 | 3300011119 | Ga0105246_10125509 | Ga0105246_101255092 | 150 |
| 286 | 3300011119 | Ga0105246_10565137 | Ga0105246_105651372 | 150 |
| 287 | 3300012478 | Ga0157328_1021225 | Ga0157328_10212251 | 150 |
| 288 | 3300012505 | Ga0157339_1050135 | Ga0157339_10501351 | 150 |
| 289 | 3300013104 | Ga0157370_10847024 | Ga0157370_108470242 | 150 |
| 290 | 3300013105 | Ga0157369_10322983 | Ga0157369_103229832 | 150 |
| 291 | 3300013296 | Ga0157374_10089386 | Ga0157374_100893861 | 150 |
| 292 | 3300013296 | Ga0157374_10126041 | Ga0157374_101260413 | 150 |
| 293 | 3300013296 | Ga0157374_10132105 | Ga0157374_101321051 | 150 |
| 294 | 3300013296 | Ga0157374_10404682 | Ga0157374_104046823 | 150 |
| 295 | 3300013297 | Ga0157378_10016502 | Ga0157378_100165024 | 150 |
| 296 | 3300013297 | Ga0157378_10026782 | Ga0157378_100267824 | 150 |
| 297 | 3300013297 | Ga0157378_10165834 | Ga0157378_101658343 | 150 |
| 298 | 3300013297 | Ga0157378_10266414 | Ga0157378_102664141 | 150 |
| 299 | 3300013297 | Ga0157378_10590495 | Ga0157378_105904952 | 150 |
| 300 | 3300013306 | Ga0163162_10396151 | Ga0163162_103961512 | 150 |
| 301 | 3300013306 | Ga0163162_11664141 | Ga0163162_116641411 | 150 |
| 302 | 3300013307 | Ga0157372_10438836 | Ga0157372_104388362 | 150 |
| 303 | 3300013308 | Ga0157375_10033405 | Ga0157375_100334054 | 150 |
| 304 | 3300013308 | Ga0157375_10154772 | Ga0157375_101547722 | 150 |
| 305 | 3300014325 | Ga0163163_10376579 | Ga0163163_103765793 | 150 |
| 306 | 3300014325 | Ga0163163_10763526 | Ga0163163_107635262 | 150 |
| 307 | 3300014325 | Ga0163163_10901763 | Ga0163163_109017632 | 150 |
| 308 | 3300014745 | Ga0157377_10021695 | Ga0157377_100216954 | 150 |
| 309 | 3300014745 | Ga0157377_10109672 | Ga0157377_101096723 | 150 |
| 310 | 3300014745 | Ga0157377_11520522 | Ga0157377_115205221 | 150 |
| 311 | 3300014968 | Ga0157379_10007258 | Ga0157379_100072587 | 150 |
| 312 | 3300014969 | Ga0157376_10038475 | Ga0157376_100384753 | 150 |
| 313 | 3300014969 | Ga0157376_10439082 | Ga0157376_104390822 | 150 |
| 314 | 3300014969 | Ga0157376_10683488 | Ga0157376_106834882 | 150 |
| 315 | 3300014969 | Ga0157376_11328554 | Ga0157376_113285541 | 150 |
| 316 | 3300015261 | Ga0182006_1042580 | Ga0182006_10425803 | 150 |
| 317 | 3300017792 | Ga0163161_10680101 | Ga0163161_106801011 | 150 |
| 318 | 3300017792 | Ga0163161_11000703 | Ga0163161_110007031 | 150 |
| 319 | 3300017792 | Ga0163161_11231178 | Ga0163161_112311781 | 150 |
| 320 | 3300025271 | Ga0207666_1000279 | Ga0207666_10002798 | 150 |
| 321 | 3300025290 | Ga0207673_1003496 | Ga0207673_10034962 | 150 |
| 322 | 3300025290 | Ga0207673_1003587 | Ga0207673_10035873 | 150 |
| 323 | 3300025290 | Ga0207673_1003690 | Ga0207673_10036903 | 150 |
| 324 | 3300025315 | Ga0207697_10002160 | Ga0207697_100021608 | 150 |
| 325 | 3300025315 | Ga0207697_10003050 | Ga0207697_1000305010 | 150 |
| 326 | 3300025315 | Ga0207697_10011161 | Ga0207697_100111614 | 150 |
| 327 | 3300025315 | Ga0207697_10012565 | Ga0207697_100125654 | 150 |
| 328 | 3300025315 | Ga0207697_10315536 | Ga0207697_103155362 | 150 |
| 329 | 3300025885 | Ga0207653_10054709 | Ga0207653_100547091 | 150 |
| 330 | 3300025900 | Ga0207710_10146991 | Ga0207710_101469911 | 150 |
| 331 | 3300025903 | Ga0207680_10049384 | Ga0207680_100493843 | 150 |
| 332 | 3300025904 | Ga0207647_10015620 | Ga0207647_100156204 | 150 |
| 333 | 3300025905 | Ga0207685_10115617 | Ga0207685_101156172 | 150 |
| 334 | 3300025906 | Ga0207699_10238075 | Ga0207699_102380752 | 150 |
| 335 | 3300025906 | Ga0207699_10656535 | Ga0207699_106565351 | 150 |
| 336 | 3300025907 | Ga0207645_10109188 | Ga0207645_101091884 | 150 |
| 337 | 3300025907 | Ga0207645_10594919 | Ga0207645_105949191 | 150 |
| 338 | 3300025910 | Ga0207684_10003031 | Ga0207684_1000303117 | 150 |
| 339 | 3300025910 | Ga0207684_10141736 | Ga0207684_101417362 | 150 |
| 340 | 3300025911 | Ga0207654_10377543 | Ga0207654_103775432 | 150 |
| 341 | 3300025912 | Ga0207707_10009207 | Ga0207707_100092078 | 150 |
| 342 | 3300025912 | Ga0207707_11088716 | Ga0207707_110887162 | 150 |
| 343 | 3300025915 | Ga0207693_10033176 | Ga0207693_100331766 | 150 |
| 344 | 3300025915 | Ga0207693_10287012 | Ga0207693_102870123 | 150 |
| 345 | 3300025916 | Ga0207663_10487925 | Ga0207663_104879251 | 150 |
| 346 | 3300025917 | Ga0207660_10033371 | Ga0207660_100333714 | 150 |
| 347 | 3300025918 | Ga0207662_10054942 | Ga0207662_100549423 | 150 |
| 348 | 3300025918 | Ga0207662_10131357 | Ga0207662_101313573 | 150 |
| 349 | 3300025919 | Ga0207657_10095412 | Ga0207657_100954124 | 150 |
| 350 | 3300025920 | Ga0207649_10029582 | Ga0207649_100295824 | 150 |
| 351 | 3300025921 | Ga0207652_10219588 | Ga0207652_102195884 | 150 |
| 352 | 3300025922 | Ga0207646_10030718 | Ga0207646_100307186 | 150 |
| 353 | 3300025922 | Ga0207646_10367265 | Ga0207646_103672652 | 150 |
| 354 | 3300025922 | Ga0207646_10475438 | Ga0207646_104754382 | 150 |
| 355 | 3300025922 | Ga0207646_10598911 | Ga0207646_105989112 | 150 |
| 356 | 3300025926 | Ga0207659_10020462 | Ga0207659_100204624 | 150 |
| 357 | 3300025926 | Ga0207659_10046276 | Ga0207659_100462764 | 150 |
| 358 | 3300025926 | Ga0207659_10071841 | Ga0207659_100718414 | 150 |
| 359 | 3300025928 | Ga0207700_10022036 | Ga0207700_100220362 | 150 |
| 360 | 3300025931 | Ga0207644_10041764 | Ga0207644_100417645 | 150 |
| 361 | 3300025931 | Ga0207644_10062264 | Ga0207644_100622642 | 150 |
| 362 | 3300025932 | Ga0207690_10020793 | Ga0207690_100207933 | 150 |
| 363 | 3300025932 | Ga0207690_10207131 | Ga0207690_102071312 | 150 |
| 364 | 3300025932 | Ga0207690_10786797 | Ga0207690_107867972 | 150 |
| 365 | 3300025933 | Ga0207706_10213282 | Ga0207706_102132823 | 150 |
| 366 | 3300025933 | Ga0207706_10439148 | Ga0207706_104391482 | 150 |
| 367 | 3300025934 | Ga0207686_10228456 | Ga0207686_102284562 | 150 |
| 368 | 3300025936 | Ga0207670_10126342 | Ga0207670_101263423 | 150 |
| 369 | 3300025936 | Ga0207670_10420392 | Ga0207670_104203921 | 150 |
| 370 | 3300025937 | Ga0207669_11002167 | Ga0207669_110021671 | 150 |
| 371 | 3300025939 | Ga0207665_10183063 | Ga0207665_101830633 | 150 |
| 372 | 3300025940 | Ga0207691_10041645 | Ga0207691_100416455 | 150 |
| 373 | 3300025941 | Ga0207711_10148805 | Ga0207711_101488054 | 150 |
| 374 | 3300025941 | Ga0207711_10361471 | Ga0207711_103614712 | 150 |
| 375 | 3300025941 | Ga0207711_10368750 | Ga0207711_103687502 | 150 |
| 376 | 3300025942 | Ga0207689_10250270 | Ga0207689_102502702 | 150 |
| 377 | 3300025944 | Ga0207661_10031091 | Ga0207661_100310914 | 150 |
| 378 | 3300025944 | Ga0207661_10273088 | Ga0207661_102730882 | 150 |
| 379 | 3300025945 | Ga0207679_10752705 | Ga0207679_107527051 | 150 |
| 380 | 3300025960 | Ga0207651_10046799 | Ga0207651_100467992 | 150 |
| 381 | 3300025960 | Ga0207651_11032082 | Ga0207651_110320821 | 150 |
| 382 | 3300025961 | Ga0207712_10006240 | Ga0207712_100062404 | 150 |
| 383 | 3300025961 | Ga0207712_10134322 | Ga0207712_101343223 | 150 |
| 384 | 3300025972 | Ga0207668_10020331 | Ga0207668_100203313 | 150 |
| 385 | 3300026023 | Ga0207677_10046961 | Ga0207677_100469614 | 150 |
| 386 | 3300026035 | Ga0207703_10016561 | Ga0207703_100165614 | 150 |
| 387 | 3300026035 | Ga0207703_10656276 | Ga0207703_106562762 | 150 |
| 388 | 3300026035 | Ga0207703_11422454 | Ga0207703_114224542 | 150 |
| 389 | 3300026067 | Ga0207678_10009753 | Ga0207678_100097539 | 150 |
| 390 | 3300026067 | Ga0207678_10059942 | Ga0207678_100599425 | 150 |
| 391 | 3300026075 | Ga0207708_10015316 | Ga0207708_100153163 | 150 |
| 392 | 3300026078 | Ga0207702_10086182 | Ga0207702_100861824 | 150 |
| 393 | 3300026088 | Ga0207641_10028509 | Ga0207641_100285094 | 150 |
| 394 | 3300026088 | Ga0207641_10242020 | Ga0207641_102420203 | 150 |
| 395 | 3300026095 | Ga0207676_10081849 | Ga0207676_100818494 | 150 |
| 396 | 3300026095 | Ga0207676_10865195 | Ga0207676_108651952 | 150 |
| 397 | 3300026121 | Ga0207683_10179139 | Ga0207683_101791392 | 150 |
| 398 | 3300028379 | Ga0268266_10017597 | Ga0268266_100175974 | 150 |
| 399 | 3300028379 | Ga0268266_10028113 | Ga0268266_100281135 | 150 |
| 400 | 3300028381 | Ga0268264_10036890 | Ga0268264_100368903 | 150 |
| 401 | 3300035089 | Ga0373944_0037848 | Ga0373944_0037848_774_1226 | 150 |
| 402 | 3300035116 | Ga0373945_0073149 | Ga0373945_0073149_236_688 | 150 |
| 403 | 3300035117 | Ga0373953_0053261 | Ga0373953_0053261_881_1333 | 150 |
| 404 | 3300035171 | Ga0373946_0294051 | Ga0373946_0294051_198_650 | 150 |
| 405 | 3300035695 | Ga0373927_0749326 | Ga0373927_0749326_152_604 | 150 |
| 406 | 3300035724 | Ga0373933_0316418 | Ga0373933_0316418_315_767 | 150 |
| 407 | 3300035725 | Ga0373947_0117875 | Ga0373947_0117875_738_1190 | 150 |
| 408 | 3300035725 | Ga0373947_0359836 | Ga0373947_0359836_374_826 | 150 |
| 409 | 3300036401 | Ga0373937_0506818 | Ga0373937_0506818_12_464 | 150 |
| 410 | 3300037068 | Ga0373925_0596356 | Ga0373925_0596356_61_516 | 150 |
| 411 | 3300037418 | Ga0395900_0105451 | Ga0395900_0105451_1057_1512 | 150 |
| 412 | 3300037418 | Ga0395900_0552510 | Ga0395900_0552510_564_1022 | 150 |
| 413 | 3300037418 | Ga0395900_1057540 | Ga0395900_1057540_81_533 | 150 |
| 414 | 3300041441 | Ga0451787_832899 | Ga0451787_832899_129_581 | 150 |
| 415 | 3300041496 | Ga0451839_1382909 | Ga0451839_1382909_21_473 | 150 |
| 416 | 3300041503 | Ga0451847_0043840 | Ga0451847_0043840_79_531 | 150 |
| 417 | 3300044706 | Ga0466964_0071168 | Ga0466964_0071168_917_1369 | 150 |
| 418 | 3300045051 | Ga0451576_0209162 | Ga0451576_0209162_333_824 | 150 |
| 419 | 3300046455 | Ga0495603_0129676 | Ga0495603_0129676_213_665 | 150 |
| 420 | 3300046459 | Ga0495629_0028413 | Ga0495629_0028413_566_1018 | 150 |
| 421 | 3300046462 | Ga0495651_0490482 | Ga0495651_0490482_82_534 | 150 |
| 422 | 3300046475 | Ga0495639_0049013 | Ga0495639_0049013_363_815 | 150 |
| 423 | 3300046477 | Ga0495664_0044459 | Ga0495664_0044459_1876_2328 | 150 |
| 424 | 3300046477 | Ga0495664_0270040 | Ga0495664_0270040_446_901 | 150 |
| 425 | 3300046499 | Ga0495594_0358526 | Ga0495594_0358526_140_592 | 150 |
| 426 | 3300046511 | Ga0495608_0509963 | Ga0495608_0509963_32_484 | 150 |
| 427 | 3300046516 | Ga0495628_0058212 | Ga0495628_0058212_1281_1733 | 150 |
| 428 | 3300046517 | Ga0495630_0064451 | Ga0495630_0064451_680_1132 | 150 |
| 429 | 3300046517 | Ga0495630_0178329 | Ga0495630_0178329_936_1391 | 150 |
| 430 | 3300046517 | Ga0495630_0475126 | Ga0495630_0475126_212_664 | 150 |
| 431 | 3300046526 | Ga0495666_0127671 | Ga0495666_0127671_145_597 | 150 |
| 432 | 3300046529 | Ga0495652_0085453 | Ga0495652_0085453_1824_2276 | 150 |
| 433 | 3300046531 | Ga0495665_0414483 | Ga0495665_0414483_198_650 | 150 |
| 434 | 3300046533 | Ga0495640_0071663 | Ga0495640_0071663_1626_2078 | 150 |
| 435 | 3300046535 | Ga0495586_0160951 | Ga0495586_0160951_22_474 | 150 |
| 436 | 3300046536 | Ga0495587_0057733 | Ga0495587_0057733_1690_2142 | 150 |
| 437 | 3300046536 | Ga0495587_0194826 | Ga0495587_0194826_346_798 | 150 |
| 438 | 3300046543 | Ga0495645_0147087 | Ga0495645_0147087_216_668 | 150 |
| 439 | 3300046663 | Ga0495635_0129927 | Ga0495635_0129927_1159_1611 | 150 |
| 440 | 3300046675 | Ga0495657_0380323 | Ga0495657_0380323_152_604 | 150 |
| 441 | 3300046675 | Ga0495657_0387066 | Ga0495657_0387066_331_783 | 150 |
| 442 | 3300046678 | Ga0495599_0023095 | Ga0495599_0023095_1634_2086 | 150 |
| 443 | 3300046679 | Ga0495623_0033348 | Ga0495623_0033348_2351_2803 | 150 |
| 444 | 3300046680 | Ga0495646_0014061 | Ga0495646_0014061_4350_4802 | 150 |
| 445 | 3300046683 | Ga0495658_0188236 | Ga0495658_0188236_370_822 | 150 |
| 446 | 3300046684 | Ga0495669_0241261 | Ga0495669_0241261_284_736 | 150 |
| 447 | 3300046689 | Ga0495613_0074007 | Ga0495613_0074007_1856_2308 | 150 |
| 448 | 3300046689 | Ga0495613_0545007 | Ga0495613_0545007_166_618 | 150 |
| 449 | 3300046690 | Ga0495624_0390496 | Ga0495624_0390496_193_645 | 150 |
| 450 | 3300046691 | Ga0495670_0447717 | Ga0495670_0447717_186_638 | 150 |
| 451 | 3300047315 | Ga0495581_0230705 | Ga0495581_0230705_246_698 | 150 |
| 452 | 3300047317 | Ga0495604_0191736 | Ga0495604_0191736_822_1283 | 150 |
| 453 | 3300047317 | Ga0495604_0269695 | Ga0495604_0269695_133_585 | 150 |
| 454 | 3300047319 | Ga0495674_0134606 | Ga0495674_0134606_174_626 | 150 |
| 455 | 3300047319 | Ga0495674_0187607 | Ga0495674_0187607_249_701 | 150 |
| 456 | 3300047321 | Ga0495676_0115349 | Ga0495676_0115349_918_1370 | 150 |
| 457 | 3300047444 | Ga0495675_0325291 | Ga0495675_0325291_65_517 | 150 |
| 458 | 3300047446 | Ga0495679_154626 | Ga0495679_154626_18_470 | 150 |
| 459 | 3300047471 | Ga0495684_0200892 | Ga0495684_0200892_661_1113 | 150 |
| 460 | 3300047471 | Ga0495684_0839449 | Ga0495684_0839449_10_462 | 150 |
| 461 | 3300048088 | Ga0495602_0047897 | Ga0495602_0047897_1435_1887 | 150 |
| 462 | 3300048903 | Ga0496100_0772358 | Ga0496100_0772358_83_538 | 150 |
| 463 | 3300048904 | Ga0496101_0101046 | Ga0496101_0101046_269_721 | 150 |
| 464 | 3300048904 | Ga0496101_0403397 | Ga0496101_0403397_117_572 | 150 |
| 465 | 3300048905 | Ga0496102_0046761 | Ga0496102_0046761_1068_1520 | 150 |
| 466 | 3300048905 | Ga0496102_0171915 | Ga0496102_0171915_1463_1915 | 150 |
| 467 | 3300048905 | Ga0496102_0861232 | Ga0496102_0861232_115_570 | 150 |
| 468 | 3300048906 | Ga0496103_0113423 | Ga0496103_0113423_965_1417 | 150 |
| 469 | 3300048907 | Ga0496104_0195153 | Ga0496104_0195153_295_750 | 150 |
| 470 | 3300048907 | Ga0496104_1429766 | Ga0496104_1429766_59_511 | 150 |
| 471 | 3300048909 | Ga0496106_1206584 | Ga0496106_1206584_26_478 | 150 |
| 472 | 3300048911 | Ga0496108_0032355 | Ga0496108_0032355_79_531 | 150 |
| 473 | 3300048911 | Ga0496108_0903849 | Ga0496108_0903849_90_542 | 150 |
| 474 | 3300048912 | Ga0496109_0026304 | Ga0496109_0026304_1547_1999 | 150 |
| 475 | 3300048912 | Ga0496109_0073767 | Ga0496109_0073767_2286_2741 | 150 |
| 476 | 3300048912 | Ga0496109_0562107 | Ga0496109_0562107_364_816 | 150 |
| 477 | 3300048913 | Ga0496110_0165372 | Ga0496110_0165372_1347_1799 | 150 |
| 478 | 3300048913 | Ga0496110_0210911 | Ga0496110_0210911_1086_1538 | 150 |
| 479 | 3300048914 | Ga0496111_0065476 | Ga0496111_0065476_1815_2267 | 150 |
| 480 | 3300048915 | Ga0496112_0578594 | Ga0496112_0578594_432_884 | 150 |
| 481 | 3300048915 | Ga0496112_0754828 | Ga0496112_0754828_56_508 | 150 |
| 482 | 3300048916 | Ga0496113_0013643 | Ga0496113_0013643_1050_1502 | 150 |
| 483 | 3300048917 | Ga0496114_0011578 | Ga0496114_0011578_1320_1775 | 150 |
| 484 | 3300048918 | Ga0496115_0134167 | Ga0496115_0134167_142_594 | 150 |
| 485 | 3300048918 | Ga0496115_0204507 | Ga0496115_0204507_241_696 | 150 |
| 486 | 3300050510 | nmdc:mga06r32_1500395_c1 | nmdc:mga06r32_1500395_c1_112_564 | 150 |
| 487 | 3300050513 | nmdc:mga0rr50_379147_c1 | nmdc:mga0rr50_379147_c1_220_672 | 150 |
| 488 | 3300050515 | nmdc:mga0a205_334582_c1 | nmdc:mga0a205_334582_c1_914_1369 | 150 |
| 489 | 3300053077 | Ga0495601_0267372 | Ga0495601_0267372_424_876 | 150 |
| 490 | 3300053084 | Ga0495595_0120285 | Ga0495595_0120285_416_868 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.8692 | 10 | 146 |
| 2luz-assembly1.cif.gz_A | solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 | 0.8481 | 8 | 143 |
| 4fpw-assembly3.cif.gz_B | crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. | 0.8437 | 10 | 150 |
| 1z94-assembly1.cif.gz_B | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.836 | 10 | 144 |
| 4fpw-assembly3.cif.gz_A | crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. | 0.835 | 10 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2luzA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8481 | 8 | 143 | 3.30.530.20 |
| af_Q93168_208_339_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8431 | 8 | 144 | 3.30.530.20 |
| af_Q8N9S3_197_326_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8375 | 9 | 144 | 3.30.530.20 |
| af_Q9P782_203_333_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8368 | 9 | 144 | 3.30.530.20 |
| 4fpwA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8355 | 10 | 147 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A556MWA0-F1-model_v4 | SRPBCC domain-containing protein | 0.9905 | 9 | 145 |
|
| AF-A0A5D8YJ24-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9898 | 8 | 145 |
|
| AF-A0A1T4N6W8-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9874 | 9 | 144 |
|
| AF-A0A1M3G0P2-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9865 | 10 | 143 |
|
| AF-A0A2V5TTW4-F1-model_v4 | SRPBCC domain-containing protein | 0.9862 | 23 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar