F453931

General Info

Members Datasets Scaffolds Average Seq Length
490 246 490 150

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10140286|Ga0114129_101402862
Length 179
Sequence VRVTGTNNGGLSKKENKSDGAEYQCKGENIMTKTNDLAEPIIVERTFDAPVGRVWTALTDVNEMRQWYFDLKEFKPQVGFEFEFIVEHEGNSYHHLCRVTEVVPQKKIAYSWRYKGEPGDSLVTIELSPEGEKTHLKLTHSGIETFPKTPAYARKNFEAGWTAIVGTELKQFVEQKQKT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
95 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.73
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1298596 2162886007 Bacteria 1328
2 SwRhRL2b_contig_2531808 2162886007 Bacteria 1116
3 SwRhRL2b_contig_3073330 2162886007 Bacteria 820
4 JGI24743J22301_10009542 3300001991 Bacteria 1721
5 JGI24035J26624_1001177 3300002126 Bacteria 2482
6 JGI25406J46586_10000005 3300003203 Bacteria 118289
7 JGI25406J46586_10240930 3300003203 Unclassified 531
8 JGI25405J52794_10153732 3300003911 Unclassified 525
9 Ga0065714_10127204 3300005288 Bacteria 1284
10 Ga0065704_10044063 3300005289 Bacteria 904
11 Ga0065704_10393187 3300005289 Bacteria 760
12 Ga0065704_10455190 3300005289 Unclassified 702
13 Ga0065712_10001986 3300005290 Bacteria 13447
14 Ga0065712_10003070 3300005290 Bacteria 10088
15 Ga0065712_10008286 3300005290 Bacteria 2738
16 Ga0065712_10010351 3300005290 Bacteria 3193
17 Ga0065712_10207420 3300005290 Bacteria 1085
18 Ga0065712_10313863 3300005290 Bacteria 820
19 Ga0065712_10423776 3300005290 Unclassified 688
20 Ga0065715_10002225 3300005293 Bacteria 12258
21 Ga0065715_10008128 3300005293 Bacteria 4970
22 Ga0065715_10095299 3300005293 Bacteria 4117
23 Ga0065715_10104559 3300005293 Bacteria 2950
24 Ga0065715_10245587 3300005293 Bacteria 1184
25 Ga0065715_10251641 3300005293 Bacteria 1165
26 Ga0065707_10000986 3300005295 Bacteria 8919
27 Ga0065707_10197703 3300005295 Unclassified 1327
28 Ga0065707_11025741 3300005295 Unclassified 533
29 Ga0065707_11141255 3300005295 Bacteria 507
30 Ga0070658_10197883 3300005327 Bacteria 1695
31 Ga0070676_10266277 3300005328 Unclassified 1149
32 Ga0070676_10521905 3300005328 Unclassified 846
33 Ga0070683_100016071 3300005329 Bacteria 6587
34 Ga0070683_100257033 3300005329 Bacteria 1661
35 Ga0070683_100298340 3300005329 Bacteria 1533
36 Ga0070690_100125605 3300005330 Bacteria 1727
37 Ga0070670_101170903 3300005331 Unclassified 702
38 Ga0070666_10047952 3300005335 Bacteria 2869
39 Ga0070666_10230446 3300005335 Bacteria 1308
40 Ga0070680_100036859 3300005336 Bacteria 3951
41 Ga0070682_100274712 3300005337 Bacteria 1226
42 Ga0070682_100380571 3300005337 Bacteria 1061
43 Ga0070682_100829150 3300005337 Unclassified 754
44 Ga0068868_100192461 3300005338 Bacteria 1696
45 Ga0068868_100352890 3300005338 Bacteria 1260
46 Ga0070660_100533670 3300005339 Bacteria 978
47 Ga0070660_100660209 3300005339 Unclassified 876
48 Ga0070689_100058807 3300005340 Bacteria 2986
49 Ga0070689_100267926 3300005340 Bacteria 1413
50 Ga0070687_100044097 3300005343 Bacteria 2270
51 Ga0070687_100366108 3300005343 Bacteria 935
52 Ga0070661_100035685 3300005344 Bacteria 3612
53 Ga0070661_100051358 3300005344 Bacteria 3017
54 Ga0070661_100706171 3300005344 Bacteria 822
55 Ga0070668_100032496 3300005347 Bacteria 3971
56 Ga0070668_100694734 3300005347 Bacteria 897
57 Ga0070669_100021292 3300005353 Bacteria 4635
58 Ga0070669_100644662 3300005353 Bacteria 891
59 Ga0070675_100047008 3300005354 Bacteria 3535
60 Ga0070675_100058494 3300005354 Bacteria 3179
61 Ga0070675_100205149 3300005354 Bacteria 1712
62 Ga0070675_100346512 3300005354 Bacteria 1317
63 Ga0070675_101359315 3300005354 Bacteria 655
64 Ga0070671_100228507 3300005355 Bacteria 1579
65 Ga0070671_100704999 3300005355 Bacteria 876
66 Ga0070673_100298548 3300005364 Bacteria 1417
67 Ga0070673_101327376 3300005364 Unclassified 676
68 Ga0070673_101895253 3300005364 Unclassified 565
69 Ga0070688_100018024 3300005365 Bacteria 4065
70 Ga0070688_100046793 3300005365 Bacteria 2680
71 Ga0070688_100061581 3300005365 Bacteria 2373
72 Ga0070659_100002685 3300005366 Bacteria 12644
73 Ga0070659_100290011 3300005366 Bacteria 1363
74 Ga0070667_100302667 3300005367 Bacteria 1440
75 Ga0070709_10092908 3300005434 Bacteria 1993
76 Ga0070709_10621554 3300005434 Bacteria 834
77 Ga0070714_100108519 3300005435 Bacteria 2454
78 Ga0070714_100235077 3300005435 Bacteria 1690
79 Ga0070713_100073337 3300005436 Bacteria 2897
80 Ga0070710_10454869 3300005437 Unclassified 868
81 Ga0070710_10700303 3300005437 Unclassified 715
82 Ga0070701_10032536 3300005438 Bacteria 2598
83 Ga0070711_100017632 3300005439 Bacteria 4549
84 Ga0070711_100108591 3300005439 Bacteria 2033
85 Ga0070711_100237604 3300005439 Bacteria 1423
86 Ga0070711_101578197 3300005439 Bacteria 574
87 Ga0070705_100041828 3300005440 Unclassified 2616
88 Ga0070705_100141657 3300005440 Bacteria 1583
89 Ga0070700_100064071 3300005441 Bacteria 2327
90 Ga0070694_100085835 3300005444 Bacteria 2199
91 Ga0070708_100019967 3300005445 Bacteria 5641
92 Ga0070708_100036148 3300005445 Bacteria 4307
93 Ga0070708_100193057 3300005445 Bacteria 1905
94 Ga0070708_100249690 3300005445 Unclassified 1667
95 Ga0070708_101615989 3300005445 Bacteria 603
96 Ga0070663_100048566 3300005455 Bacteria 3010
97 Ga0070663_100633945 3300005455 Bacteria 902
98 Ga0070678_100079673 3300005456 Bacteria 2478
99 Ga0070678_100215059 3300005456 Bacteria 1595
100 Ga0070678_100973604 3300005456 Unclassified 779
101 Ga0070662_100139986 3300005457 Bacteria 1874
102 Ga0070662_100378082 3300005457 Bacteria 1165
103 Ga0070681_10013048 3300005458 Bacteria 8250
104 Ga0070685_10002918 3300005466 Bacteria 8738
105 Ga0070685_10234773 3300005466 Unclassified 1208
106 Ga0070685_10306022 3300005466 Bacteria 1073
107 Ga0070706_100032564 3300005467 Bacteria 4808
108 Ga0070706_100048900 3300005467 Bacteria 3902
109 Ga0070706_100180367 3300005467 Bacteria 1972
110 Ga0070706_100224719 3300005467 Unclassified 1752
111 Ga0070706_100846029 3300005467 Bacteria 846
112 Ga0070706_101371105 3300005467 Unclassified 648
113 Ga0070707_100007862 3300005468 Bacteria 9901
114 Ga0070707_100347103 3300005468 Bacteria 1442
115 Ga0070698_100006750 3300005471 Bacteria 12441
116 Ga0070698_100575820 3300005471 Unclassified 1066
117 Ga0070698_100905225 3300005471 Unclassified 828
118 Ga0070699_100707366 3300005518 Unclassified 921
119 Ga0070699_101251460 3300005518 Unclassified 681
120 Ga0070679_100038018 3300005530 Bacteria 4783
121 Ga0070684_100002414 3300005535 Bacteria 13776
122 Ga0070684_100032889 3300005535 Bacteria 4424
123 Ga0070684_100077513 3300005535 Bacteria 2935
124 Ga0070684_100738406 3300005535 Bacteria 919
125 Ga0070684_101400266 3300005535 Bacteria 658
126 Ga0070697_100005127 3300005536 Bacteria 10060
127 Ga0070697_100228151 3300005536 Bacteria 1588
128 Ga0070697_100236379 3300005536 Bacteria 1560
129 Ga0070697_100268979 3300005536 Unclassified 1461
130 Ga0070697_100300940 3300005536 Unclassified 1379
131 Ga0070697_100613106 3300005536 Bacteria 957
132 Ga0070697_101116269 3300005536 Unclassified 702
133 Ga0070672_100040678 3300005543 Bacteria 3568
134 Ga0070672_100603692 3300005543 Bacteria 956
135 Ga0070686_100016744 3300005544 Bacteria 4270
136 Ga0070686_100042514 3300005544 Bacteria 2847
137 Ga0070695_100037100 3300005545 Bacteria 3070
138 Ga0070665_100028026 3300005548 Bacteria 5673
139 Ga0070665_100063641 3300005548 Bacteria 3698
140 Ga0070665_101588076 3300005548 Bacteria 662
141 Ga0070704_100393090 3300005549 Unclassified 1181
142 Ga0070704_101524229 3300005549 Unclassified 615
143 Ga0068855_100773895 3300005563 Bacteria 1022
144 Ga0070664_100203268 3300005564 Bacteria 1768
145 Ga0070664_100792022 3300005564 Bacteria 886
146 Ga0068857_100022369 3300005577 Bacteria 5562
147 Ga0068857_100536495 3300005577 Bacteria 1101
148 Ga0068857_100568895 3300005577 Bacteria 1069
149 Ga0068856_100086333 3300005614 Bacteria 3118
150 Ga0068856_100706219 3300005614 Bacteria 1029
151 Ga0068856_100735089 3300005614 Bacteria 1007
152 Ga0068852_101280297 3300005616 Bacteria 755
153 Ga0068859_100056621 3300005617 Bacteria 3947
154 Ga0068870_10713563 3300005840 Bacteria 693
155 Ga0068863_100059451 3300005841 Bacteria 3616
156 Ga0068863_100074687 3300005841 Bacteria 3207
157 Ga0068863_101067514 3300005841 Bacteria 812
158 Ga0068858_100021640 3300005842 Bacteria 6011
159 Ga0068858_100759315 3300005842 Bacteria 945
160 Ga0081455_10006446 3300005937 Bacteria 12576
161 Ga0081455_10010873 3300005937 Bacteria 9187
162 Ga0081455_10021810 3300005937 Bacteria 5999
163 Ga0081455_10517902 3300005937 Bacteria 797
164 Ga0081540_1069915 3300005983 Bacteria 1628
165 Ga0081539_10000026 3300005985 Bacteria 330830
166 Ga0081539_10008376 3300005985 Bacteria 9028
167 Ga0081539_10099835 3300005985 Bacteria 1482
168 Ga0070717_10006689 3300006028 Bacteria 8503
169 Ga0070717_10022168 3300006028 Bacteria 5016
170 Ga0070717_10390069 3300006028 Bacteria 1250
171 Ga0070715_10040498 3300006163 Bacteria 1947
172 Ga0070716_101536883 3300006173 Bacteria 545
173 Ga0070712_100014030 3300006175 Bacteria 5135
174 Ga0070712_100336331 3300006175 Unclassified 1232
175 Ga0070712_100445372 3300006175 Unclassified 1077
176 Ga0097621_100591235 3300006237 Bacteria 1014
177 Ga0068871_100106190 3300006358 Bacteria 2357
178 Ga0068871_101324066 3300006358 Bacteria 678
179 Ga0075433_10169623 3300006852 Bacteria 1942
180 Ga0075434_100183270 3300006871 Bacteria 2114
181 Ga0068865_100486120 3300006881 Bacteria 1027
182 Ga0068865_101345582 3300006881 Bacteria 636
183 Ga0097620_100056623 3300006931 Bacteria 3947
184 Ga0099795_10001863 3300007788 Bacteria 4772
185 Ga0099795_10594662 3300007788 Bacteria 526
186 Ga0111539_10248008 3300009094 Unclassified 2073
187 Ga0105245_10160675 3300009098 Bacteria 2132
188 Ga0105245_10325073 3300009098 Bacteria 1516
189 Ga0105245_13068283 3300009098 Bacteria 518
190 Ga0105247_10154042 3300009101 Bacteria 1517
191 Ga0114129_10140286 3300009147 Bacteria 3314
192 Ga0105241_10839342 3300009174 Bacteria 849
193 Ga0105241_11246235 3300009174 Bacteria 706
194 Ga0105242_10118817 3300009176 Bacteria 2265
195 Ga0105248_10177786 3300009177 Bacteria 2398
196 Ga0105248_10449262 3300009177 Bacteria 1452
197 Ga0105248_10611241 3300009177 Bacteria 1230
198 Ga0105237_10086135 3300009545 Bacteria 3132
199 Ga0105249_10017208 3300009553 Bacteria 6418
200 Ga0105249_10137538 3300009553 Bacteria 2340
201 Ga0105249_10350990 3300009553 Bacteria 1494
202 Ga0099796_10021985 3300010159 Bacteria 1973
203 Ga0099796_10127312 3300010159 Bacteria 984
204 Ga0099796_10267695 3300010159 Unclassified 715
205 Ga0099796_10436347 3300010159 Bacteria 580
206 Ga0105239_10439762 3300010375 Bacteria 1479
207 Ga0105239_10671889 3300010375 Bacteria 1184
208 Ga0105239_11191133 3300010375 Unclassified 878
209 Ga0105246_10125509 3300011119 Bacteria 1909
210 Ga0105246_10565137 3300011119 Bacteria 977
211 Ga0157328_1021225 3300012478 Unclassified 550
212 Ga0157339_1050135 3300012505 Bacteria 550
213 Ga0157371_10166480 3300013102 Bacteria 1574
214 Ga0157370_10847024 3300013104 Bacteria 831
215 Ga0157369_10322983 3300013105 Bacteria 1604
216 Ga0157374_10089386 3300013296 Bacteria 2935
217 Ga0157374_10126041 3300013296 Bacteria 2475
218 Ga0157374_10132105 3300013296 Bacteria 2416
219 Ga0157374_10404682 3300013296 Bacteria 1362
220 Ga0157374_10631584 3300013296 Bacteria 1082
221 Ga0157374_10652667 3300013296 Bacteria 1064
222 Ga0157374_12338001 3300013296 Unclassified 562
223 Ga0157378_10016502 3300013297 Bacteria 6468
224 Ga0157378_10026782 3300013297 Bacteria 5084
225 Ga0157378_10165834 3300013297 Bacteria 2069
226 Ga0157378_10266414 3300013297 Bacteria 1646
227 Ga0157378_10282552 3300013297 Bacteria 1600
228 Ga0157378_10590495 3300013297 Bacteria 1121
229 Ga0157378_10797283 3300013297 Bacteria 970
230 Ga0157378_11132654 3300013297 Bacteria 820
231 Ga0163162_10237800 3300013306 Bacteria 1952
232 Ga0163162_10396151 3300013306 Bacteria 1513
233 Ga0163162_11664141 3300013306 Unclassified 728
234 Ga0163162_11857613 3300013306 Unclassified 689
235 Ga0157372_10438836 3300013307 Bacteria 1522
236 Ga0157375_10033405 3300013308 Bacteria 4888
237 Ga0157375_10154772 3300013308 Bacteria 2431
238 Ga0157375_10302946 3300013308 Unclassified 1762
239 Ga0157375_10800363 3300013308 Bacteria 1091
240 Ga0163163_10376579 3300014325 Bacteria 1477
241 Ga0163163_10763526 3300014325 Unclassified 1030
242 Ga0163163_10901763 3300014325 Bacteria 947
243 Ga0157377_10021695 3300014745 Bacteria 3382
244 Ga0157377_10109672 3300014745 Bacteria 1657
245 Ga0157377_11520522 3300014745 Unclassified 533
246 Ga0157377_11604160 3300014745 Bacteria 521
247 Ga0157379_10007258 3300014968 Bacteria 9589
248 Ga0157376_10038475 3300014969 Bacteria 3893
249 Ga0157376_10439082 3300014969 Bacteria 1270
250 Ga0157376_10683488 3300014969 Bacteria 1030
251 Ga0157376_11328554 3300014969 Bacteria 749
252 Ga0182006_1042580 3300015261 Bacteria 1778
253 Ga0163161_10680101 3300017792 Unclassified 855
254 Ga0163161_11000703 3300017792 Bacteria 714
255 Ga0163161_11231178 3300017792 Unclassified 648
256 Ga0163161_12091909 3300017792 Unclassified 503
257 Ga0207666_1000279 3300025271 Bacteria 7292
258 Ga0207673_1003496 3300025290 Bacteria 1840
259 Ga0207673_1003587 3300025290 Bacteria 1823
260 Ga0207673_1003690 3300025290 Bacteria 1802
261 Ga0207697_10002160 3300025315 Bacteria 10298
262 Ga0207697_10003050 3300025315 Bacteria 8398
263 Ga0207697_10011161 3300025315 Bacteria 3807
264 Ga0207697_10012565 3300025315 Bacteria 3548
265 Ga0207697_10116820 3300025315 Bacteria 1146
266 Ga0207697_10315536 3300025315 Unclassified 694
267 Ga0207653_10054709 3300025885 Bacteria 1335
268 Ga0207710_10146991 3300025900 Unclassified 1141
269 Ga0207680_10049384 3300025903 Bacteria 2504
270 Ga0207647_10015620 3300025904 Bacteria 5199
271 Ga0207685_10115617 3300025905 Bacteria 1170
272 Ga0207699_10121973 3300025906 Bacteria 1687
273 Ga0207699_10238075 3300025906 Bacteria 1249
274 Ga0207699_10656535 3300025906 Unclassified 766
275 Ga0207645_10109188 3300025907 Bacteria 1790
276 Ga0207645_10594919 3300025907 Unclassified 751
277 Ga0207684_10003031 3300025910 Bacteria 16647
278 Ga0207684_10099222 3300025910 Bacteria 2487
279 Ga0207684_10141736 3300025910 Bacteria 2066
280 Ga0207684_10819916 3300025910 Unclassified 786
281 Ga0207654_10377543 3300025911 Bacteria 981
282 Ga0207707_10009207 3300025912 Bacteria 8571
283 Ga0207707_11088716 3300025912 Bacteria 652
284 Ga0207693_10009927 3300025915 Bacteria 7739
285 Ga0207693_10033176 3300025915 Bacteria 4074
286 Ga0207693_10287012 3300025915 Unclassified 1289
287 Ga0207663_10180101 3300025916 Bacteria 1508
288 Ga0207663_10487925 3300025916 Unclassified 955
289 Ga0207660_10033371 3300025917 Bacteria 3560
290 Ga0207662_10054942 3300025918 Bacteria 2375
291 Ga0207662_10131357 3300025918 Bacteria 1579
292 Ga0207657_10095412 3300025919 Bacteria 2475
293 Ga0207649_10029582 3300025920 Bacteria 3236
294 Ga0207652_10219588 3300025921 Bacteria 1712
295 Ga0207646_10030718 3300025922 Unclassified 4868
296 Ga0207646_10060905 3300025922 Bacteria 3369
297 Ga0207646_10367265 3300025922 Unclassified 1300
298 Ga0207646_10475438 3300025922 Bacteria 1127
299 Ga0207646_10598911 3300025922 Bacteria 989
300 Ga0207681_10052599 3300025923 Bacteria 2762
301 Ga0207650_10795974 3300025925 Unclassified 801
302 Ga0207659_10020462 3300025926 Bacteria 4376
303 Ga0207659_10046276 3300025926 Bacteria 3071
304 Ga0207659_10071841 3300025926 Bacteria 2528
305 Ga0207659_11218790 3300025926 Unclassified 647
306 Ga0207700_10022036 3300025928 Bacteria 4364
307 Ga0207700_10033804 3300025928 Bacteria 3662
308 Ga0207644_10041764 3300025931 Bacteria 3247
309 Ga0207644_10062264 3300025931 Bacteria 2705
310 Ga0207690_10020793 3300025932 Bacteria 4060
311 Ga0207690_10207131 3300025932 Bacteria 1493
312 Ga0207690_10786797 3300025932 Bacteria 786
313 Ga0207706_10213282 3300025933 Bacteria 1692
314 Ga0207706_10439148 3300025933 Bacteria 1130
315 Ga0207686_10228456 3300025934 Bacteria 1348
316 Ga0207670_10126342 3300025936 Bacteria 1867
317 Ga0207670_10420392 3300025936 Bacteria 1072
318 Ga0207670_10897520 3300025936 Bacteria 742
319 Ga0207669_11002167 3300025937 Unclassified 702
320 Ga0207704_11159312 3300025938 Bacteria 658
321 Ga0207665_10183063 3300025939 Bacteria 1518
322 Ga0207691_10041645 3300025940 Bacteria 4239
323 Ga0207691_10234615 3300025940 Bacteria 1588
324 Ga0207691_10474906 3300025940 Bacteria 1063
325 Ga0207711_10148805 3300025941 Bacteria 2112
326 Ga0207711_10361471 3300025941 Bacteria 1345
327 Ga0207711_10368750 3300025941 Bacteria 1331
328 Ga0207689_10250270 3300025942 Bacteria 1465
329 Ga0207661_10031091 3300025944 Bacteria 4119
330 Ga0207661_10273088 3300025944 Bacteria 1509
331 Ga0207679_10752705 3300025945 Bacteria 886
332 Ga0207679_11023061 3300025945 Bacteria 757
333 Ga0207651_10046799 3300025960 Bacteria 2912
334 Ga0207651_11032082 3300025960 Bacteria 735
335 Ga0207712_10006240 3300025961 Bacteria 7512
336 Ga0207712_10134322 3300025961 Bacteria 1890
337 Ga0207668_10020331 3300025972 Bacteria 4216
338 Ga0207677_10046961 3300026023 Bacteria 2895
339 Ga0207703_10016561 3300026035 Bacteria 5749
340 Ga0207703_10576713 3300026035 Bacteria 1063
341 Ga0207703_10656276 3300026035 Bacteria 995
342 Ga0207703_11422454 3300026035 Unclassified 667
343 Ga0207678_10009753 3300026067 Bacteria 8444
344 Ga0207678_10059942 3300026067 Bacteria 3274
345 Ga0207708_10015316 3300026075 Bacteria 5749
346 Ga0207702_10086182 3300026078 Bacteria 2738
347 Ga0207702_10704887 3300026078 Bacteria 995
348 Ga0207641_10028509 3300026088 Bacteria 4614
349 Ga0207641_10242020 3300026088 Bacteria 1682
350 Ga0207676_10081849 3300026095 Bacteria 2624
351 Ga0207676_10865195 3300026095 Unclassified 885
352 Ga0207674_10022663 3300026116 Bacteria 6740
353 Ga0207683_10100256 3300026121 Bacteria 2585
354 Ga0207683_10179139 3300026121 Bacteria 1921
355 Ga0207683_11204749 3300026121 Unclassified 702
356 Ga0268266_10017597 3300028379 Bacteria 6095
357 Ga0268266_10028113 3300028379 Bacteria 4781
358 Ga0268264_10036890 3300028381 Bacteria 4028
359 Ga0373944_0037848 3300035089 Bacteria 1480
360 Ga0373944_0220672 3300035089 Unclassified 692
361 Ga0373949_0170828 3300035090 Unclassified 639
362 Ga0373945_0073149 3300035116 Bacteria 1301
363 Ga0373945_0138852 3300035116 Bacteria 979
364 Ga0373953_0053261 3300035117 Bacteria 1640
365 Ga0373943_0085853 3300035170 Bacteria 1622
366 Ga0373943_0092084 3300035170 Bacteria 1572
367 Ga0373943_0094167 3300035170 Bacteria 1556
368 Ga0373946_0294051 3300035171 Bacteria 802
369 Ga0373946_0583348 3300035171 Unclassified 579
370 Ga0373935_0049354 3300035692 Bacteria 2667
371 Ga0373935_0085920 3300035692 Bacteria 2052
372 Ga0373935_0267283 3300035692 Bacteria 1201
373 Ga0373927_0360090 3300035695 Bacteria 959
374 Ga0373927_0749326 3300035695 Bacteria 645
375 Ga0373933_0316418 3300035724 Bacteria 1012
376 Ga0373933_0527668 3300035724 Unclassified 774
377 Ga0373947_0117875 3300035725 Bacteria 1684
378 Ga0373947_0359836 3300035725 Bacteria 977
379 Ga0373947_0859258 3300035725 Unclassified 619
380 Ga0373937_0506818 3300036401 Bacteria 1147
381 Ga0373925_0104927 3300037068 Bacteria 2177
382 Ga0373925_0596356 3300037068 Bacteria 910
383 Ga0373925_1031277 3300037068 Bacteria 677
384 Ga0395899_0142991 3300037312 Bacteria 1701
385 Ga0395900_0040671 3300037418 Bacteria 4791
386 Ga0395900_0105451 3300037418 Bacteria 2896
387 Ga0395900_0552510 3300037418 Bacteria 1096
388 Ga0395900_0702342 3300037418 Unclassified 945
389 Ga0395900_1057540 3300037418 Bacteria 730
390 Ga0395900_1779021 3300037418 Unclassified 527
391 Ga0395898_0653873 3300037466 Bacteria 994
392 Ga0395905_0707049 3300037471 Unclassified 910
393 Ga0395901_0023891 3300038443 Bacteria 6270
394 Ga0395901_0254323 3300038443 Bacteria 1830
395 Ga0451787_832899 3300041441 Unclassified 676
396 Ga0451839_1382909 3300041496 Unclassified 605
397 Ga0451847_0043840 3300041503 Unclassified 678
398 Ga0439464_0111144 3300042439 Unclassified 839
399 Ga0439460_0229869 3300042461 Unclassified 637
400 Ga0439440_0109171 3300042993 Bacteria 760
401 Ga0466964_0071168 3300044706 Bacteria 1471
402 Ga0451576_0209162 3300045051 Bacteria 2037
403 Ga0495603_0129676 3300046455 Bacteria 1469
404 Ga0495629_0028413 3300046459 Bacteria 3971
405 Ga0495651_0490482 3300046462 Bacteria 788
406 Ga0495580_0191959 3300046472 Bacteria 1409
407 Ga0495639_0049013 3300046475 Bacteria 1917
408 Ga0495664_0044459 3300046477 Bacteria 2632
409 Ga0495664_0270040 3300046477 Bacteria 1028
410 Ga0495594_0358526 3300046499 Bacteria 830
411 Ga0495608_0509963 3300046511 Bacteria 728
412 Ga0495628_0058212 3300046516 Bacteria 3037
413 Ga0495630_0064451 3300046517 Bacteria 2753
414 Ga0495630_0178329 3300046517 Bacteria 1620
415 Ga0495630_0475126 3300046517 Bacteria 958
416 Ga0495666_0127671 3300046526 Bacteria 1189
417 Ga0495642_0151944 3300046528 Bacteria 1002
418 Ga0495652_0085453 3300046529 Bacteria 2592
419 Ga0495665_0414483 3300046531 Bacteria 683
420 Ga0495640_0071663 3300046533 Bacteria 2325
421 Ga0495586_0160951 3300046535 Bacteria 1266
422 Ga0495587_0057733 3300046536 Bacteria 2281
423 Ga0495587_0194826 3300046536 Bacteria 1147
424 Ga0495598_0039682 3300046537 Bacteria 1370
425 Ga0495645_0147087 3300046543 Bacteria 1640
426 Ga0495635_0129927 3300046663 Bacteria 1717
427 Ga0495657_0380323 3300046675 Unclassified 833
428 Ga0495657_0387066 3300046675 Unclassified 824
429 Ga0495599_0023095 3300046678 Bacteria 3886
430 Ga0495623_0033348 3300046679 Bacteria 3304
431 Ga0495646_0014061 3300046680 Bacteria 5089
432 Ga0495658_0188236 3300046683 Bacteria 1282
433 Ga0495669_0241261 3300046684 Unclassified 867
434 Ga0495613_0074007 3300046689 Bacteria 2481
435 Ga0495613_0545007 3300046689 Bacteria 777
436 Ga0495624_0390496 3300046690 Bacteria 836
437 Ga0495670_0447717 3300046691 Bacteria 700
438 Ga0495581_0230705 3300047315 Bacteria 1083
439 Ga0495604_0191736 3300047317 Unclassified 1424
440 Ga0495604_0269695 3300047317 Bacteria 1153
441 Ga0495674_0134606 3300047319 Bacteria 2080
442 Ga0495674_0187607 3300047319 Bacteria 1720
443 Ga0495676_0115349 3300047321 Bacteria 1964
444 Ga0495675_0325291 3300047444 Bacteria 909
445 Ga0495679_154626 3300047446 Bacteria 615
446 Ga0495684_0200892 3300047471 Bacteria 1470
447 Ga0495684_0839449 3300047471 Unclassified 597
448 Ga0495602_0047897 3300048088 Bacteria 3846
449 Ga0496100_0161712 3300048903 Bacteria 1606
450 Ga0496100_0772358 3300048903 Bacteria 752
451 Ga0496101_0101046 3300048904 Bacteria 2159
452 Ga0496101_0403397 3300048904 Bacteria 1077
453 Ga0496102_0046761 3300048905 Bacteria 3931
454 Ga0496102_0171915 3300048905 Bacteria 2040
455 Ga0496102_0740600 3300048905 Unclassified 906
456 Ga0496102_0861232 3300048905 Bacteria 828
457 Ga0496103_0113423 3300048906 Bacteria 1723
458 Ga0496104_0195153 3300048907 Bacteria 1937
459 Ga0496104_1005614 3300048907 Unclassified 738
460 Ga0496104_1429766 3300048907 Unclassified 595
461 Ga0496106_1206584 3300048909 Unclassified 590
462 Ga0496108_0032355 3300048911 Unclassified 4345
463 Ga0496108_0132692 3300048911 Unclassified 2141
464 Ga0496108_0903849 3300048911 Bacteria 758
465 Ga0496109_0026304 3300048912 Bacteria 5188
466 Ga0496109_0073767 3300048912 Bacteria 3136
467 Ga0496109_0186322 3300048912 Bacteria 1950
468 Ga0496109_0562107 3300048912 Unclassified 1076
469 Ga0496110_0165372 3300048913 Unclassified 2006
470 Ga0496110_0210911 3300048913 Bacteria 1766
471 Ga0496111_0065476 3300048914 Bacteria 2638
472 Ga0496111_1112241 3300048914 Unclassified 563
473 Ga0496112_0017656 3300048915 Bacteria 6711
474 Ga0496112_0109739 3300048915 Bacteria 2729
475 Ga0496112_0578594 3300048915 Bacteria 1056
476 Ga0496112_0754828 3300048915 Bacteria 899
477 Ga0496113_0013643 3300048916 Bacteria 5515
478 Ga0496114_0011578 3300048917 Bacteria 7049
479 Ga0496115_0134167 3300048918 Bacteria 2041
480 Ga0496115_0204507 3300048918 Bacteria 1631
481 nmdc:mga05p37_442166_c1 3300050507 Bacteria 1507
482 nmdc:mga06r32_1500395_c1 3300050510 Unclassified 614
483 nmdc:mga08y16_361070_c1 3300050511 Unclassified 1491
484 nmdc:mga0n895_112184_c1 3300050512 Bacteria 2743
485 nmdc:mga0rr50_379147_c1 3300050513 Unclassified 1192
486 nmdc:mga08x19_1341863_c1 3300050514 Unclassified 506
487 nmdc:mga0a205_141552_c1 3300050515 Bacteria 2305
488 nmdc:mga0a205_334582_c1 3300050515 Bacteria 1383
489 Ga0495601_0267372 3300053077 Bacteria 1116
490 Ga0495595_0120285 3300053084 Bacteria 1279

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100249690 Ga0070708_1002496902 143
2 3300005518 Ga0070699_100707366 Ga0070699_1007073662 143
3 3300005536 Ga0070697_100236379 Ga0070697_1002363793 143
4 3300005289 Ga0065704_10044063 Ga0065704_100440632 146
5 3300005295 Ga0065707_10000986 Ga0065707_100009869 146
6 3300005347 Ga0070668_100694734 Ga0070668_1006947341 146
7 3300005434 Ga0070709_10621554 Ga0070709_106215541 146
8 3300005439 Ga0070711_100017632 Ga0070711_1000176326 146
9 3300005457 Ga0070662_100139986 Ga0070662_1001399862 146
10 3300005467 Ga0070706_100180367 Ga0070706_1001803673 146
11 3300005985 Ga0081539_10008376 Ga0081539_100083766 146
12 3300006175 Ga0070712_100014030 Ga0070712_1000140304 146
13 3300009094 Ga0111539_10248008 Ga0111539_102480082 146
14 3300013102 Ga0157371_10166480 Ga0157371_101664802 146
15 3300017792 Ga0163161_12091909 Ga0163161_120919091 146
16 3300025906 Ga0207699_10121973 Ga0207699_101219734 146
17 3300025915 Ga0207693_10009927 Ga0207693_100099278 146
18 3300025916 Ga0207663_10180101 Ga0207663_101801012 146
19 3300025926 Ga0207659_11218790 Ga0207659_112187901 146
20 3300025940 Ga0207691_10234615 Ga0207691_102346153 146
21 3300026121 Ga0207683_11204749 Ga0207683_112047492 146
22 3300035089 Ga0373944_0220672 Ga0373944_0220672_114_554 146
23 3300035170 Ga0373943_0085853 Ga0373943_0085853_733_1173 146
24 3300035171 Ga0373946_0583348 Ga0373946_0583348_53_493 146
25 3300035725 Ga0373947_0859258 Ga0373947_0859258_152_592 146
26 3300046472 Ga0495580_0191959 Ga0495580_0191959_260_700 146
27 3300046528 Ga0495642_0151944 Ga0495642_0151944_417_857 146
28 3300046537 Ga0495598_0039682 Ga0495598_0039682_192_632 146
29 3300048903 Ga0496100_0161712 Ga0496100_0161712_322_762 146
30 3300048905 Ga0496102_0740600 Ga0496102_0740600_14_454 146
31 3300050511 nmdc:mga08y16_361070_c1 nmdc:mga08y16_361070_c1_557_997 146
32 3300005289 Ga0065704_10455190 Ga0065704_104551901 147
33 3300005290 Ga0065712_10313863 Ga0065712_103138632 147
34 3300005293 Ga0065715_10245587 Ga0065715_102455872 147
35 3300005295 Ga0065707_11025741 Ga0065707_110257411 147
36 3300005340 Ga0070689_100267926 Ga0070689_1002679262 147
37 3300005353 Ga0070669_100021292 Ga0070669_1000212922 147
38 3300005354 Ga0070675_100205149 Ga0070675_1002051493 147
39 3300005364 Ga0070673_101895253 Ga0070673_1018952531 147
40 3300005435 Ga0070714_100235077 Ga0070714_1002350772 147
41 3300005436 Ga0070713_100073337 Ga0070713_1000733374 147
42 3300005440 Ga0070705_100141657 Ga0070705_1001416573 147
43 3300005467 Ga0070706_100846029 Ga0070706_1008460292 147
44 3300005468 Ga0070707_100007862 Ga0070707_1000078625 147
45 3300005471 Ga0070698_100006750 Ga0070698_1000067506 147
46 3300005536 Ga0070697_100228151 Ga0070697_1002281513 147
47 3300005536 Ga0070697_100613106 Ga0070697_1006131061 147
48 3300005543 Ga0070672_100603692 Ga0070672_1006036922 147
49 3300005545 Ga0070695_100037100 Ga0070695_1000371005 147
50 3300005577 Ga0068857_100022369 Ga0068857_1000223696 147
51 3300005577 Ga0068857_100568895 Ga0068857_1005688952 147
52 3300005614 Ga0068856_100735089 Ga0068856_1007350892 147
53 3300006028 Ga0070717_10006689 Ga0070717_1000668911 147
54 3300006028 Ga0070717_10390069 Ga0070717_103900693 147
55 3300006881 Ga0068865_101345582 Ga0068865_1013455821 147
56 3300009098 Ga0105245_13068283 Ga0105245_130682831 147
57 3300013296 Ga0157374_12338001 Ga0157374_123380011 147
58 3300013297 Ga0157378_10797283 Ga0157378_107972832 147
59 3300013306 Ga0163162_10237800 Ga0163162_102378001 147
60 3300013308 Ga0157375_10800363 Ga0157375_108003632 147
61 3300014745 Ga0157377_11604160 Ga0157377_116041601 147
62 3300025922 Ga0207646_10060905 Ga0207646_100609056 147
63 3300025923 Ga0207681_10052599 Ga0207681_100525994 147
64 3300025928 Ga0207700_10033804 Ga0207700_100338044 147
65 3300025938 Ga0207704_11159312 Ga0207704_111593122 147
66 3300025940 Ga0207691_10474906 Ga0207691_104749061 147
67 3300026035 Ga0207703_10576713 Ga0207703_105767132 147
68 3300026078 Ga0207702_10704887 Ga0207702_107048872 147
69 3300026116 Ga0207674_10022663 Ga0207674_100226635 147
70 3300035090 Ga0373949_0170828 Ga0373949_0170828_58_501 147
71 3300035170 Ga0373943_0094167 Ga0373943_0094167_77_520 147
72 3300035692 Ga0373935_0049354 Ga0373935_0049354_1823_2266 147
73 3300035692 Ga0373935_0267283 Ga0373935_0267283_52_495 147
74 3300035724 Ga0373933_0527668 Ga0373933_0527668_175_618 147
75 3300037068 Ga0373925_1031277 Ga0373925_1031277_83_526 147
76 3300037312 Ga0395899_0142991 Ga0395899_0142991_1082_1549 147
77 3300037418 Ga0395900_0040671 Ga0395900_0040671_2503_2970 147
78 3300037466 Ga0395898_0653873 Ga0395898_0653873_308_775 147
79 3300037471 Ga0395905_0707049 Ga0395905_0707049_258_725 147
80 3300038443 Ga0395901_0023891 Ga0395901_0023891_5735_6202 147
81 3300003911 JGI25405J52794_10153732 JGI25405J52794_101537321 148
82 3300005290 Ga0065712_10423776 Ga0065712_104237762 148
83 3300005328 Ga0070676_10266277 Ga0070676_102662772 148
84 3300005354 Ga0070675_100346512 Ga0070675_1003465123 148
85 3300005355 Ga0070671_100228507 Ga0070671_1002285072 148
86 3300005364 Ga0070673_101327376 Ga0070673_1013273761 148
87 3300005367 Ga0070667_100302667 Ga0070667_1003026672 148
88 3300005456 Ga0070678_100973604 Ga0070678_1009736042 148
89 3300005549 Ga0070704_101524229 Ga0070704_1015242292 148
90 3300005937 Ga0081455_10006446 Ga0081455_1000644615 148
91 3300005937 Ga0081455_10010873 Ga0081455_100108735 148
92 3300010159 Ga0099796_10436347 Ga0099796_104363471 148
93 3300013296 Ga0157374_10631584 Ga0157374_106315842 148
94 3300013296 Ga0157374_10652667 Ga0157374_106526672 148
95 3300013297 Ga0157378_10282552 Ga0157378_102825523 148
96 3300013297 Ga0157378_11132654 Ga0157378_111326542 148
97 3300013306 Ga0163162_11857613 Ga0163162_118576132 148
98 3300013308 Ga0157375_10302946 Ga0157375_103029461 148
99 3300025315 Ga0207697_10116820 Ga0207697_101168202 148
100 3300025925 Ga0207650_10795974 Ga0207650_107959742 148
101 3300025936 Ga0207670_10897520 Ga0207670_108975202 148
102 3300025945 Ga0207679_11023061 Ga0207679_110230612 148
103 3300026121 Ga0207683_10100256 Ga0207683_101002564 148
104 3300035116 Ga0373945_0138852 Ga0373945_0138852_278_724 148
105 3300035170 Ga0373943_0092084 Ga0373943_0092084_161_607 148
106 3300035692 Ga0373935_0085920 Ga0373935_0085920_1424_1870 148
107 3300035695 Ga0373927_0360090 Ga0373927_0360090_183_629 148
108 3300037068 Ga0373925_0104927 Ga0373925_0104927_387_833 148
109 3300037418 Ga0395900_0702342 Ga0395900_0702342_373_822 148
110 3300037418 Ga0395900_1779021 Ga0395900_1779021_36_485 148
111 3300038443 Ga0395901_0254323 Ga0395901_0254323_1070_1519 148
112 3300048907 Ga0496104_1005614 Ga0496104_1005614_70_519 148
113 3300048911 Ga0496108_0132692 Ga0496108_0132692_980_1429 148
114 3300048912 Ga0496109_0186322 Ga0496109_0186322_166_615 148
115 3300048914 Ga0496111_1112241 Ga0496111_1112241_25_474 148
116 3300048915 Ga0496112_0017656 Ga0496112_0017656_3854_4303 148
117 3300048915 Ga0496112_0109739 Ga0496112_0109739_1686_2135 148
118 3300050514 nmdc:mga08x19_1341863_c1 nmdc:mga08x19_1341863_c1_40_486 148
119 3300003203 JGI25406J46586_10240930 JGI25406J46586_102409301 149
120 3300005467 Ga0070706_100224719 Ga0070706_1002247194 149
121 3300005467 Ga0070706_101371105 Ga0070706_1013711052 149
122 3300005471 Ga0070698_100575820 Ga0070698_1005758202 149
123 3300005471 Ga0070698_100905225 Ga0070698_1009052251 149
124 3300005518 Ga0070699_101251460 Ga0070699_1012514601 149
125 3300005536 Ga0070697_100300940 Ga0070697_1003009403 149
126 3300005536 Ga0070697_101116269 Ga0070697_1011162692 149
127 3300005937 Ga0081455_10021810 Ga0081455_100218107 149
128 3300005983 Ga0081540_1069915 Ga0081540_10699152 149
129 3300005985 Ga0081539_10099835 Ga0081539_100998352 149
130 3300006852 Ga0075433_10169623 Ga0075433_101696234 149
131 3300006871 Ga0075434_100183270 Ga0075434_1001832702 149
132 3300009147 Ga0114129_10140286 Ga0114129_101402862 149
133 3300025910 Ga0207684_10099222 Ga0207684_100992223 149
134 3300025910 Ga0207684_10819916 Ga0207684_108199162 149
135 3300042439 Ga0439464_0111144 Ga0439464_0111144_319_768 149
136 3300042461 Ga0439460_0229869 Ga0439460_0229869_159_608 149
137 3300042993 Ga0439440_0109171 Ga0439440_0109171_158_607 149
138 3300050507 nmdc:mga05p37_442166_c1 nmdc:mga05p37_442166_c1_46_495 149
139 3300050512 nmdc:mga0n895_112184_c1 nmdc:mga0n895_112184_c1_2089_2628 149
140 3300050515 nmdc:mga0a205_141552_c1 nmdc:mga0a205_141552_c1_127_666 149
141 2162886007 SwRhRL2b_contig_1298596 SwRhRL2b_0211.00007770 150
142 2162886007 SwRhRL2b_contig_2531808 SwRhRL2b_0148.00002910 150
143 2162886007 SwRhRL2b_contig_3073330 SwRhRL2b_0998.00007780 150
144 3300001991 JGI24743J22301_10009542 JGI24743J22301_100095422 150
145 3300002126 JGI24035J26624_1001177 JGI24035J26624_10011772 150
146 3300003203 JGI25406J46586_10000005 JGI25406J46586_1000000549 150
147 3300005288 Ga0065714_10127204 Ga0065714_101272042 150
148 3300005289 Ga0065704_10393187 Ga0065704_103931871 150
149 3300005290 Ga0065712_10001986 Ga0065712_100019866 150
150 3300005290 Ga0065712_10003070 Ga0065712_100030708 150
151 3300005290 Ga0065712_10008286 Ga0065712_100082864 150
152 3300005290 Ga0065712_10010351 Ga0065712_100103515 150
153 3300005290 Ga0065712_10207420 Ga0065712_102074202 150
154 3300005293 Ga0065715_10002225 Ga0065715_1000222514 150
155 3300005293 Ga0065715_10008128 Ga0065715_100081286 150
156 3300005293 Ga0065715_10095299 Ga0065715_100952993 150
157 3300005293 Ga0065715_10104559 Ga0065715_101045593 150
158 3300005293 Ga0065715_10251641 Ga0065715_102516412 150
159 3300005295 Ga0065707_10197703 Ga0065707_101977031 150
160 3300005295 Ga0065707_11141255 Ga0065707_111412551 150
161 3300005327 Ga0070658_10197883 Ga0070658_101978833 150
162 3300005328 Ga0070676_10521905 Ga0070676_105219051 150
163 3300005329 Ga0070683_100016071 Ga0070683_1000160717 150
164 3300005329 Ga0070683_100257033 Ga0070683_1002570333 150
165 3300005329 Ga0070683_100298340 Ga0070683_1002983402 150
166 3300005330 Ga0070690_100125605 Ga0070690_1001256051 150
167 3300005331 Ga0070670_101170903 Ga0070670_1011709032 150
168 3300005335 Ga0070666_10047952 Ga0070666_100479524 150
169 3300005335 Ga0070666_10230446 Ga0070666_102304462 150
170 3300005336 Ga0070680_100036859 Ga0070680_1000368592 150
171 3300005337 Ga0070682_100274712 Ga0070682_1002747122 150
172 3300005337 Ga0070682_100380571 Ga0070682_1003805712 150
173 3300005337 Ga0070682_100829150 Ga0070682_1008291501 150
174 3300005338 Ga0068868_100192461 Ga0068868_1001924613 150
175 3300005338 Ga0068868_100352890 Ga0068868_1003528902 150
176 3300005339 Ga0070660_100533670 Ga0070660_1005336702 150
177 3300005339 Ga0070660_100660209 Ga0070660_1006602092 150
178 3300005340 Ga0070689_100058807 Ga0070689_1000588073 150
179 3300005343 Ga0070687_100044097 Ga0070687_1000440973 150
180 3300005343 Ga0070687_100366108 Ga0070687_1003661082 150
181 3300005344 Ga0070661_100035685 Ga0070661_1000356853 150
182 3300005344 Ga0070661_100051358 Ga0070661_1000513587 150
183 3300005344 Ga0070661_100706171 Ga0070661_1007061711 150
184 3300005347 Ga0070668_100032496 Ga0070668_1000324964 150
185 3300005353 Ga0070669_100644662 Ga0070669_1006446622 150
186 3300005354 Ga0070675_100047008 Ga0070675_1000470082 150
187 3300005354 Ga0070675_100058494 Ga0070675_1000584943 150
188 3300005354 Ga0070675_101359315 Ga0070675_1013593151 150
189 3300005355 Ga0070671_100704999 Ga0070671_1007049992 150
190 3300005364 Ga0070673_100298548 Ga0070673_1002985482 150
191 3300005365 Ga0070688_100018024 Ga0070688_1000180242 150
192 3300005365 Ga0070688_100046793 Ga0070688_1000467934 150
193 3300005365 Ga0070688_100061581 Ga0070688_1000615815 150
194 3300005366 Ga0070659_100002685 Ga0070659_1000026856 150
195 3300005366 Ga0070659_100290011 Ga0070659_1002900112 150
196 3300005434 Ga0070709_10092908 Ga0070709_100929083 150
197 3300005435 Ga0070714_100108519 Ga0070714_1001085192 150
198 3300005437 Ga0070710_10454869 Ga0070710_104548692 150
199 3300005437 Ga0070710_10700303 Ga0070710_107003031 150
200 3300005438 Ga0070701_10032536 Ga0070701_100325363 150
201 3300005439 Ga0070711_100108591 Ga0070711_1001085911 150
202 3300005439 Ga0070711_100237604 Ga0070711_1002376042 150
203 3300005439 Ga0070711_101578197 Ga0070711_1015781971 150
204 3300005440 Ga0070705_100041828 Ga0070705_1000418282 150
205 3300005441 Ga0070700_100064071 Ga0070700_1000640713 150
206 3300005444 Ga0070694_100085835 Ga0070694_1000858352 150
207 3300005445 Ga0070708_100019967 Ga0070708_1000199679 150
208 3300005445 Ga0070708_100036148 Ga0070708_1000361485 150
209 3300005445 Ga0070708_100193057 Ga0070708_1001930572 150
210 3300005445 Ga0070708_101615989 Ga0070708_1016159891 150
211 3300005455 Ga0070663_100048566 Ga0070663_1000485663 150
212 3300005455 Ga0070663_100633945 Ga0070663_1006339452 150
213 3300005456 Ga0070678_100079673 Ga0070678_1000796732 150
214 3300005456 Ga0070678_100215059 Ga0070678_1002150592 150
215 3300005457 Ga0070662_100378082 Ga0070662_1003780822 150
216 3300005458 Ga0070681_10013048 Ga0070681_100130487 150
217 3300005466 Ga0070685_10002918 Ga0070685_100029189 150
218 3300005466 Ga0070685_10234773 Ga0070685_102347731 150
219 3300005466 Ga0070685_10306022 Ga0070685_103060221 150
220 3300005467 Ga0070706_100032564 Ga0070706_1000325644 150
221 3300005467 Ga0070706_100048900 Ga0070706_1000489006 150
222 3300005468 Ga0070707_100347103 Ga0070707_1003471032 150
223 3300005530 Ga0070679_100038018 Ga0070679_1000380184 150
224 3300005535 Ga0070684_100002414 Ga0070684_1000024148 150
225 3300005535 Ga0070684_100032889 Ga0070684_1000328895 150
226 3300005535 Ga0070684_100077513 Ga0070684_1000775131 150
227 3300005535 Ga0070684_100738406 Ga0070684_1007384061 150
228 3300005535 Ga0070684_101400266 Ga0070684_1014002661 150
229 3300005536 Ga0070697_100005127 Ga0070697_10000512713 150
230 3300005536 Ga0070697_100268979 Ga0070697_1002689793 150
231 3300005543 Ga0070672_100040678 Ga0070672_1000406783 150
232 3300005544 Ga0070686_100016744 Ga0070686_1000167441 150
233 3300005544 Ga0070686_100042514 Ga0070686_1000425144 150
234 3300005548 Ga0070665_100028026 Ga0070665_1000280265 150
235 3300005548 Ga0070665_100063641 Ga0070665_1000636412 150
236 3300005548 Ga0070665_101588076 Ga0070665_1015880762 150
237 3300005549 Ga0070704_100393090 Ga0070704_1003930902 150
238 3300005563 Ga0068855_100773895 Ga0068855_1007738952 150
239 3300005564 Ga0070664_100203268 Ga0070664_1002032681 150
240 3300005564 Ga0070664_100792022 Ga0070664_1007920222 150
241 3300005577 Ga0068857_100536495 Ga0068857_1005364952 150
242 3300005614 Ga0068856_100086333 Ga0068856_1000863333 150
243 3300005614 Ga0068856_100706219 Ga0068856_1007062191 150
244 3300005616 Ga0068852_101280297 Ga0068852_1012802972 150
245 3300005617 Ga0068859_100056621 Ga0068859_1000566213 150
246 3300005840 Ga0068870_10713563 Ga0068870_107135632 150
247 3300005841 Ga0068863_100059451 Ga0068863_1000594514 150
248 3300005841 Ga0068863_100074687 Ga0068863_1000746877 150
249 3300005841 Ga0068863_101067514 Ga0068863_1010675142 150
250 3300005842 Ga0068858_100021640 Ga0068858_1000216405 150
251 3300005842 Ga0068858_100759315 Ga0068858_1007593152 150
252 3300005937 Ga0081455_10517902 Ga0081455_105179021 150
253 3300005985 Ga0081539_10000026 Ga0081539_10000026255 150
254 3300006028 Ga0070717_10022168 Ga0070717_100221684 150
255 3300006163 Ga0070715_10040498 Ga0070715_100404982 150
256 3300006173 Ga0070716_101536883 Ga0070716_1015368831 150
257 3300006175 Ga0070712_100336331 Ga0070712_1003363311 150
258 3300006175 Ga0070712_100445372 Ga0070712_1004453722 150
259 3300006237 Ga0097621_100591235 Ga0097621_1005912352 150
260 3300006358 Ga0068871_100106190 Ga0068871_1001061903 150
261 3300006358 Ga0068871_101324066 Ga0068871_1013240662 150
262 3300006881 Ga0068865_100486120 Ga0068865_1004861202 150
263 3300006931 Ga0097620_100056623 Ga0097620_1000566233 150
264 3300007788 Ga0099795_10001863 Ga0099795_100018635 150
265 3300007788 Ga0099795_10594662 Ga0099795_105946621 150
266 3300009098 Ga0105245_10160675 Ga0105245_101606752 150
267 3300009098 Ga0105245_10325073 Ga0105245_103250732 150
268 3300009101 Ga0105247_10154042 Ga0105247_101540423 150
269 3300009174 Ga0105241_10839342 Ga0105241_108393422 150
270 3300009174 Ga0105241_11246235 Ga0105241_112462351 150
271 3300009176 Ga0105242_10118817 Ga0105242_101188175 150
272 3300009177 Ga0105248_10177786 Ga0105248_101777863 150
273 3300009177 Ga0105248_10449262 Ga0105248_104492622 150
274 3300009177 Ga0105248_10611241 Ga0105248_106112412 150
275 3300009545 Ga0105237_10086135 Ga0105237_100861353 150
276 3300009553 Ga0105249_10017208 Ga0105249_100172082 150
277 3300009553 Ga0105249_10137538 Ga0105249_101375383 150
278 3300009553 Ga0105249_10350990 Ga0105249_103509902 150
279 3300010159 Ga0099796_10021985 Ga0099796_100219852 150
280 3300010159 Ga0099796_10127312 Ga0099796_101273122 150
281 3300010159 Ga0099796_10267695 Ga0099796_102676952 150
282 3300010375 Ga0105239_10439762 Ga0105239_104397622 150
283 3300010375 Ga0105239_10671889 Ga0105239_106718892 150
284 3300010375 Ga0105239_11191133 Ga0105239_111911331 150
285 3300011119 Ga0105246_10125509 Ga0105246_101255092 150
286 3300011119 Ga0105246_10565137 Ga0105246_105651372 150
287 3300012478 Ga0157328_1021225 Ga0157328_10212251 150
288 3300012505 Ga0157339_1050135 Ga0157339_10501351 150
289 3300013104 Ga0157370_10847024 Ga0157370_108470242 150
290 3300013105 Ga0157369_10322983 Ga0157369_103229832 150
291 3300013296 Ga0157374_10089386 Ga0157374_100893861 150
292 3300013296 Ga0157374_10126041 Ga0157374_101260413 150
293 3300013296 Ga0157374_10132105 Ga0157374_101321051 150
294 3300013296 Ga0157374_10404682 Ga0157374_104046823 150
295 3300013297 Ga0157378_10016502 Ga0157378_100165024 150
296 3300013297 Ga0157378_10026782 Ga0157378_100267824 150
297 3300013297 Ga0157378_10165834 Ga0157378_101658343 150
298 3300013297 Ga0157378_10266414 Ga0157378_102664141 150
299 3300013297 Ga0157378_10590495 Ga0157378_105904952 150
300 3300013306 Ga0163162_10396151 Ga0163162_103961512 150
301 3300013306 Ga0163162_11664141 Ga0163162_116641411 150
302 3300013307 Ga0157372_10438836 Ga0157372_104388362 150
303 3300013308 Ga0157375_10033405 Ga0157375_100334054 150
304 3300013308 Ga0157375_10154772 Ga0157375_101547722 150
305 3300014325 Ga0163163_10376579 Ga0163163_103765793 150
306 3300014325 Ga0163163_10763526 Ga0163163_107635262 150
307 3300014325 Ga0163163_10901763 Ga0163163_109017632 150
308 3300014745 Ga0157377_10021695 Ga0157377_100216954 150
309 3300014745 Ga0157377_10109672 Ga0157377_101096723 150
310 3300014745 Ga0157377_11520522 Ga0157377_115205221 150
311 3300014968 Ga0157379_10007258 Ga0157379_100072587 150
312 3300014969 Ga0157376_10038475 Ga0157376_100384753 150
313 3300014969 Ga0157376_10439082 Ga0157376_104390822 150
314 3300014969 Ga0157376_10683488 Ga0157376_106834882 150
315 3300014969 Ga0157376_11328554 Ga0157376_113285541 150
316 3300015261 Ga0182006_1042580 Ga0182006_10425803 150
317 3300017792 Ga0163161_10680101 Ga0163161_106801011 150
318 3300017792 Ga0163161_11000703 Ga0163161_110007031 150
319 3300017792 Ga0163161_11231178 Ga0163161_112311781 150
320 3300025271 Ga0207666_1000279 Ga0207666_10002798 150
321 3300025290 Ga0207673_1003496 Ga0207673_10034962 150
322 3300025290 Ga0207673_1003587 Ga0207673_10035873 150
323 3300025290 Ga0207673_1003690 Ga0207673_10036903 150
324 3300025315 Ga0207697_10002160 Ga0207697_100021608 150
325 3300025315 Ga0207697_10003050 Ga0207697_1000305010 150
326 3300025315 Ga0207697_10011161 Ga0207697_100111614 150
327 3300025315 Ga0207697_10012565 Ga0207697_100125654 150
328 3300025315 Ga0207697_10315536 Ga0207697_103155362 150
329 3300025885 Ga0207653_10054709 Ga0207653_100547091 150
330 3300025900 Ga0207710_10146991 Ga0207710_101469911 150
331 3300025903 Ga0207680_10049384 Ga0207680_100493843 150
332 3300025904 Ga0207647_10015620 Ga0207647_100156204 150
333 3300025905 Ga0207685_10115617 Ga0207685_101156172 150
334 3300025906 Ga0207699_10238075 Ga0207699_102380752 150
335 3300025906 Ga0207699_10656535 Ga0207699_106565351 150
336 3300025907 Ga0207645_10109188 Ga0207645_101091884 150
337 3300025907 Ga0207645_10594919 Ga0207645_105949191 150
338 3300025910 Ga0207684_10003031 Ga0207684_1000303117 150
339 3300025910 Ga0207684_10141736 Ga0207684_101417362 150
340 3300025911 Ga0207654_10377543 Ga0207654_103775432 150
341 3300025912 Ga0207707_10009207 Ga0207707_100092078 150
342 3300025912 Ga0207707_11088716 Ga0207707_110887162 150
343 3300025915 Ga0207693_10033176 Ga0207693_100331766 150
344 3300025915 Ga0207693_10287012 Ga0207693_102870123 150
345 3300025916 Ga0207663_10487925 Ga0207663_104879251 150
346 3300025917 Ga0207660_10033371 Ga0207660_100333714 150
347 3300025918 Ga0207662_10054942 Ga0207662_100549423 150
348 3300025918 Ga0207662_10131357 Ga0207662_101313573 150
349 3300025919 Ga0207657_10095412 Ga0207657_100954124 150
350 3300025920 Ga0207649_10029582 Ga0207649_100295824 150
351 3300025921 Ga0207652_10219588 Ga0207652_102195884 150
352 3300025922 Ga0207646_10030718 Ga0207646_100307186 150
353 3300025922 Ga0207646_10367265 Ga0207646_103672652 150
354 3300025922 Ga0207646_10475438 Ga0207646_104754382 150
355 3300025922 Ga0207646_10598911 Ga0207646_105989112 150
356 3300025926 Ga0207659_10020462 Ga0207659_100204624 150
357 3300025926 Ga0207659_10046276 Ga0207659_100462764 150
358 3300025926 Ga0207659_10071841 Ga0207659_100718414 150
359 3300025928 Ga0207700_10022036 Ga0207700_100220362 150
360 3300025931 Ga0207644_10041764 Ga0207644_100417645 150
361 3300025931 Ga0207644_10062264 Ga0207644_100622642 150
362 3300025932 Ga0207690_10020793 Ga0207690_100207933 150
363 3300025932 Ga0207690_10207131 Ga0207690_102071312 150
364 3300025932 Ga0207690_10786797 Ga0207690_107867972 150
365 3300025933 Ga0207706_10213282 Ga0207706_102132823 150
366 3300025933 Ga0207706_10439148 Ga0207706_104391482 150
367 3300025934 Ga0207686_10228456 Ga0207686_102284562 150
368 3300025936 Ga0207670_10126342 Ga0207670_101263423 150
369 3300025936 Ga0207670_10420392 Ga0207670_104203921 150
370 3300025937 Ga0207669_11002167 Ga0207669_110021671 150
371 3300025939 Ga0207665_10183063 Ga0207665_101830633 150
372 3300025940 Ga0207691_10041645 Ga0207691_100416455 150
373 3300025941 Ga0207711_10148805 Ga0207711_101488054 150
374 3300025941 Ga0207711_10361471 Ga0207711_103614712 150
375 3300025941 Ga0207711_10368750 Ga0207711_103687502 150
376 3300025942 Ga0207689_10250270 Ga0207689_102502702 150
377 3300025944 Ga0207661_10031091 Ga0207661_100310914 150
378 3300025944 Ga0207661_10273088 Ga0207661_102730882 150
379 3300025945 Ga0207679_10752705 Ga0207679_107527051 150
380 3300025960 Ga0207651_10046799 Ga0207651_100467992 150
381 3300025960 Ga0207651_11032082 Ga0207651_110320821 150
382 3300025961 Ga0207712_10006240 Ga0207712_100062404 150
383 3300025961 Ga0207712_10134322 Ga0207712_101343223 150
384 3300025972 Ga0207668_10020331 Ga0207668_100203313 150
385 3300026023 Ga0207677_10046961 Ga0207677_100469614 150
386 3300026035 Ga0207703_10016561 Ga0207703_100165614 150
387 3300026035 Ga0207703_10656276 Ga0207703_106562762 150
388 3300026035 Ga0207703_11422454 Ga0207703_114224542 150
389 3300026067 Ga0207678_10009753 Ga0207678_100097539 150
390 3300026067 Ga0207678_10059942 Ga0207678_100599425 150
391 3300026075 Ga0207708_10015316 Ga0207708_100153163 150
392 3300026078 Ga0207702_10086182 Ga0207702_100861824 150
393 3300026088 Ga0207641_10028509 Ga0207641_100285094 150
394 3300026088 Ga0207641_10242020 Ga0207641_102420203 150
395 3300026095 Ga0207676_10081849 Ga0207676_100818494 150
396 3300026095 Ga0207676_10865195 Ga0207676_108651952 150
397 3300026121 Ga0207683_10179139 Ga0207683_101791392 150
398 3300028379 Ga0268266_10017597 Ga0268266_100175974 150
399 3300028379 Ga0268266_10028113 Ga0268266_100281135 150
400 3300028381 Ga0268264_10036890 Ga0268264_100368903 150
401 3300035089 Ga0373944_0037848 Ga0373944_0037848_774_1226 150
402 3300035116 Ga0373945_0073149 Ga0373945_0073149_236_688 150
403 3300035117 Ga0373953_0053261 Ga0373953_0053261_881_1333 150
404 3300035171 Ga0373946_0294051 Ga0373946_0294051_198_650 150
405 3300035695 Ga0373927_0749326 Ga0373927_0749326_152_604 150
406 3300035724 Ga0373933_0316418 Ga0373933_0316418_315_767 150
407 3300035725 Ga0373947_0117875 Ga0373947_0117875_738_1190 150
408 3300035725 Ga0373947_0359836 Ga0373947_0359836_374_826 150
409 3300036401 Ga0373937_0506818 Ga0373937_0506818_12_464 150
410 3300037068 Ga0373925_0596356 Ga0373925_0596356_61_516 150
411 3300037418 Ga0395900_0105451 Ga0395900_0105451_1057_1512 150
412 3300037418 Ga0395900_0552510 Ga0395900_0552510_564_1022 150
413 3300037418 Ga0395900_1057540 Ga0395900_1057540_81_533 150
414 3300041441 Ga0451787_832899 Ga0451787_832899_129_581 150
415 3300041496 Ga0451839_1382909 Ga0451839_1382909_21_473 150
416 3300041503 Ga0451847_0043840 Ga0451847_0043840_79_531 150
417 3300044706 Ga0466964_0071168 Ga0466964_0071168_917_1369 150
418 3300045051 Ga0451576_0209162 Ga0451576_0209162_333_824 150
419 3300046455 Ga0495603_0129676 Ga0495603_0129676_213_665 150
420 3300046459 Ga0495629_0028413 Ga0495629_0028413_566_1018 150
421 3300046462 Ga0495651_0490482 Ga0495651_0490482_82_534 150
422 3300046475 Ga0495639_0049013 Ga0495639_0049013_363_815 150
423 3300046477 Ga0495664_0044459 Ga0495664_0044459_1876_2328 150
424 3300046477 Ga0495664_0270040 Ga0495664_0270040_446_901 150
425 3300046499 Ga0495594_0358526 Ga0495594_0358526_140_592 150
426 3300046511 Ga0495608_0509963 Ga0495608_0509963_32_484 150
427 3300046516 Ga0495628_0058212 Ga0495628_0058212_1281_1733 150
428 3300046517 Ga0495630_0064451 Ga0495630_0064451_680_1132 150
429 3300046517 Ga0495630_0178329 Ga0495630_0178329_936_1391 150
430 3300046517 Ga0495630_0475126 Ga0495630_0475126_212_664 150
431 3300046526 Ga0495666_0127671 Ga0495666_0127671_145_597 150
432 3300046529 Ga0495652_0085453 Ga0495652_0085453_1824_2276 150
433 3300046531 Ga0495665_0414483 Ga0495665_0414483_198_650 150
434 3300046533 Ga0495640_0071663 Ga0495640_0071663_1626_2078 150
435 3300046535 Ga0495586_0160951 Ga0495586_0160951_22_474 150
436 3300046536 Ga0495587_0057733 Ga0495587_0057733_1690_2142 150
437 3300046536 Ga0495587_0194826 Ga0495587_0194826_346_798 150
438 3300046543 Ga0495645_0147087 Ga0495645_0147087_216_668 150
439 3300046663 Ga0495635_0129927 Ga0495635_0129927_1159_1611 150
440 3300046675 Ga0495657_0380323 Ga0495657_0380323_152_604 150
441 3300046675 Ga0495657_0387066 Ga0495657_0387066_331_783 150
442 3300046678 Ga0495599_0023095 Ga0495599_0023095_1634_2086 150
443 3300046679 Ga0495623_0033348 Ga0495623_0033348_2351_2803 150
444 3300046680 Ga0495646_0014061 Ga0495646_0014061_4350_4802 150
445 3300046683 Ga0495658_0188236 Ga0495658_0188236_370_822 150
446 3300046684 Ga0495669_0241261 Ga0495669_0241261_284_736 150
447 3300046689 Ga0495613_0074007 Ga0495613_0074007_1856_2308 150
448 3300046689 Ga0495613_0545007 Ga0495613_0545007_166_618 150
449 3300046690 Ga0495624_0390496 Ga0495624_0390496_193_645 150
450 3300046691 Ga0495670_0447717 Ga0495670_0447717_186_638 150
451 3300047315 Ga0495581_0230705 Ga0495581_0230705_246_698 150
452 3300047317 Ga0495604_0191736 Ga0495604_0191736_822_1283 150
453 3300047317 Ga0495604_0269695 Ga0495604_0269695_133_585 150
454 3300047319 Ga0495674_0134606 Ga0495674_0134606_174_626 150
455 3300047319 Ga0495674_0187607 Ga0495674_0187607_249_701 150
456 3300047321 Ga0495676_0115349 Ga0495676_0115349_918_1370 150
457 3300047444 Ga0495675_0325291 Ga0495675_0325291_65_517 150
458 3300047446 Ga0495679_154626 Ga0495679_154626_18_470 150
459 3300047471 Ga0495684_0200892 Ga0495684_0200892_661_1113 150
460 3300047471 Ga0495684_0839449 Ga0495684_0839449_10_462 150
461 3300048088 Ga0495602_0047897 Ga0495602_0047897_1435_1887 150
462 3300048903 Ga0496100_0772358 Ga0496100_0772358_83_538 150
463 3300048904 Ga0496101_0101046 Ga0496101_0101046_269_721 150
464 3300048904 Ga0496101_0403397 Ga0496101_0403397_117_572 150
465 3300048905 Ga0496102_0046761 Ga0496102_0046761_1068_1520 150
466 3300048905 Ga0496102_0171915 Ga0496102_0171915_1463_1915 150
467 3300048905 Ga0496102_0861232 Ga0496102_0861232_115_570 150
468 3300048906 Ga0496103_0113423 Ga0496103_0113423_965_1417 150
469 3300048907 Ga0496104_0195153 Ga0496104_0195153_295_750 150
470 3300048907 Ga0496104_1429766 Ga0496104_1429766_59_511 150
471 3300048909 Ga0496106_1206584 Ga0496106_1206584_26_478 150
472 3300048911 Ga0496108_0032355 Ga0496108_0032355_79_531 150
473 3300048911 Ga0496108_0903849 Ga0496108_0903849_90_542 150
474 3300048912 Ga0496109_0026304 Ga0496109_0026304_1547_1999 150
475 3300048912 Ga0496109_0073767 Ga0496109_0073767_2286_2741 150
476 3300048912 Ga0496109_0562107 Ga0496109_0562107_364_816 150
477 3300048913 Ga0496110_0165372 Ga0496110_0165372_1347_1799 150
478 3300048913 Ga0496110_0210911 Ga0496110_0210911_1086_1538 150
479 3300048914 Ga0496111_0065476 Ga0496111_0065476_1815_2267 150
480 3300048915 Ga0496112_0578594 Ga0496112_0578594_432_884 150
481 3300048915 Ga0496112_0754828 Ga0496112_0754828_56_508 150
482 3300048916 Ga0496113_0013643 Ga0496113_0013643_1050_1502 150
483 3300048917 Ga0496114_0011578 Ga0496114_0011578_1320_1775 150
484 3300048918 Ga0496115_0134167 Ga0496115_0134167_142_594 150
485 3300048918 Ga0496115_0204507 Ga0496115_0204507_241_696 150
486 3300050510 nmdc:mga06r32_1500395_c1 nmdc:mga06r32_1500395_c1_112_564 150
487 3300050513 nmdc:mga0rr50_379147_c1 nmdc:mga0rr50_379147_c1_220_672 150
488 3300050515 nmdc:mga0a205_334582_c1 nmdc:mga0a205_334582_c1_914_1369 150
489 3300053077 Ga0495601_0267372 Ga0495601_0267372_424_876 150
490 3300053084 Ga0495595_0120285 Ga0495595_0120285_416_868 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

48

174

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8692 10 146
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8481 8 143
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8437 10 150
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.836 10 144
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.835 10 147
ID Description Score Start End Superfamily
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8481 8 143 3.30.530.20
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8431 8 144 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8375 9 144 3.30.530.20
af_Q9P782_203_333_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8368 9 144 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8355 10 147 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A556MWA0-F1-model_v4 SRPBCC domain-containing protein 0.9905 9 145
AF-A0A5D8YJ24-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9898 8 145
AF-A0A1T4N6W8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9874 9 144
AF-A0A1M3G0P2-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9865 10 143
AF-A0A2V5TTW4-F1-model_v4 SRPBCC domain-containing protein 0.9862 23 150

Feature Viewer

pLDDT pTM Quality
88.15 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map