F453919

General Info

Members Datasets Scaffolds Average Seq Length
490 249 980 118

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10922879|Ga0075433_109228793
Length 133
Sequence VNSGEGDNPGVCYVSQMEPAPVKPVITLEVLNQLDIRVGTIEAVSNVEGSDKLVALTVSFGNHARTIVAGMRLERQNPGEIVGRQALFVVNLAPRRMRGVLSEGMLFDLGYADGITPVLAVPEKPVPDGTRAG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 8.37
Rhizosphere 91.02
Stem 0
Stem Tuber 0
Unclassified 26.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10922879 3300006852 Unclassified 761
2 MRS1b_contig_3934405 2162886011 Bacteria 1097
3 Ga0065712_10088156 3300005290 Bacteria 2535
4 Ga0065715_10096824 3300005293 Bacteria 3812
5 Ga0065715_10113556 3300005293 Bacteria 2484
6 Ga0065715_10155845 3300005293 Unclassified 1678
7 Ga0065715_10228440 3300005293 Bacteria 1243
8 Ga0065715_10782838 3300005293 Bacteria 617
9 Ga0070676_10168143 3300005328 Bacteria 1416
10 Ga0070683_100358863 3300005329 Bacteria 1388
11 Ga0070683_100698729 3300005329 Bacteria 971
12 Ga0070683_100714900 3300005329 Unclassified 959
13 Ga0070683_101808105 3300005329 Bacteria 587
14 Ga0070690_100485929 3300005330 Bacteria 921
15 Ga0070690_100838585 3300005330 Unclassified 715
16 Ga0070670_100150964 3300005331 Bacteria 2011
17 Ga0070670_100345384 3300005331 Bacteria 1307
18 Ga0070670_100663589 3300005331 Bacteria 936
19 Ga0070670_100740405 3300005331 Bacteria 885
20 Ga0070670_101258614 3300005331 Unclassified 677
21 Ga0068869_100011893 3300005334 Bacteria 5724
22 Ga0068869_101083694 3300005334 Unclassified 700
23 Ga0070666_10002671 3300005335 Bacteria 10753
24 Ga0070666_10095514 3300005335 Bacteria 2046
25 Ga0070666_10354030 3300005335 Unclassified 1051
26 Ga0070682_100007498 3300005337 Bacteria 6150
27 Ga0068868_100006431 3300005338 Bacteria 8315
28 Ga0068868_100017315 3300005338 Bacteria 5365
29 Ga0068868_100076360 3300005338 Bacteria 2678
30 Ga0068868_100712510 3300005338 Bacteria 899
31 Ga0068868_101337499 3300005338 Bacteria 666
32 Ga0070660_100162249 3300005339 Bacteria 1801
33 Ga0070660_101532812 3300005339 Unclassified 567
34 Ga0070689_100001295 3300005340 Bacteria 15934
35 Ga0070691_10131081 3300005341 Bacteria 1271
36 Ga0070687_100053217 3300005343 Bacteria 2104
37 Ga0070661_100031857 3300005344 Bacteria 3814
38 Ga0070661_100210091 3300005344 Bacteria 1489
39 Ga0070668_100018129 3300005347 Bacteria 5282
40 Ga0070669_100108259 3300005353 Bacteria 2106
41 Ga0070669_100111860 3300005353 Bacteria 2073
42 Ga0070669_100387339 3300005353 Bacteria 1141
43 Ga0070675_100088356 3300005354 Bacteria 2593
44 Ga0070674_100540455 3300005356 Bacteria 976
45 Ga0070673_100173195 3300005364 Bacteria 1843
46 Ga0070673_100177147 3300005364 Bacteria 1823
47 Ga0070673_100209461 3300005364 Unclassified 1683
48 Ga0070673_100298111 3300005364 Bacteria 1419
49 Ga0070688_100013168 3300005365 Bacteria 4657
50 Ga0070688_100032670 3300005365 Bacteria 3140
51 Ga0070659_100187241 3300005366 Bacteria 1700
52 Ga0070667_100013832 3300005367 Bacteria 6670
53 Ga0070667_100158937 3300005367 Bacteria 1989
54 Ga0070667_100424041 3300005367 Bacteria 1213
55 Ga0070709_10059386 3300005434 Bacteria 2428
56 Ga0070714_100008796 3300005435 Bacteria 7895
57 Ga0070701_10109399 3300005438 Bacteria 1542
58 Ga0070700_100285478 3300005441 Bacteria 1198
59 Ga0070700_100290498 3300005441 Bacteria 1189
60 Ga0070694_100134916 3300005444 Bacteria 1787
61 Ga0070663_100023619 3300005455 Bacteria 4123
62 Ga0070663_100280391 3300005455 Bacteria 1328
63 Ga0070663_100320643 3300005455 Bacteria 1246
64 Ga0070678_100004708 3300005456 Bacteria 7770
65 Ga0070678_100183472 3300005456 Bacteria 1715
66 Ga0070662_100548672 3300005457 Unclassified 968
67 Ga0068867_100292769 3300005459 Bacteria 1339
68 Ga0070685_10045134 3300005466 Bacteria 2526
69 Ga0070706_100069057 3300005467 Bacteria 3268
70 Ga0070706_102075003 3300005467 Unclassified 514
71 Ga0070707_100146555 3300005468 Unclassified 2298
72 Ga0070707_101217569 3300005468 Unclassified 719
73 Ga0070699_100956076 3300005518 Bacteria 785
74 Ga0070679_100128058 3300005530 Bacteria 2520
75 Ga0070684_100170882 3300005535 Bacteria 1974
76 Ga0070684_101140546 3300005535 Unclassified 733
77 Ga0070697_101194498 3300005536 Unclassified 678
78 Ga0068853_100039185 3300005539 Bacteria 4041
79 Ga0070672_100007982 3300005543 Bacteria 7230
80 Ga0070672_100178945 3300005543 Bacteria 1766
81 Ga0070672_101032830 3300005543 Bacteria 729
82 Ga0070686_100002080 3300005544 Bacteria 11057
83 Ga0070686_100219324 3300005544 Unclassified 1374
84 Ga0070686_101390937 3300005544 Bacteria 588
85 Ga0070695_100118971 3300005545 Bacteria 1804
86 Ga0070695_100571009 3300005545 Bacteria 884
87 Ga0070696_100036801 3300005546 Bacteria 3375
88 Ga0070665_100196812 3300005548 Bacteria 2016
89 Ga0070665_100524926 3300005548 Unclassified 1196
90 Ga0070665_100739091 3300005548 Bacteria 997
91 Ga0070704_100188431 3300005549 Bacteria 1656
92 Ga0068855_100144209 3300005563 Bacteria 2712
93 Ga0070664_100001474 3300005564 Bacteria 18768
94 Ga0070664_100034943 3300005564 Bacteria 4218
95 Ga0070664_100408310 3300005564 Bacteria 1243
96 Ga0068857_100019131 3300005577 Bacteria 6010
97 Ga0068857_101510842 3300005577 Bacteria 654
98 Ga0068854_100001461 3300005578 Bacteria 14306
99 Ga0068854_100007522 3300005578 Bacteria 6962
100 Ga0068856_100019308 3300005614 Bacteria 6616
101 Ga0068856_100096260 3300005614 Bacteria 2949
102 Ga0070702_100385950 3300005615 Bacteria 997
103 Ga0068852_100004238 3300005616 Bacteria 10126
104 Ga0068852_102029390 3300005616 Unclassified 597
105 Ga0068859_100028488 3300005617 Bacteria 5600
106 Ga0068859_100032862 3300005617 Bacteria 5212
107 Ga0068859_100602857 3300005617 Bacteria 1191
108 Ga0068859_100773923 3300005617 Bacteria 1048
109 Ga0068859_102990285 3300005617 Bacteria 517
110 Ga0068864_100000070 3300005618 Bacteria 113700
111 Ga0068864_100012255 3300005618 Bacteria 7085
112 Ga0068864_100042223 3300005618 Bacteria 3902
113 Ga0068864_100123530 3300005618 Bacteria 2317
114 Ga0068866_10266164 3300005718 Bacteria 1056
115 Ga0068861_100123203 3300005719 Bacteria 2094
116 Ga0068861_100328532 3300005719 Bacteria 1334
117 Ga0068861_100338095 3300005719 Bacteria 1317
118 Ga0068851_10003443 3300005834 Bacteria 7043
119 Ga0068870_10151458 3300005840 Bacteria 1367
120 Ga0068863_100006892 3300005841 Bacteria 11132
121 Ga0068863_100098223 3300005841 Unclassified 2781
122 Ga0068863_100395998 3300005841 Unclassified 1350
123 Ga0068863_101451219 3300005841 Unclassified 694
124 Ga0068863_101830216 3300005841 Unclassified 617
125 Ga0068858_100000306 3300005842 Bacteria 52410
126 Ga0068858_100037007 3300005842 Bacteria 4524
127 Ga0068858_100206715 3300005842 Bacteria 1857
128 Ga0068858_100341537 3300005842 Bacteria 1433
129 Ga0068858_101534382 3300005842 Unclassified 657
130 Ga0068860_100139786 3300005843 Bacteria 2327
131 Ga0068860_100243845 3300005843 Bacteria 1748
132 Ga0068860_100763871 3300005843 Unclassified 979
133 Ga0068860_101123289 3300005843 Bacteria 805
134 Ga0068860_102051135 3300005843 Bacteria 593
135 Ga0068862_100464473 3300005844 Bacteria 1195
136 Ga0081540_1088454 3300005983 Bacteria 1369
137 Ga0070716_100152546 3300006173 Bacteria 1488
138 Ga0070716_100526449 3300006173 Unclassified 877
139 Ga0070712_100018770 3300006175 Bacteria 4497
140 Ga0070712_101117482 3300006175 Unclassified 684
141 Ga0097621_100023399 3300006237 Bacteria 4811
142 Ga0097621_100055455 3300006237 Bacteria 3236
143 Ga0097621_100261061 3300006237 Bacteria 1519
144 Ga0097621_100791724 3300006237 Unclassified 878
145 Ga0068871_100016597 3300006358 Bacteria 5551
146 Ga0068871_100290098 3300006358 Bacteria 1433
147 Ga0075428_100513241 3300006844 Bacteria 1282
148 Ga0075431_101233461 3300006847 Bacteria 710
149 Ga0075433_10005654 3300006852 Bacteria 9823
150 Ga0075433_10075447 3300006852 Unclassified 2967
151 Ga0075433_10791169 3300006852 Bacteria 829
152 Ga0075434_100004039 3300006871 Bacteria 13156
153 Ga0075434_100152969 3300006871 Unclassified 2327
154 Ga0075434_100283292 3300006871 Bacteria 1677
155 Ga0075434_100521785 3300006871 Bacteria 1208
156 Ga0068865_100406036 3300006881 Bacteria 1117
157 Ga0068865_100426647 3300006881 Unclassified 1091
158 Ga0068865_101667191 3300006881 Unclassified 574
159 Ga0075436_100159001 3300006914 Bacteria 1592
160 Ga0075436_100491702 3300006914 Bacteria 897
161 Ga0097620_100028488 3300006931 Bacteria 5600
162 Ga0097620_100032861 3300006931 Bacteria 5212
163 Ga0097620_100602825 3300006931 Bacteria 1191
164 Ga0097620_100773934 3300006931 Bacteria 1048
165 Ga0097620_102989417 3300006931 Bacteria 517
166 Ga0075435_100000461 3300007076 Bacteria 24879
167 Ga0075435_100016641 3300007076 Bacteria 5546
168 Ga0075435_100067628 3300007076 Unclassified 2909
169 Ga0075435_100087116 3300007076 Unclassified 2572
170 Ga0075435_100743596 3300007076 Unclassified 853
171 Ga0075435_101710500 3300007076 Bacteria 552
172 Ga0105251_10047820 3300009011 Bacteria 2054
173 Ga0105240_10058456 3300009093 Bacteria 4814
174 Ga0105240_10082032 3300009093 Bacteria 3961
175 Ga0105240_10109717 3300009093 Bacteria 3341
176 Ga0105240_10324166 3300009093 Bacteria 1755
177 Ga0105245_10008762 3300009098 Bacteria 8822
178 Ga0105245_10213732 3300009098 Bacteria 1857
179 Ga0105245_10906225 3300009098 Unclassified 923
180 Ga0105247_10068574 3300009101 Bacteria 2212
181 Ga0114129_10000993 3300009147 Bacteria 37109
182 Ga0105243_10092196 3300009148 Unclassified 2497
183 Ga0105241_10006237 3300009174 Bacteria 8789
184 Ga0105241_10124260 3300009174 Bacteria 2082
185 Ga0105241_10133838 3300009174 Bacteria 2010
186 Ga0105241_10469461 3300009174 Bacteria 1116
187 Ga0105241_12405129 3300009174 Unclassified 526
188 Ga0105242_10575323 3300009176 Bacteria 1084
189 Ga0105242_12586601 3300009176 Unclassified 556
190 Ga0105248_10014646 3300009177 Bacteria 8629
191 Ga0105248_10015991 3300009177 Bacteria 8260
192 Ga0105248_10052744 3300009177 Bacteria 4564
193 Ga0105248_10197821 3300009177 Bacteria 2265
194 Ga0105248_10829592 3300009177 Bacteria 1043
195 Ga0105238_10005459 3300009551 Bacteria 12562
196 Ga0105238_10078520 3300009551 Bacteria 3291
197 Ga0105238_10212619 3300009551 Unclassified 1910
198 Ga0105249_10003055 3300009553 Bacteria 14445
199 Ga0105249_10907966 3300009553 Unclassified 948
200 Ga0105239_10044069 3300010375 Bacteria 4891
201 Ga0105239_10345650 3300010375 Bacteria 1679
202 Ga0105239_11109188 3300010375 Unclassified 911
203 Ga0105239_11546669 3300010375 Unclassified 767
204 Ga0105239_12968993 3300010375 Unclassified 553
205 Ga0105246_10005741 3300011119 Bacteria 7575
206 Ga0157373_10063322 3300013100 Unclassified 2619
207 Ga0157373_10208014 3300013100 Bacteria 1379
208 Ga0157371_10005072 3300013102 Bacteria 11245
209 Ga0157370_10190171 3300013104 Bacteria 1905
210 Ga0157369_10029190 3300013105 Bacteria 6098
211 Ga0157374_10024406 3300013296 Bacteria 5422
212 Ga0157374_10179985 3300013296 Bacteria 2064
213 Ga0157378_10005797 3300013297 Bacteria 10826
214 Ga0157378_10329738 3300013297 Bacteria 1485
215 Ga0157378_10391808 3300013297 Bacteria 1366
216 Ga0157378_10735612 3300013297 Bacteria 1008
217 Ga0157378_12977394 3300013297 Unclassified 525
218 Ga0157378_13259038 3300013297 Unclassified 504
219 Ga0163162_10163030 3300013306 Bacteria 2352
220 Ga0163162_10220855 3300013306 Bacteria 2025
221 Ga0163162_10232287 3300013306 Bacteria 1975
222 Ga0163162_10753836 3300013306 Unclassified 1093
223 Ga0157375_10039097 3300013308 Bacteria 4562
224 Ga0157375_10219813 3300013308 Bacteria 2058
225 Ga0157375_10627941 3300013308 Bacteria 1232
226 Ga0163163_10026114 3300014325 Bacteria 5577
227 Ga0163163_10165662 3300014325 Bacteria 2256
228 Ga0157377_10000024 3300014745 Bacteria 142391
229 Ga0157377_10033722 3300014745 Bacteria 2796
230 Ga0157377_10295305 3300014745 Bacteria 1067
231 Ga0157377_11446352 3300014745 Unclassified 544
232 Ga0157379_10084116 3300014968 Bacteria 2852
233 Ga0157379_10395182 3300014968 Bacteria 1270
234 Ga0157376_10018268 3300014969 Bacteria 5370
235 Ga0157376_10117408 3300014969 Bacteria 2352
236 Ga0157376_10431061 3300014969 Bacteria 1281
237 Ga0157376_10561093 3300014969 Bacteria 1131
238 Ga0163161_10269526 3300017792 Bacteria 1332
239 Ga0206354_10370791 3300020081 Bacteria 3822
240 Ga0206353_10015191 3300020082 Bacteria 1886
241 Ga0213872_10000149 3300021361 Bacteria 64009
242 Ga0207656_10001883 3300025321 Bacteria 6984
243 Ga0207642_10031262 3300025899 Bacteria 2228
244 Ga0207642_10254068 3300025899 Bacteria 999
245 Ga0207710_10220885 3300025900 Unclassified 941
246 Ga0207680_10027718 3300025903 Bacteria 3159
247 Ga0207680_10031952 3300025903 Bacteria 2986
248 Ga0207680_10072107 3300025903 Bacteria 2143
249 Ga0207647_10223271 3300025904 Bacteria 1085
250 Ga0207699_10516890 3300025906 Bacteria 863
251 Ga0207645_10004273 3300025907 Bacteria 10603
252 Ga0207643_10107222 3300025908 Bacteria 1643
253 Ga0207684_10789136 3300025910 Unclassified 803
254 Ga0207684_11333828 3300025910 Unclassified 590
255 Ga0207654_10013486 3300025911 Bacteria 4206
256 Ga0207654_10064090 3300025911 Bacteria 2159
257 Ga0207654_10079863 3300025911 Bacteria 1966
258 Ga0207654_10246966 3300025911 Unclassified 1195
259 Ga0207707_10177786 3300025912 Bacteria 1858
260 Ga0207707_10588622 3300025912 Unclassified 942
261 Ga0207695_10016663 3300025913 Bacteria 8587
262 Ga0207695_10420341 3300025913 Bacteria 1221
263 Ga0207695_10473630 3300025913 Unclassified 1135
264 Ga0207695_10870433 3300025913 Unclassified 781
265 Ga0207671_10585271 3300025914 Bacteria 890
266 Ga0207662_10005754 3300025918 Bacteria 6636
267 Ga0207657_10000766 3300025919 Bacteria 34045
268 Ga0207649_10028595 3300025920 Bacteria 3283
269 Ga0207652_10123141 3300025921 Bacteria 2308
270 Ga0207652_10135200 3300025921 Bacteria 2201
271 Ga0207646_10171263 3300025922 Unclassified 1961
272 Ga0207646_10944191 3300025922 Unclassified 764
273 Ga0207681_10293649 3300025923 Bacteria 1284
274 Ga0207681_10644666 3300025923 Unclassified 878
275 Ga0207694_10000724 3300025924 Bacteria 29652
276 Ga0207694_10230625 3300025924 Unclassified 1512
277 Ga0207694_10951255 3300025924 Bacteria 727
278 Ga0207650_10029758 3300025925 Bacteria 3928
279 Ga0207650_10076667 3300025925 Bacteria 2526
280 Ga0207650_10286092 3300025925 Unclassified 1343
281 Ga0207650_10476629 3300025925 Bacteria 1041
282 Ga0207659_10358594 3300025926 Bacteria 1211
283 Ga0207687_10000501 3300025927 Bacteria 26436
284 Ga0207687_10014291 3300025927 Bacteria 5194
285 Ga0207687_11555841 3300025927 Unclassified 568
286 Ga0207700_10007127 3300025928 Bacteria 6812
287 Ga0207664_10005433 3300025929 Bacteria 8709
288 Ga0207644_10806579 3300025931 Unclassified 785
289 Ga0207644_11703889 3300025931 Unclassified 528
290 Ga0207690_10290508 3300025932 Unclassified 1276
291 Ga0207706_10000956 3300025933 Bacteria 29545
292 Ga0207706_10036801 3300025933 Bacteria 4347
293 Ga0207706_10203464 3300025933 Bacteria 1736
294 Ga0207706_10224424 3300025933 Bacteria 1644
295 Ga0207686_10093717 3300025934 Bacteria 1989
296 Ga0207709_10165396 3300025935 Bacteria 1547
297 Ga0207670_10001092 3300025936 Bacteria 14293
298 Ga0207670_10155328 3300025936 Bacteria 1702
299 Ga0207669_10316412 3300025937 Bacteria 1193
300 Ga0207704_10011012 3300025938 Bacteria 4437
301 Ga0207704_10133788 3300025938 Unclassified 1722
302 Ga0207704_10189484 3300025938 Unclassified 1495
303 Ga0207665_10695974 3300025939 Unclassified 799
304 Ga0207691_10028853 3300025940 Bacteria 5193
305 Ga0207691_10055115 3300025940 Bacteria 3625
306 Ga0207711_10029061 3300025941 Bacteria 4660
307 Ga0207711_10076017 3300025941 Bacteria 2924
308 Ga0207689_10044147 3300025942 Bacteria 3685
309 Ga0207689_10357361 3300025942 Bacteria 1215
310 Ga0207689_10430136 3300025942 Unclassified 1102
311 Ga0207661_10344145 3300025944 Bacteria 1344
312 Ga0207679_10057026 3300025945 Unclassified 2887
313 Ga0207679_10660483 3300025945 Bacteria 946
314 Ga0207667_10022760 3300025949 Bacteria 6912
315 Ga0207651_10108631 3300025960 Bacteria 2077
316 Ga0207651_10373081 3300025960 Bacteria 1207
317 Ga0207651_10562138 3300025960 Bacteria 993
318 Ga0207712_10011595 3300025961 Bacteria 5620
319 Ga0207712_10013126 3300025961 Bacteria 5307
320 Ga0207668_10104396 3300025972 Bacteria 2112
321 Ga0207668_10273098 3300025972 Bacteria 1383
322 Ga0207640_10015265 3300025981 Bacteria 4443
323 Ga0207640_10024485 3300025981 Bacteria 3642
324 Ga0207658_10030505 3300025986 Bacteria 3818
325 Ga0207658_10111069 3300025986 Bacteria 2167
326 Ga0207677_10000050 3300026023 Bacteria 100733
327 Ga0207677_11059628 3300026023 Bacteria 737
328 Ga0207677_11984423 3300026023 Unclassified 541
329 Ga0207703_10000104 3300026035 Bacteria 99914
330 Ga0207703_10123393 3300026035 Unclassified 2226
331 Ga0207703_10381831 3300026035 Bacteria 1303
332 Ga0207639_10480514 3300026041 Bacteria 1132
333 Ga0207678_10000887 3300026067 Bacteria 27526
334 Ga0207708_10546895 3300026075 Bacteria 976
335 Ga0207702_10088826 3300026078 Bacteria 2701
336 Ga0207702_10093709 3300026078 Bacteria 2634
337 Ga0207641_10042835 3300026088 Bacteria 3799
338 Ga0207641_10231818 3300026088 Bacteria 1716
339 Ga0207641_10952525 3300026088 Unclassified 854
340 Ga0207641_11132851 3300026088 Unclassified 781
341 Ga0207641_11530321 3300026088 Unclassified 669
342 Ga0207648_10023453 3300026089 Bacteria 5527
343 Ga0207648_10032011 3300026089 Bacteria 4647
344 Ga0207648_10788050 3300026089 Bacteria 884
345 Ga0207676_10000014 3300026095 Bacteria 339896
346 Ga0207676_10268667 3300026095 Bacteria 1543
347 Ga0207676_11180940 3300026095 Unclassified 758
348 Ga0207675_100080283 3300026118 Bacteria 3058
349 Ga0207683_10002258 3300026121 Bacteria 16908
350 Ga0207683_10237398 3300026121 Bacteria 1663
351 Ga0207683_10308972 3300026121 Bacteria 1447
352 Ga0207683_11662202 3300026121 Bacteria 588
353 Ga0207683_11804193 3300026121 Unclassified 561
354 Ga0268266_10014210 3300028379 Bacteria 6850
355 Ga0268266_10015063 3300028379 Bacteria 6639
356 Ga0268266_10028843 3300028379 Bacteria 4717
357 Ga0268265_10981848 3300028380 Bacteria 833
358 Ga0268264_10179370 3300028381 Bacteria 1922
359 Ga0268264_10248089 3300028381 Bacteria 1652
360 Ga0268264_10524019 3300028381 Bacteria 1159
361 Ga0268264_11139980 3300028381 Bacteria 789
362 Ga0265330_10050776 3300031235 Bacteria 1819
363 Ga0265328_10412383 3300031239 Unclassified 531
364 Ga0265329_10030675 3300031242 Bacteria 1751
365 Ga0265340_10070106 3300031247 Bacteria 1663
366 Ga0265339_10038442 3300031249 Bacteria 2670
367 Ga0265331_10025169 3300031250 Bacteria 3006
368 Ga0265316_10057023 3300031344 Bacteria 3048
369 Ga0316579_10038020 3300031691 Bacteria 2224
370 Ga0265342_10251334 3300031712 Bacteria 943
371 Ga0316576_10060691 3300031727 Bacteria 2770
372 Ga0316578_10068847 3300031728 Unclassified 2093
373 Ga0373930_0003906 3300034816 Bacteria 2394
374 Ga0373958_0180216 3300034819 Unclassified 544
375 Ga0373951_0078842 3300035091 Unclassified 850
376 Ga0373952_0067021 3300035092 Unclassified 890
377 Ga0373932_0031625 3300035112 Unclassified 1476
378 Ga0373954_0085553 3300035118 Unclassified 1510
379 Ga0373960_0067607 3300035121 Unclassified 1098
380 Ga0373955_0666075 3300035172 Bacteria 638
381 Ga0373962_0014012 3300035242 Bacteria 2038
382 Ga0316574_0706844 3300035398 Unclassified 618
383 Ga0373931_0033871 3300035691 Unclassified 2648
384 Ga0373931_0061891 3300035691 Bacteria 2019
385 Ga0373927_0418464 3300035695 Unclassified 884
386 Ga0373933_0225604 3300035724 Unclassified 1203
387 Ga0373937_0016240 3300036401 Bacteria 6607
388 Ga0373937_0106007 3300036401 Bacteria 2613
389 Ga0316582_0112797 3300036647 Unclassified 1811
390 Ga0373925_0851812 3300037068 Unclassified 751
391 Ga0316581_0052543 3300037588 Unclassified 1249
392 Ga0436364_0360857 3300037853 Bacteria 3017
393 Ga0242420_009145 3300038996 Unclassified 1622
394 Ga0436361_0446407 3300039447 Bacteria 1161
395 Ga0436361_0996671 3300039447 Bacteria 46796
396 Ga0451802_0758532 3300041460 Unclassified 530
397 Ga0451853_2486478 3300041512 Bacteria 1060
398 Ga0453684_0434530 3300044712 Bacteria 1464
399 Ga0495603_0246304 3300046455 Unclassified 1029
400 Ga0495651_0049060 3300046462 Unclassified 3259
401 Ga0495580_0000967 3300046472 Bacteria 25191
402 Ga0495580_0106883 3300046472 Unclassified 1944
403 Ga0495580_0239205 3300046472 Unclassified 1245
404 Ga0495639_0410140 3300046475 Bacteria 685
405 Ga0495594_0385678 3300046499 Unclassified 797
406 Ga0495628_0097389 3300046516 Bacteria 2273
407 Ga0495628_0171890 3300046516 Bacteria 1643
408 Ga0495665_0168096 3300046531 Bacteria 1142
409 Ga0495587_0109800 3300046536 Unclassified 1585
410 Ga0495645_0098721 3300046543 Unclassified 2078
411 Ga0495667_0066557 3300046559 Bacteria 2355
412 Ga0495599_0023415 3300046678 Bacteria 3861
413 Ga0495599_0122230 3300046678 Unclassified 1618
414 Ga0495658_0828298 3300046683 Unclassified 592
415 Ga0495581_0362545 3300047315 Bacteria 846
416 Ga0495604_0131776 3300047317 Bacteria 1796
417 Ga0495674_0676431 3300047319 Unclassified 812
418 Ga0495674_1166261 3300047319 Unclassified 584
419 Ga0495675_0468537 3300047444 Unclassified 727
420 Ga0495684_0002122 3300047471 Bacteria 15917
421 Ga0495602_0578542 3300048088 Unclassified 775
422 Ga0496100_0129038 3300048903 Bacteria 1778
423 Ga0496101_1163266 3300048904 Unclassified 605
424 Ga0496102_0040336 3300048905 Bacteria 4223
425 Ga0496102_0085031 3300048905 Bacteria 2920
426 Ga0496102_0186467 3300048905 Bacteria 1955
427 Ga0496102_0231689 3300048905 Bacteria 1741
428 Ga0496102_1053539 3300048905 Bacteria 733
429 Ga0496102_1720957 3300048905 Bacteria 545
430 Ga0496103_0212229 3300048906 Unclassified 1245
431 Ga0496103_0695869 3300048906 Bacteria 644
432 Ga0496104_0022162 3300048907 Bacteria 5837
433 Ga0496104_0083267 3300048907 Bacteria 3051
434 Ga0496104_0222455 3300048907 Bacteria 1800
435 Ga0496105_0084774 3300048908 Bacteria 2618
436 Ga0496105_0329095 3300048908 Bacteria 1223
437 Ga0496105_1073040 3300048908 Unclassified 599
438 Ga0496106_0018468 3300048909 Bacteria 5157
439 Ga0496106_0146383 3300048909 Bacteria 1861
440 Ga0496106_0295774 3300048909 Unclassified 1298
441 Ga0496106_0453710 3300048909 Bacteria 1030
442 Ga0496107_0168810 3300048910 Unclassified 1623
443 Ga0496108_0253261 3300048911 Bacteria 1532
444 Ga0496108_0765016 3300048911 Bacteria 835
445 Ga0496109_0003475 3300048912 Bacteria 13154
446 Ga0496109_0121197 3300048912 Unclassified 2437
447 Ga0496109_0919784 3300048912 Bacteria 813
448 Ga0496110_0111699 3300048913 Bacteria 2457
449 Ga0496110_0350971 3300048913 Bacteria 1344
450 Ga0496111_0278487 3300048914 Bacteria 1241
451 Ga0496112_0003226 3300048915 Bacteria 13432
452 Ga0496112_0023044 3300048915 Bacteria 5942
453 Ga0496112_0037538 3300048915 Bacteria 4728
454 Ga0496112_0150147 3300048915 Bacteria 2297
455 Ga0496112_0371605 3300048915 Bacteria 1371
456 Ga0496112_1613361 3300048915 Unclassified 562
457 Ga0496113_0205570 3300048916 Bacteria 1566
458 Ga0496113_0315999 3300048916 Bacteria 1252
459 Ga0496113_0378422 3300048916 Bacteria 1136
460 Ga0496114_1661006 3300048917 Unclassified 527
461 Ga0496115_0028171 3300048918 Bacteria 4401
462 Ga0501033_0283544 3300049570 Unclassified 1169
463 Ga0501040_0246846 3300049576 Unclassified 1273
464 Ga0501042_0251471 3300049578 Unclassified 1275
465 Ga0501072_0053441 3300049588 Unclassified 3181
466 Ga0501076_0036295 3300049592 Bacteria 3862
467 Ga0501077_0164928 3300049593 Bacteria 1407
468 Ga0501079_0147481 3300049741 Bacteria 1834
469 Ga0501081_0171517 3300049743 Unclassified 1566
470 nmdc:mga05p37_18114_c1 3300050507 Bacteria 8508
471 nmdc:mga05p37_1916355_c1 3300050507 Unclassified 565
472 nmdc:mga06r32_805105_c1 3300050510 Bacteria 900
473 nmdc:mga0n895_383403_c1 3300050512 Bacteria 1422
474 nmdc:mga0n895_4917_c1 3300050512 Bacteria 11080
475 nmdc:mga0n895_493077_c1 3300050512 Unclassified 1235
476 nmdc:mga0n895_506973_c1 3300050512 Unclassified 1215
477 nmdc:mga0n895_66869_c1 3300050512 Unclassified 3558
478 nmdc:mga0rr50_118830_c1 3300050513 Unclassified 2101
479 nmdc:mga0rr50_1802_c1 3300050513 Bacteria 10231
480 nmdc:mga0rr50_65972_c1 3300050513 Bacteria 2744
481 nmdc:mga0rr50_691_c1 3300050513 Bacteria 18017
482 nmdc:mga0rr50_85289_c2 3300050513 Bacteria 1549
483 nmdc:mga08x19_143607_c1 3300050514 Bacteria 1613
484 nmdc:mga08x19_282800_c1 3300050514 Unclassified 1150
485 nmdc:mga08x19_755450_c1 3300050514 Unclassified 690
486 nmdc:mga0a205_270_c1 3300050515 Bacteria 37618
487 nmdc:mga0a205_781306_c1 3300050515 Unclassified 803
488 nmdc:mga0a205_89607_c1 3300050515 Unclassified 2973
489 Ga0495619_0158123 3300053085 Bacteria 1564
490 Ga0500641_0082774 3300053096 Bacteria 1364
491 Ga0075433_10922879
492 MRS1b_contig_3934405
493 Ga0065712_10088156
494 Ga0065715_10096824
495 Ga0065715_10113556
496 Ga0065715_10155845
497 Ga0065715_10228440
498 Ga0065715_10782838
499 Ga0070676_10168143
500 Ga0070683_100358863
501 Ga0070683_100698729
502 Ga0070683_100714900
503 Ga0070683_101808105
504 Ga0070690_100485929
505 Ga0070690_100838585
506 Ga0070670_100150964
507 Ga0070670_100345384
508 Ga0070670_100663589
509 Ga0070670_100740405
510 Ga0070670_101258614
511 Ga0068869_100011893
512 Ga0068869_101083694
513 Ga0070666_10002671
514 Ga0070666_10095514
515 Ga0070666_10354030
516 Ga0070682_100007498
517 Ga0068868_100006431
518 Ga0068868_100017315
519 Ga0068868_100076360
520 Ga0068868_100712510
521 Ga0068868_101337499
522 Ga0070660_100162249
523 Ga0070660_101532812
524 Ga0070689_100001295
525 Ga0070691_10131081
526 Ga0070687_100053217
527 Ga0070661_100031857
528 Ga0070661_100210091
529 Ga0070668_100018129
530 Ga0070669_100108259
531 Ga0070669_100111860
532 Ga0070669_100387339
533 Ga0070675_100088356
534 Ga0070674_100540455
535 Ga0070673_100173195
536 Ga0070673_100177147
537 Ga0070673_100209461
538 Ga0070673_100298111
539 Ga0070688_100013168
540 Ga0070688_100032670
541 Ga0070659_100187241
542 Ga0070667_100013832
543 Ga0070667_100158937
544 Ga0070667_100424041
545 Ga0070709_10059386
546 Ga0070714_100008796
547 Ga0070701_10109399
548 Ga0070700_100285478
549 Ga0070700_100290498
550 Ga0070694_100134916
551 Ga0070663_100023619
552 Ga0070663_100280391
553 Ga0070663_100320643
554 Ga0070678_100004708
555 Ga0070678_100183472
556 Ga0070662_100548672
557 Ga0068867_100292769
558 Ga0070685_10045134
559 Ga0070706_100069057
560 Ga0070706_102075003
561 Ga0070707_100146555
562 Ga0070707_101217569
563 Ga0070699_100956076
564 Ga0070679_100128058
565 Ga0070684_100170882
566 Ga0070684_101140546
567 Ga0070697_101194498
568 Ga0068853_100039185
569 Ga0070672_100007982
570 Ga0070672_100178945
571 Ga0070672_101032830
572 Ga0070686_100002080
573 Ga0070686_100219324
574 Ga0070686_101390937
575 Ga0070695_100118971
576 Ga0070695_100571009
577 Ga0070696_100036801
578 Ga0070665_100196812
579 Ga0070665_100524926
580 Ga0070665_100739091
581 Ga0070704_100188431
582 Ga0068855_100144209
583 Ga0070664_100001474
584 Ga0070664_100034943
585 Ga0070664_100408310
586 Ga0068857_100019131
587 Ga0068857_101510842
588 Ga0068854_100001461
589 Ga0068854_100007522
590 Ga0068856_100019308
591 Ga0068856_100096260
592 Ga0070702_100385950
593 Ga0068852_100004238
594 Ga0068852_102029390
595 Ga0068859_100028488
596 Ga0068859_100032862
597 Ga0068859_100602857
598 Ga0068859_100773923
599 Ga0068859_102990285
600 Ga0068864_100000070
601 Ga0068864_100012255
602 Ga0068864_100042223
603 Ga0068864_100123530
604 Ga0068866_10266164
605 Ga0068861_100123203
606 Ga0068861_100328532
607 Ga0068861_100338095
608 Ga0068851_10003443
609 Ga0068870_10151458
610 Ga0068863_100006892
611 Ga0068863_100098223
612 Ga0068863_100395998
613 Ga0068863_101451219
614 Ga0068863_101830216
615 Ga0068858_100000306
616 Ga0068858_100037007
617 Ga0068858_100206715
618 Ga0068858_100341537
619 Ga0068858_101534382
620 Ga0068860_100139786
621 Ga0068860_100243845
622 Ga0068860_100763871
623 Ga0068860_101123289
624 Ga0068860_102051135
625 Ga0068862_100464473
626 Ga0081540_1088454
627 Ga0070716_100152546
628 Ga0070716_100526449
629 Ga0070712_100018770
630 Ga0070712_101117482
631 Ga0097621_100023399
632 Ga0097621_100055455
633 Ga0097621_100261061
634 Ga0097621_100791724
635 Ga0068871_100016597
636 Ga0068871_100290098
637 Ga0075428_100513241
638 Ga0075431_101233461
639 Ga0075433_10005654
640 Ga0075433_10075447
641 Ga0075433_10791169
642 Ga0075434_100004039
643 Ga0075434_100152969
644 Ga0075434_100283292
645 Ga0075434_100521785
646 Ga0068865_100406036
647 Ga0068865_100426647
648 Ga0068865_101667191
649 Ga0075436_100159001
650 Ga0075436_100491702
651 Ga0097620_100028488
652 Ga0097620_100032861
653 Ga0097620_100602825
654 Ga0097620_100773934
655 Ga0097620_102989417
656 Ga0075435_100000461
657 Ga0075435_100016641
658 Ga0075435_100067628
659 Ga0075435_100087116
660 Ga0075435_100743596
661 Ga0075435_101710500
662 Ga0105251_10047820
663 Ga0105240_10058456
664 Ga0105240_10082032
665 Ga0105240_10109717
666 Ga0105240_10324166
667 Ga0105245_10008762
668 Ga0105245_10213732
669 Ga0105245_10906225
670 Ga0105247_10068574
671 Ga0114129_10000993
672 Ga0105243_10092196
673 Ga0105241_10006237
674 Ga0105241_10124260
675 Ga0105241_10133838
676 Ga0105241_10469461
677 Ga0105241_12405129
678 Ga0105242_10575323
679 Ga0105242_12586601
680 Ga0105248_10014646
681 Ga0105248_10015991
682 Ga0105248_10052744
683 Ga0105248_10197821
684 Ga0105248_10829592
685 Ga0105238_10005459
686 Ga0105238_10078520
687 Ga0105238_10212619
688 Ga0105249_10003055
689 Ga0105249_10907966
690 Ga0105239_10044069
691 Ga0105239_10345650
692 Ga0105239_11109188
693 Ga0105239_11546669
694 Ga0105239_12968993
695 Ga0105246_10005741
696 Ga0157373_10063322
697 Ga0157373_10208014
698 Ga0157371_10005072
699 Ga0157370_10190171
700 Ga0157369_10029190
701 Ga0157374_10024406
702 Ga0157374_10179985
703 Ga0157378_10005797
704 Ga0157378_10329738
705 Ga0157378_10391808
706 Ga0157378_10735612
707 Ga0157378_12977394
708 Ga0157378_13259038
709 Ga0163162_10163030
710 Ga0163162_10220855
711 Ga0163162_10232287
712 Ga0163162_10753836
713 Ga0157375_10039097
714 Ga0157375_10219813
715 Ga0157375_10627941
716 Ga0163163_10026114
717 Ga0163163_10165662
718 Ga0157377_10000024
719 Ga0157377_10033722
720 Ga0157377_10295305
721 Ga0157377_11446352
722 Ga0157379_10084116
723 Ga0157379_10395182
724 Ga0157376_10018268
725 Ga0157376_10117408
726 Ga0157376_10431061
727 Ga0157376_10561093
728 Ga0163161_10269526
729 Ga0206354_10370791
730 Ga0206353_10015191
731 Ga0213872_10000149
732 Ga0207656_10001883
733 Ga0207642_10031262
734 Ga0207642_10254068
735 Ga0207710_10220885
736 Ga0207680_10027718
737 Ga0207680_10031952
738 Ga0207680_10072107
739 Ga0207647_10223271
740 Ga0207699_10516890
741 Ga0207645_10004273
742 Ga0207643_10107222
743 Ga0207684_10789136
744 Ga0207684_11333828
745 Ga0207654_10013486
746 Ga0207654_10064090
747 Ga0207654_10079863
748 Ga0207654_10246966
749 Ga0207707_10177786
750 Ga0207707_10588622
751 Ga0207695_10016663
752 Ga0207695_10420341
753 Ga0207695_10473630
754 Ga0207695_10870433
755 Ga0207671_10585271
756 Ga0207662_10005754
757 Ga0207657_10000766
758 Ga0207649_10028595
759 Ga0207652_10123141
760 Ga0207652_10135200
761 Ga0207646_10171263
762 Ga0207646_10944191
763 Ga0207681_10293649
764 Ga0207681_10644666
765 Ga0207694_10000724
766 Ga0207694_10230625
767 Ga0207694_10951255
768 Ga0207650_10029758
769 Ga0207650_10076667
770 Ga0207650_10286092
771 Ga0207650_10476629
772 Ga0207659_10358594
773 Ga0207687_10000501
774 Ga0207687_10014291
775 Ga0207687_11555841
776 Ga0207700_10007127
777 Ga0207664_10005433
778 Ga0207644_10806579
779 Ga0207644_11703889
780 Ga0207690_10290508
781 Ga0207706_10000956
782 Ga0207706_10036801
783 Ga0207706_10203464
784 Ga0207706_10224424
785 Ga0207686_10093717
786 Ga0207709_10165396
787 Ga0207670_10001092
788 Ga0207670_10155328
789 Ga0207669_10316412
790 Ga0207704_10011012
791 Ga0207704_10133788
792 Ga0207704_10189484
793 Ga0207665_10695974
794 Ga0207691_10028853
795 Ga0207691_10055115
796 Ga0207711_10029061
797 Ga0207711_10076017
798 Ga0207689_10044147
799 Ga0207689_10357361
800 Ga0207689_10430136
801 Ga0207661_10344145
802 Ga0207679_10057026
803 Ga0207679_10660483
804 Ga0207667_10022760
805 Ga0207651_10108631
806 Ga0207651_10373081
807 Ga0207651_10562138
808 Ga0207712_10011595
809 Ga0207712_10013126
810 Ga0207668_10104396
811 Ga0207668_10273098
812 Ga0207640_10015265
813 Ga0207640_10024485
814 Ga0207658_10030505
815 Ga0207658_10111069
816 Ga0207677_10000050
817 Ga0207677_11059628
818 Ga0207677_11984423
819 Ga0207703_10000104
820 Ga0207703_10123393
821 Ga0207703_10381831
822 Ga0207639_10480514
823 Ga0207678_10000887
824 Ga0207708_10546895
825 Ga0207702_10088826
826 Ga0207702_10093709
827 Ga0207641_10042835
828 Ga0207641_10231818
829 Ga0207641_10952525
830 Ga0207641_11132851
831 Ga0207641_11530321
832 Ga0207648_10023453
833 Ga0207648_10032011
834 Ga0207648_10788050
835 Ga0207676_10000014
836 Ga0207676_10268667
837 Ga0207676_11180940
838 Ga0207675_100080283
839 Ga0207683_10002258
840 Ga0207683_10237398
841 Ga0207683_10308972
842 Ga0207683_11662202
843 Ga0207683_11804193
844 Ga0268266_10014210
845 Ga0268266_10015063
846 Ga0268266_10028843
847 Ga0268265_10981848
848 Ga0268264_10179370
849 Ga0268264_10248089
850 Ga0268264_10524019
851 Ga0268264_11139980
852 Ga0265330_10050776
853 Ga0265328_10412383
854 Ga0265329_10030675
855 Ga0265340_10070106
856 Ga0265339_10038442
857 Ga0265331_10025169
858 Ga0265316_10057023
859 Ga0316579_10038020
860 Ga0265342_10251334
861 Ga0316576_10060691
862 Ga0316578_10068847
863 Ga0373930_0003906
864 Ga0373958_0180216
865 Ga0373951_0078842
866 Ga0373952_0067021
867 Ga0373932_0031625
868 Ga0373954_0085553
869 Ga0373960_0067607
870 Ga0373955_0666075
871 Ga0373962_0014012
872 Ga0316574_0706844
873 Ga0373931_0033871
874 Ga0373931_0061891
875 Ga0373927_0418464
876 Ga0373933_0225604
877 Ga0373937_0016240
878 Ga0373937_0106007
879 Ga0316582_0112797
880 Ga0373925_0851812
881 Ga0316581_0052543
882 Ga0436364_0360857
883 Ga0242420_009145
884 Ga0436361_0446407
885 Ga0436361_0996671
886 Ga0451802_0758532
887 Ga0451853_2486478
888 Ga0453684_0434530
889 Ga0495603_0246304
890 Ga0495651_0049060
891 Ga0495580_0000967
892 Ga0495580_0106883
893 Ga0495580_0239205
894 Ga0495639_0410140
895 Ga0495594_0385678
896 Ga0495628_0097389
897 Ga0495628_0171890
898 Ga0495665_0168096
899 Ga0495587_0109800
900 Ga0495645_0098721
901 Ga0495667_0066557
902 Ga0495599_0023415
903 Ga0495599_0122230
904 Ga0495658_0828298
905 Ga0495581_0362545
906 Ga0495604_0131776
907 Ga0495674_0676431
908 Ga0495674_1166261
909 Ga0495675_0468537
910 Ga0495684_0002122
911 Ga0495602_0578542
912 Ga0496100_0129038
913 Ga0496101_1163266
914 Ga0496102_0040336
915 Ga0496102_0085031
916 Ga0496102_0186467
917 Ga0496102_0231689
918 Ga0496102_1053539
919 Ga0496102_1720957
920 Ga0496103_0212229
921 Ga0496103_0695869
922 Ga0496104_0022162
923 Ga0496104_0083267
924 Ga0496104_0222455
925 Ga0496105_0084774
926 Ga0496105_0329095
927 Ga0496105_1073040
928 Ga0496106_0018468
929 Ga0496106_0146383
930 Ga0496106_0295774
931 Ga0496106_0453710
932 Ga0496107_0168810
933 Ga0496108_0253261
934 Ga0496108_0765016
935 Ga0496109_0003475
936 Ga0496109_0121197
937 Ga0496109_0919784
938 Ga0496110_0111699
939 Ga0496110_0350971
940 Ga0496111_0278487
941 Ga0496112_0003226
942 Ga0496112_0023044
943 Ga0496112_0037538
944 Ga0496112_0150147
945 Ga0496112_0371605
946 Ga0496112_1613361
947 Ga0496113_0205570
948 Ga0496113_0315999
949 Ga0496113_0378422
950 Ga0496114_1661006
951 Ga0496115_0028171
952 Ga0501033_0283544
953 Ga0501040_0246846
954 Ga0501042_0251471
955 Ga0501072_0053441
956 Ga0501076_0036295
957 Ga0501077_0164928
958 Ga0501079_0147481
959 Ga0501081_0171517
960 nmdc:mga05p37_18114_c1
961 nmdc:mga05p37_1916355_c1
962 nmdc:mga06r32_805105_c1
963 nmdc:mga0n895_383403_c1
964 nmdc:mga0n895_4917_c1
965 nmdc:mga0n895_493077_c1
966 nmdc:mga0n895_506973_c1
967 nmdc:mga0n895_66869_c1
968 nmdc:mga0rr50_118830_c1
969 nmdc:mga0rr50_1802_c1
970 nmdc:mga0rr50_65972_c1
971 nmdc:mga0rr50_691_c1
972 nmdc:mga0rr50_85289_c2
973 nmdc:mga08x19_143607_c1
974 nmdc:mga08x19_282800_c1
975 nmdc:mga08x19_755450_c1
976 nmdc:mga0a205_270_c1
977 nmdc:mga0a205_781306_c1
978 nmdc:mga0a205_89607_c1
979 Ga0495619_0158123
980 Ga0500641_0082774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

36

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h34-assembly1.cif.gz_A crystal structure of the c-terminal domain of methionyl-trna synthetase (metrs-c) in nanoarchaeum equitans 0.9629 3 116
1mkh-assembly1.cif.gz_A-2 c-terminal domain of methionyl-trna synthetase from pyrococcus abyssi 0.9626 7 116
7d8r-assembly2.cif.gz_C mitf hlhlz structure 0.961 11 116
7d8s-assembly2.cif.gz_C mitf bhlhlz apo structure 0.9563 11 116
5h34-assembly1.cif.gz_A crystal structure of the c-terminal domain of methionyl-trna synthetase (metrs-c) in nanoarchaeum equitans 0.9546 3 116
ID Description Score Start End Superfamily
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9629 3 116 2.40.50.140
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9546 3 116 2.40.50.140
af_Q2G1R9_548_656_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9479 4 115 2.40.50.140
af_Q2G1R9_548_656_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9396 4 115 2.40.50.140
af_P00959_568_677_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9334 6 116 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0C5WNZ1-F1-model_v4 tRNA-binding domain-containing protein 0.9997 1 116 GO:0000049
AF-A0A2V8LE17-F1-model_v4 tRNA-binding protein 0.999 1 116 GO:0000049
AF-A0A7Y2AVB9-F1-model_v4 tRNA-binding protein 0.9978 1 116 GO:0000049
AF-A0A0F9ZRP8-F1-model_v4 EMAP domain protein 0.9971 22 116 GO:0000049
AF-A0A537E4N9-F1-model_v4 tRNA-binding domain-containing protein 0.9956 2 116 GO:0000049

Map