F453899

General Info

Members Datasets Scaffolds Average Seq Length
490 249 485 146

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_101394414|Ga0070689_1013944141
Length 158
Sequence MSNVTEPSPPRWLKPMNRLVLALGRIGVPAGPSQVLTVPGRKSGQPRSTPMTPFDHDGGLYTVAGYPGADWAANARAAGEGTLTRGRRSRRVRIVELSAAESRPILRSFALKVPVGVGFAKRSGLVVDGTPDEFEALAGRLAVFRFDPAYSGGRDASP

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
5 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
240 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.06
Nodule 0
Rhizoplane 13.06
Rhizosphere 66.53
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10010963 3300002075 Bacteria 2004
2 JGI24749J21850_1006896 3300002076 Bacteria 1579
3 JGI24744J21845_10002222 3300002077 Bacteria 3950
4 JGI24742J22300_10001339 3300002244 Bacteria 3872
5 Ga0055540_1002004 3300003792 Bacteria 11361
6 Ga0070690_100023626 3300005330 Bacteria 3772
7 Ga0068869_100121105 3300005334 Bacteria 2001
8 Ga0070680_100152412 3300005336 Bacteria 1941
9 Ga0068868_100004288 3300005338 Bacteria 9987
10 Ga0070689_100060551 3300005340 Bacteria 2944
11 Ga0070689_101394414 3300005340 Bacteria 633
12 Ga0070691_10002040 3300005341 Bacteria 8918
13 Ga0070687_100047653 3300005343 Bacteria 2200
14 Ga0070692_10014408 3300005345 Bacteria 3714
15 Ga0070668_100000140 3300005347 Bacteria 45946
16 Ga0070668_100000721 3300005347 Bacteria 22652
17 Ga0070668_100002934 3300005347 Bacteria 12605
18 Ga0070669_100003554 3300005353 Bacteria 11248
19 Ga0070671_100290174 3300005355 Bacteria 1392
20 Ga0070671_100343940 3300005355 Bacteria 1273
21 Ga0070674_100001316 3300005356 Bacteria 13057
22 Ga0070674_100641988 3300005356 Bacteria 901
23 Ga0070674_100749188 3300005356 Bacteria 839
24 Ga0070688_100209432 3300005365 Bacteria 1368
25 Ga0070688_100908445 3300005365 Bacteria 695
26 Ga0070659_100341895 3300005366 Bacteria 1254
27 Ga0070667_100000408 3300005367 Bacteria 45977
28 Ga0070709_10018972 3300005434 Bacteria 3969
29 Ga0070709_10035233 3300005434 Bacteria 3041
30 Ga0070714_102197493 3300005435 Bacteria 537
31 Ga0070710_10002975 3300005437 Bacteria 8047
32 Ga0070710_10036828 3300005437 Bacteria 2677
33 Ga0070701_10011176 3300005438 Bacteria 4002
34 Ga0070711_100001002 3300005439 Bacteria 14990
35 Ga0070711_100035334 3300005439 Bacteria 3340
36 Ga0070705_100425533 3300005440 Bacteria 990
37 Ga0070705_100616038 3300005440 Bacteria 842
38 Ga0070700_100010766 3300005441 Bacteria 5054
39 Ga0070700_101012888 3300005441 Bacteria 683
40 Ga0070663_100637150 3300005455 Bacteria 900
41 Ga0070663_102166415 3300005455 Bacteria 501
42 Ga0070678_100000061 3300005456 Bacteria 39817
43 Ga0070662_100015415 3300005457 Bacteria 5119
44 Ga0068867_100004454 3300005459 Bacteria 9845
45 Ga0068867_100110512 3300005459 Bacteria 2111
46 Ga0068867_101797112 3300005459 Bacteria 576
47 Ga0070685_10228342 3300005466 Bacteria 1223
48 Ga0070684_100109457 3300005535 Bacteria 2476
49 Ga0070684_100293381 3300005535 Unclassified 1491
50 Ga0068853_100000950 3300005539 Bacteria 20343
51 Ga0070686_100232858 3300005544 Bacteria 1337
52 Ga0070686_100298331 3300005544 Bacteria 1194
53 Ga0070686_101611491 3300005544 Bacteria 549
54 Ga0070695_100254520 3300005545 Bacteria 1280
55 Ga0070696_100005654 3300005546 Bacteria 8354
56 Ga0070696_100159615 3300005546 Bacteria 1660
57 Ga0070693_100006413 3300005547 Bacteria 5701
58 Ga0070693_100127606 3300005547 Bacteria 1585
59 Ga0070693_101245355 3300005547 Bacteria 573
60 Ga0070665_100003972 3300005548 Bacteria 15589
61 Ga0070665_100319855 3300005548 Bacteria 1556
62 Ga0070665_100446358 3300005548 Bacteria 1303
63 Ga0070665_100516843 3300005548 Bacteria 1206
64 Ga0070665_100698241 3300005548 Bacteria 1028
65 Ga0070704_100003425 3300005549 Bacteria 9093
66 Ga0068855_100036427 3300005563 Bacteria 5856
67 Ga0068854_100154083 3300005578 Bacteria 1774
68 Ga0068856_100228765 3300005614 Bacteria 1875
69 Ga0070702_100001059 3300005615 Bacteria 10974
70 Ga0070702_100014257 3300005615 Bacteria 4030
71 Ga0070702_100599707 3300005615 Bacteria 825
72 Ga0068852_100400566 3300005616 Bacteria 1350
73 Ga0068859_100000542 3300005617 Bacteria 37422
74 Ga0068859_100014454 3300005617 Bacteria 7923
75 Ga0068859_100990880 3300005617 Bacteria 923
76 Ga0068864_100702206 3300005618 Bacteria 988
77 Ga0068864_101025002 3300005618 Bacteria 819
78 Ga0068866_10000351 3300005718 Bacteria 21618
79 Ga0068866_10075528 3300005718 Bacteria 1794
80 Ga0068861_100000122 3300005719 Bacteria 39876
81 Ga0068863_100000352 3300005841 Bacteria 46727
82 Ga0068863_100546541 3300005841 Bacteria 1143
83 Ga0068863_102187825 3300005841 Bacteria 563
84 Ga0068858_100005649 3300005842 Bacteria 12231
85 Ga0068858_100016485 3300005842 Bacteria 6938
86 Ga0068858_101177954 3300005842 Bacteria 753
87 Ga0068860_100000542 3300005843 Bacteria 45977
88 Ga0068860_100001605 3300005843 Bacteria 24276
89 Ga0068860_100230379 3300005843 Bacteria 1800
90 Ga0068862_100000422 3300005844 Bacteria 45975
91 Ga0068862_100019043 3300005844 Bacteria 5724
92 Ga0068862_101613373 3300005844 Bacteria 656
93 Ga0075365_10000611 3300006038 Bacteria 14048
94 Ga0075365_10102960 3300006038 Bacteria 1956
95 Ga0075365_10112734 3300006038 Bacteria 1870
96 Ga0075363_100000524 3300006048 Bacteria 12347
97 Ga0075363_100004827 3300006048 Bacteria 5950
98 Ga0075363_100036748 3300006048 Bacteria 2570
99 Ga0075363_100102336 3300006048 Bacteria 1586
100 Ga0075363_100129878 3300006048 Bacteria 1412
101 Ga0075363_100624165 3300006048 Bacteria 647
102 Ga0075364_10006860 3300006051 Bacteria 6722
103 Ga0075364_10090486 3300006051 Bacteria 2030
104 Ga0075364_10228923 3300006051 Bacteria 1262
105 Ga0075364_10431815 3300006051 Bacteria 899
106 Ga0070716_100025336 3300006173 Bacteria 3164
107 Ga0070712_100003776 3300006175 Bacteria 9330
108 Ga0075362_10056074 3300006177 Bacteria 1773
109 Ga0075362_10064755 3300006177 Bacteria 1659
110 Ga0075367_10051136 3300006178 Bacteria 2442
111 Ga0075369_10015976 3300006186 Bacteria 3022
112 Ga0075369_10319200 3300006186 Bacteria 727
113 Ga0075370_10000287 3300006353 Bacteria 18091
114 Ga0075370_10040515 3300006353 Bacteria 2628
115 Ga0075370_10110179 3300006353 Bacteria 1598
116 Ga0068871_100057314 3300006358 Bacteria 3169
117 Ga0075428_100035815 3300006844 Bacteria 5471
118 Ga0075430_100042642 3300006846 Bacteria 3837
119 Ga0075430_100201255 3300006846 Bacteria 1654
120 Ga0075430_100214819 3300006846 Bacteria 1596
121 Ga0068865_100000197 3300006881 Bacteria 33642
122 Ga0097620_100000542 3300006931 Bacteria 37422
123 Ga0097620_100014454 3300006931 Bacteria 7923
124 Ga0097620_100990920 3300006931 Bacteria 923
125 Ga0075435_100508039 3300007076 Bacteria 1042
126 Ga0099795_10264875 3300007788 Bacteria 745
127 Ga0105250_10020032 3300009092 Bacteria 2705
128 Ga0111539_12719788 3300009094 Bacteria 573
129 Ga0105245_10011166 3300009098 Bacteria 7816
130 Ga0105247_10000058 3300009101 Bacteria 131442
131 Ga0105247_10968684 3300009101 Bacteria 662
132 Ga0114129_10108396 3300009147 Bacteria 3834
133 Ga0105243_10006505 3300009148 Bacteria 9033
134 Ga0105243_10889006 3300009148 Bacteria 885
135 Ga0105242_10002141 3300009176 Bacteria 15592
136 Ga0105242_10279488 3300009176 Bacteria 1516
137 Ga0105248_10000465 3300009177 Bacteria 46197
138 Ga0105248_10002640 3300009177 Bacteria 19918
139 Ga0105248_10036073 3300009177 Bacteria 5531
140 Ga0105248_10224861 3300009177 Bacteria 2113
141 Ga0105248_11397749 3300009177 Bacteria 792
142 Ga0105237_10000346 3300009545 Bacteria 65318
143 Ga0105238_10323329 3300009551 Bacteria 1529
144 Ga0105238_10947671 3300009551 Bacteria 880
145 Ga0105249_10000087 3300009553 Bacteria 131590
146 Ga0105249_10001439 3300009553 Bacteria 20816
147 Ga0105249_10627356 3300009553 Bacteria 1131
148 Ga0105249_10699595 3300009553 Bacteria 1073
149 Ga0105239_10006651 3300010375 Bacteria 13378
150 Ga0105239_10008590 3300010375 Bacteria 11583
151 Ga0105239_10200993 3300010375 Bacteria 2233
152 Ga0105246_10152188 3300011119 Bacteria 1752
153 Ga0105246_10321235 3300011119 Bacteria 1258
154 Ga0157371_10165008 3300013102 Bacteria 1582
155 Ga0157374_11679279 3300013296 Bacteria 660
156 Ga0157378_10001662 3300013297 Bacteria 20101
157 Ga0157378_10792211 3300013297 Bacteria 973
158 Ga0157378_11162375 3300013297 Bacteria 810
159 Ga0163162_10035965 3300013306 Bacteria 4933
160 Ga0163162_11304972 3300013306 Bacteria 825
161 Ga0163162_12666959 3300013306 Bacteria 575
162 Ga0163162_12999203 3300013306 Bacteria 542
163 Ga0157372_10002481 3300013307 Bacteria 19997
164 Ga0157372_10055211 3300013307 Bacteria 4435
165 Ga0157375_10036672 3300013308 Bacteria 4692
166 Ga0157375_10166434 3300013308 Bacteria 2350
167 Ga0157375_12598591 3300013308 Bacteria 605
168 Ga0163163_10009561 3300014325 Bacteria 8663
169 Ga0163163_10273969 3300014325 Bacteria 1739
170 Ga0157380_10695762 3300014326 Bacteria 1021
171 Ga0157377_10006511 3300014745 Bacteria 5575
172 Ga0157377_10164470 3300014745 Bacteria 1382
173 Ga0157379_10397106 3300014968 Bacteria 1267
174 Ga0157379_10790510 3300014968 Bacteria 895
175 Ga0157379_11347689 3300014968 Bacteria 690
176 Ga0157379_12044094 3300014968 Bacteria 567
177 Ga0157376_10134775 3300014969 Bacteria 2209
178 Ga0163161_10023632 3300017792 Bacteria 4338
179 Ga0213872_10316685 3300021361 Bacteria 645
180 Ga0209051_1000374 3300025303 Bacteria 64311
181 Ga0207696_1063363 3300025711 Bacteria 1036
182 Ga0207692_10018227 3300025898 Bacteria 3147
183 Ga0207692_10081224 3300025898 Bacteria 1734
184 Ga0207642_10000428 3300025899 Bacteria 12682
185 Ga0207710_10000085 3300025900 Bacteria 131447
186 Ga0207688_10016267 3300025901 Bacteria 4034
187 Ga0207688_10526800 3300025901 Bacteria 741
188 Ga0207647_10108365 3300025904 Bacteria 1643
189 Ga0207685_10058418 3300025905 Bacteria 1517
190 Ga0207643_10231842 3300025908 Bacteria 1133
191 Ga0207671_10004495 3300025914 Bacteria 13277
192 Ga0207671_10125212 3300025914 Bacteria 1968
193 Ga0207693_10000189 3300025915 Bacteria 56358
194 Ga0207693_10002292 3300025915 Bacteria 16650
195 Ga0207663_10344331 3300025916 Bacteria 1127
196 Ga0207662_10104698 3300025918 Bacteria 1757
197 Ga0207681_10136028 3300025923 Bacteria 1824
198 Ga0207681_10240743 3300025923 Bacteria 1408
199 Ga0207694_10901042 3300025924 Bacteria 748
200 Ga0207694_10973027 3300025924 Bacteria 718
201 Ga0207687_10024573 3300025927 Bacteria 4027
202 Ga0207644_10799016 3300025931 Bacteria 789
203 Ga0207690_10401361 3300025932 Bacteria 1093
204 Ga0207706_10001089 3300025933 Bacteria 27567
205 Ga0207686_10036351 3300025934 Bacteria 2964
206 Ga0207686_10223741 3300025934 Bacteria 1360
207 Ga0207709_10011503 3300025935 Bacteria 4882
208 Ga0207670_10025908 3300025936 Bacteria 3689
209 Ga0207669_10004455 3300025937 Bacteria 6166
210 Ga0207669_10335076 3300025937 Bacteria 1163
211 Ga0207704_10110323 3300025938 Bacteria 1858
212 Ga0207704_10188890 3300025938 Bacteria 1497
213 Ga0207665_10002245 3300025939 Bacteria 13044
214 Ga0207711_10000071 3300025941 Bacteria 112825
215 Ga0207711_10113386 3300025941 Bacteria 2413
216 Ga0207711_10119731 3300025941 Bacteria 2349
217 Ga0207689_10095097 3300025942 Bacteria 2447
218 Ga0207667_10092333 3300025949 Bacteria 3127
219 Ga0207712_10000040 3300025961 Bacteria 180255
220 Ga0207712_10033268 3300025961 Bacteria 3484
221 Ga0207712_11435063 3300025961 Bacteria 618
222 Ga0207668_10000208 3300025972 Bacteria 39588
223 Ga0207668_10000619 3300025972 Bacteria 22096
224 Ga0207668_10094721 3300025972 Bacteria 2202
225 Ga0207640_10108529 3300025981 Bacteria 1962
226 Ga0207658_10000121 3300025986 Bacteria 84805
227 Ga0207658_10354579 3300025986 Bacteria 1278
228 Ga0207677_10000688 3300026023 Bacteria 20006
229 Ga0207703_10002898 3300026035 Bacteria 14608
230 Ga0207703_10004038 3300026035 Bacteria 12129
231 Ga0207703_10704510 3300026035 Bacteria 960
232 Ga0207703_11410837 3300026035 Bacteria 670
233 Ga0207639_10020341 3300026041 Bacteria 4750
234 Ga0207639_10736567 3300026041 Bacteria 916
235 Ga0207678_10024309 3300026067 Bacteria 5292
236 Ga0207678_10495950 3300026067 Bacteria 1064
237 Ga0207678_10515906 3300026067 Bacteria 1043
238 Ga0207708_10019312 3300026075 Bacteria 5135
239 Ga0207641_10000485 3300026088 Bacteria 44793
240 Ga0207641_11982435 3300026088 Bacteria 583
241 Ga0207648_10001727 3300026089 Bacteria 23923
242 Ga0207648_10020697 3300026089 Bacteria 5921
243 Ga0207676_11049643 3300026095 Bacteria 804
244 Ga0207676_11198876 3300026095 Bacteria 752
245 Ga0207675_100000325 3300026118 Bacteria 45410
246 Ga0207675_100013470 3300026118 Bacteria 7630
247 Ga0207683_10009488 3300026121 Bacteria 8292
248 Ga0268266_10005247 3300028379 Bacteria 12167
249 Ga0268266_10244021 3300028379 Bacteria 1659
250 Ga0268265_10000004 3300028380 Bacteria 648376
251 Ga0268265_10033732 3300028380 Bacteria 3724
252 Ga0268264_10000133 3300028381 Bacteria 179929
253 Ga0268264_10091843 3300028381 Bacteria 2619
254 Ga0268264_10224076 3300028381 Bacteria 1732
255 Ga0307409_100039188 3300031995 Bacteria 3514
256 Ga0307409_100099414 3300031995 Bacteria 2409
257 Ga0373948_0048341 3300034817 Bacteria 908
258 Ga0373941_0037862 3300035115 Bacteria 1474
259 Ga0373962_0067467 3300035242 Bacteria 1062
260 Ga0373931_0037707 3300035691 Bacteria 2524
261 Ga0373931_0039772 3300035691 Bacteria 2464
262 Ga0436364_1022764 3300037853 Bacteria 5428
263 Ga0436365_1161830 3300039437 Bacteria 7241
264 Ga0436365_1377844 3300039437 Bacteria 884
265 Ga0436365_1744049 3300039437 Bacteria 503
266 Ga0436361_0104508 3300039447 Bacteria 1092
267 Ga0439461_0098625 3300041410 Bacteria 709
268 Ga0451789_1271217 3300041443 Bacteria 560
269 Ga0451793_1408289 3300041452 Bacteria 666
270 Ga0451802_2070460 3300041460 Bacteria 567
271 Ga0451839_0072854 3300041496 Bacteria 1058
272 Ga0451849_0315567 3300041505 Unclassified 717
273 Ga0466969_0093754 3300044656 Bacteria 1420
274 Ga0466972_0023220 3300044658 Bacteria 3085
275 Ga0466972_0035610 3300044658 Bacteria 2436
276 Ga0466965_0045585 3300044683 Bacteria 2169
277 Ga0466965_0509035 3300044683 Unclassified 676
278 Ga0466966_0001105 3300044684 Bacteria 17291
279 Ga0466966_0025491 3300044684 Bacteria 3862
280 Ga0466966_0084272 3300044684 Bacteria 1977
281 Ga0466961_0023893 3300044693 Bacteria 3933
282 Ga0466961_0041781 3300044693 Bacteria 2940
283 Ga0466963_0021446 3300044694 Bacteria 4076
284 Ga0466963_0291977 3300044694 Bacteria 1146
285 Ga0466963_0613275 3300044694 Bacteria 768
286 Ga0466964_0200181 3300044706 Bacteria 958
287 Ga0466971_0244321 3300044719 Bacteria 854
288 Ga0466971_0275379 3300044719 Bacteria 805
289 Ga0466971_0635906 3300044719 Bacteria 534
290 Ga0466968_0051197 3300044735 Bacteria 1764
291 Ga0466970_0017412 3300044765 Bacteria 3713
292 Ga0466970_0021752 3300044765 Bacteria 3344
293 Ga0466970_0075401 3300044765 Bacteria 1817
294 Ga0466970_0313793 3300044765 Bacteria 886
295 Ga0466970_0840608 3300044765 Bacteria 539
296 Ga0466957_0017452 3300044842 Bacteria 4205
297 Ga0466957_0021264 3300044842 Bacteria 3822
298 Ga0466957_0050552 3300044842 Bacteria 2530
299 Ga0466957_0252169 3300044842 Bacteria 1174
300 Ga0466957_0535127 3300044842 Bacteria 815
301 Ga0466960_0000334 3300044901 Bacteria 16052
302 Ga0466959_0000774 3300045049 Bacteria 18746
303 Ga0466959_0035220 3300045049 Bacteria 3704
304 Ga0466959_0264137 3300045049 Bacteria 1184
305 Ga0466958_0051767 3300045836 Bacteria 2487
306 Ga0466958_0053813 3300045836 Bacteria 2440
307 Ga0466958_0118552 3300045836 Bacteria 1656
308 Ga0466967_0089756 3300045976 Bacteria 2791
309 Ga0466967_0112412 3300045976 Bacteria 2504
310 Ga0466967_0117244 3300045976 Bacteria 2454
311 Ga0466967_1396771 3300045976 Bacteria 697
312 Ga0466967_2612026 3300045976 Bacteria 500
313 Ga0495590_0148574 3300046457 Bacteria 849
314 Ga0495638_0031855 3300046460 Bacteria 3385
315 Ga0495606_0196618 3300046507 Bacteria 1152
316 Ga0495632_0512697 3300046519 Bacteria 516
317 Ga0495648_0001738 3300046524 Bacteria 21055
318 Ga0495654_0016166 3300046530 Bacteria 3950
319 Ga0495640_0110051 3300046533 Bacteria 1801
320 Ga0495668_0010557 3300046616 Bacteria 5582
321 Ga0495635_0082005 3300046663 Bacteria 2207
322 Ga0495646_0543150 3300046680 Bacteria 594
323 Ga0495672_0001155 3300047320 Bacteria 26703
324 Ga0495672_0159502 3300047320 Bacteria 1161
325 Ga0495672_0190038 3300047320 Bacteria 1033
326 Ga0495687_211589 3300047443 Bacteria 607
327 Ga0495673_0000708 3300047469 Bacteria 32330
328 Ga0495626_0029280 3300048091 Bacteria 2666
329 Ga0496100_0009898 3300048903 Bacteria 5374
330 Ga0496100_0032983 3300048903 Bacteria 3236
331 Ga0496100_0065540 3300048903 Bacteria 2407
332 Ga0496100_0101068 3300048903 Bacteria 1987
333 Ga0496100_0420436 3300048903 Bacteria 1021
334 Ga0496100_0594902 3300048903 Bacteria 858
335 Ga0496101_0000077 3300048904 Bacteria 109236
336 Ga0496101_0007749 3300048904 Bacteria 6976
337 Ga0496101_0025301 3300048904 Bacteria 4117
338 Ga0496101_0058786 3300048904 Bacteria 2785
339 Ga0496101_0101363 3300048904 Bacteria 2156
340 Ga0496101_0563076 3300048904 Bacteria 901
341 Ga0496102_0000037 3300048905 Bacteria 199368
342 Ga0496102_0000251 3300048905 Bacteria 70253
343 Ga0496102_0010228 3300048905 Bacteria 8065
344 Ga0496102_0159761 3300048905 Bacteria 2120
345 Ga0496102_0531821 3300048905 Bacteria 1098
346 Ga0496102_0551653 3300048905 Bacteria 1075
347 Ga0496102_1668690 3300048905 Bacteria 555
348 Ga0496103_0000004 3300048906 Bacteria 510080
349 Ga0496103_0000990 3300048906 Bacteria 20036
350 Ga0496103_0001967 3300048906 Bacteria 13284
351 Ga0496103_0176171 3300048906 Bacteria 1374
352 Ga0496104_0004444 3300048907 Bacteria 12211
353 Ga0496104_0488133 3300048907 Bacteria 1143
354 Ga0496104_0531905 3300048907 Unclassified 1086
355 Ga0496106_0001893 3300048909 Bacteria 15673
356 Ga0496106_0022496 3300048909 Bacteria 4684
357 Ga0496106_0066749 3300048909 Bacteria 2741
358 Ga0496106_0105320 3300048909 Bacteria 2191
359 Ga0496106_0894292 3300048909 Bacteria 701
360 Ga0496107_0002822 3300048910 Bacteria 11457
361 Ga0496107_0297426 3300048910 Bacteria 1201
362 Ga0496107_0510924 3300048910 Bacteria 891
363 Ga0496107_1006317 3300048910 Bacteria 605
364 Ga0496108_0006358 3300048911 Bacteria 9576
365 Ga0496108_0076119 3300048911 Bacteria 2836
366 Ga0496108_0093262 3300048911 Bacteria 2561
367 Ga0496109_0039251 3300048912 Bacteria 4285
368 Ga0496109_0119959 3300048912 Bacteria 2449
369 Ga0496109_0222696 3300048912 Bacteria 1774
370 Ga0496109_2024346 3300048912 Bacteria 508
371 Ga0496110_0482730 3300048913 Bacteria 1129
372 Ga0496110_0884840 3300048913 Bacteria 799
373 Ga0496111_0109413 3300048914 Bacteria 2035
374 Ga0496111_0683314 3300048914 Unclassified 747
375 Ga0496112_0047627 3300048915 Bacteria 4206
376 Ga0496112_0068021 3300048915 Bacteria 3517
377 Ga0496112_0168726 3300048915 Bacteria 2154
378 Ga0496112_0299924 3300048915 Bacteria 1552
379 Ga0496112_1810981 3300048915 Bacteria 522
380 Ga0496113_0111164 3300048916 Bacteria 2133
381 Ga0496113_0441424 3300048916 Bacteria 1045
382 Ga0496113_0678103 3300048916 Unclassified 823
383 Ga0496114_0000849 3300048917 Bacteria 22880
384 Ga0496114_0039504 3300048917 Bacteria 3905
385 Ga0496114_0092760 3300048917 Bacteria 2566
386 Ga0496114_1212876 3300048917 Bacteria 641
387 Ga0496115_0358607 3300048918 Bacteria 1188
388 Ga0496115_0515077 3300048918 Bacteria 960
389 Ga0496115_0745830 3300048918 Bacteria 766
390 Ga0496116_0000056 3300048919 Bacteria 282554
391 Ga0496116_0004515 3300048919 Bacteria 13245
392 Ga0496117_0000003 3300048920 Bacteria 1881097
393 Ga0496117_0002020 3300048920 Bacteria 26893
394 Ga0496118_0000001 3300048921 Bacteria 1881100
395 Ga0496118_0010892 3300048921 Bacteria 8943
396 Ga0496119_0003106 3300048922 Bacteria 17524
397 Ga0496119_0025597 3300048922 Bacteria 4116
398 Ga0496120_0026621 3300048923 Bacteria 3568
399 Ga0496120_0064382 3300048923 Bacteria 2035
400 Ga0496120_0123509 3300048923 Bacteria 1335
401 Ga0496120_0396886 3300048923 Bacteria 610
402 Ga0496121_0004550 3300048924 Bacteria 18538
403 Ga0496121_0013630 3300048924 Bacteria 8716
404 Ga0496121_0196767 3300048924 Bacteria 1440
405 Ga0496122_0029757 3300048925 Bacteria 4594
406 Ga0496123_0008267 3300048926 Bacteria 9591
407 Ga0496124_0422098 3300048927 Bacteria 918
408 Ga0496125_0065418 3300048928 Bacteria 2880
409 Ga0496125_0239646 3300048928 Bacteria 1153
410 Ga0496126_0000735 3300048929 Bacteria 59474
411 Ga0496126_0007292 3300048929 Bacteria 12148
412 Ga0496126_0015261 3300048929 Bacteria 7731
413 Ga0496126_0019987 3300048929 Bacteria 6580
414 Ga0496126_0058874 3300048929 Bacteria 3462
415 Ga0496126_0167137 3300048929 Bacteria 1876
416 Ga0501032_0004377 3300049569 Bacteria 10652
417 Ga0501034_0010937 3300049571 Bacteria 9429
418 Ga0501034_0453523 3300049571 Bacteria 1200
419 Ga0501034_1145970 3300049571 Bacteria 657
420 Ga0501034_1644091 3300049571 Bacteria 515
421 Ga0501037_0001890 3300049573 Bacteria 15230
422 Ga0501038_0008303 3300049574 Bacteria 9557
423 Ga0501039_0000951 3300049575 Bacteria 21054
424 Ga0501040_0506733 3300049576 Bacteria 870
425 Ga0501043_0011675 3300049579 Bacteria 6875
426 Ga0501043_0230336 3300049579 Bacteria 1431
427 Ga0501043_0675836 3300049579 Unclassified 756
428 Ga0501047_1097956 3300049581 Bacteria 609
429 Ga0501047_1222985 3300049581 Bacteria 565
430 Ga0501068_0562031 3300049584 Bacteria 742
431 Ga0501070_0001052 3300049586 Bacteria 24811
432 Ga0501070_0070217 3300049586 Bacteria 2900
433 Ga0501070_0134172 3300049586 Bacteria 2044
434 Ga0501070_0423005 3300049586 Bacteria 1076
435 Ga0501071_0243671 3300049587 Bacteria 1356
436 Ga0501072_0558254 3300049588 Bacteria 904
437 Ga0501073_0286202 3300049589 Bacteria 1137
438 Ga0501080_0078353 3300049742 Bacteria 3074
439 Ga0501080_0796554 3300049742 Bacteria 829
440 Ga0501044_0161564 3300049823 Bacteria 2216
441 nmdc:mga03683_47444_c1 3300050489 Bacteria 1782
442 nmdc:mga03n38_22130_c1 3300050490 Bacteria 2569
443 nmdc:mga03n38_289399_c1 3300050490 Bacteria 877
444 nmdc:mga03n38_379707_c1 3300050490 Bacteria 774
445 nmdc:mga03n38_74991_c1 3300050490 Bacteria 1575
446 nmdc:mga03n38_86408_c1 3300050490 Bacteria 1484
447 nmdc:mga03n38_97903_c1 3300050490 Bacteria 1410
448 nmdc:mga00v17_1074438_c1 3300050491 Bacteria 505
449 nmdc:mga00v17_121687_c1 3300050491 Bacteria 1662
450 nmdc:mga00v17_32838_c1 3300050491 Bacteria 3071
451 nmdc:mga00v17_368118_c1 3300050491 Bacteria 934
452 nmdc:mga00v17_7667_c1 3300050491 Bacteria 5773
453 nmdc:mga00v17_76916_c1 3300050491 Bacteria 2077
454 nmdc:mga0yw44_42360_c1 3300050492 Bacteria 2715
455 nmdc:mga0yw44_6125_c1 3300050492 Bacteria 5776
456 nmdc:mga04h51_270635_c1 3300050495 Bacteria 686
457 nmdc:mga07m45_1959_c1 3300050496 Bacteria 9525
458 nmdc:mga07m45_266689_c1 3300050496 Unclassified 996
459 nmdc:mga07m45_36476_c1 3300050496 Bacteria 2738
460 nmdc:mga07m45_8527_c1 3300050496 Bacteria 5274
461 nmdc:mga0qj67_39151_c1 3300050509 Bacteria 3722
462 nmdc:mga0qj67_61779_c1 3300050509 Bacteria 2975
463 nmdc:mga06r32_200500_c1 3300050510 Bacteria 1983
464 nmdc:mga0sz30_122671_c1 3300050516 Bacteria 1142
465 nmdc:mga0sz30_296962_c1 3300050516 Bacteria 720
466 nmdc:mga0sz30_30142_c2 3300050516 Bacteria 1692
467 nmdc:mga0sz30_454914_c1 3300050516 Bacteria 575
468 nmdc:mga0sz30_482289_c1 3300050516 Bacteria 557
469 nmdc:mga0sz30_543550_c1 3300050516 Bacteria 524
470 Ga0500610_0055114 3300053079 Bacteria 2074
471 Ga0500635_0001125 3300053080 Bacteria 6394
472 Ga0500635_0096312 3300053080 Bacteria 1083
473 Ga0495655_0005732 3300053083 Bacteria 2213
474 Ga0500643_008471 3300053087 Bacteria 4038
475 Ga0500562_012970 3300053108 Bacteria 2122
476 Ga0500562_013697 3300053108 Bacteria 2073
477 Ga0500652_000098 3300053131 Bacteria 34947
478 Ga0500652_000343 3300053131 Bacteria 16733
479 Ga0500652_012040 3300053131 Bacteria 3021
480 Ga0500559_0230404 3300053136 Bacteria 873
481 Ga0500568_0083091 3300053139 Bacteria 1214
482 Ga0500616_0042721 3300053153 Bacteria 2426
483 Ga0500620_131943 3300053155 Bacteria 874
484 Ga0500645_000039 3300053730 Bacteria 111509
485 Ga0500645_015753 3300053730 Bacteria 2390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053079 Ga0500610_0055114 Ga0500610_0055114_676_1065 129
2 3300050489 nmdc:mga03683_47444_c1 nmdc:mga03683_47444_c1_734_1141 130
3 3300050490 nmdc:mga03n38_74991_c1 nmdc:mga03n38_74991_c1_456_863 130
4 3300050491 nmdc:mga00v17_76916_c1 nmdc:mga00v17_76916_c1_769_1176 130
5 3300050492 nmdc:mga0yw44_6125_c1 nmdc:mga0yw44_6125_c1_4315_4722 130
6 3300050496 nmdc:mga07m45_8527_c1 nmdc:mga07m45_8527_c1_692_1099 130
7 3300050516 nmdc:mga0sz30_30142_c2 nmdc:mga0sz30_30142_c2_317_724 130
8 3300041410 Ga0439461_0098625 Ga0439461_0098625_303_698 131
9 3300045976 Ga0466967_1396771 Ga0466967_1396771_284_679 131
10 3300003792 Ga0055540_1002004 Ga0055540_100200411 134
11 3300009545 Ga0105237_10000346 Ga0105237_1000034638 134
12 3300009551 Ga0105238_10323329 Ga0105238_103233292 134
13 3300010375 Ga0105239_10008590 Ga0105239_1000859010 134
14 3300025303 Ga0209051_1000374 Ga0209051_100037424 134
15 3300044842 Ga0466957_0050552 Ga0466957_0050552_2047_2451 134
16 3300045976 Ga0466967_0112412 Ga0466967_0112412_1698_2102 134
17 3300046507 Ga0495606_0196618 Ga0495606_0196618_553_957 134
18 3300048903 Ga0496100_0009898 Ga0496100_0009898_3044_3448 134
19 3300048904 Ga0496101_0000077 Ga0496101_0000077_73767_74171 134
20 3300048905 Ga0496102_0000037 Ga0496102_0000037_125035_125439 134
21 3300048906 Ga0496103_0000004 Ga0496103_0000004_435747_436151 134
22 3300048919 Ga0496116_0000056 Ga0496116_0000056_246544_246948 134
23 3300048920 Ga0496117_0000003 Ga0496117_0000003_1634150_1634554 134
24 3300048921 Ga0496118_0000001 Ga0496118_0000001_1634153_1634557 134
25 3300048923 Ga0496120_0026621 Ga0496120_0026621_1681_2085 134
26 3300048923 Ga0496120_0064382 Ga0496120_0064382_1599_2003 134
27 3300048924 Ga0496121_0004550 Ga0496121_0004550_9037_9441 134
28 3300048929 Ga0496126_0000735 Ga0496126_0000735_35184_35588 134
29 3300049571 Ga0501034_1145970 Ga0501034_1145970_182_586 134
30 3300049584 Ga0501068_0562031 Ga0501068_0562031_76_480 134
31 3300049586 Ga0501070_0070217 Ga0501070_0070217_732_1136 134
32 3300049588 Ga0501072_0558254 Ga0501072_0558254_327_731 134
33 3300049742 Ga0501080_0078353 Ga0501080_0078353_1961_2365 134
34 3300005535 Ga0070684_100293381 Ga0070684_1002933813 135
35 3300007788 Ga0099795_10264875 Ga0099795_102648752 135
36 3300009101 Ga0105247_10968684 Ga0105247_109686842 135
37 3300009177 Ga0105248_11397749 Ga0105248_113977492 135
38 3300010375 Ga0105239_10200993 Ga0105239_102009933 135
39 3300013296 Ga0157374_11679279 Ga0157374_116792792 135
40 3300013308 Ga0157375_12598591 Ga0157375_125985912 135
41 3300014325 Ga0163163_10273969 Ga0163163_102739692 135
42 3300014968 Ga0157379_12044094 Ga0157379_120440941 135
43 3300025924 Ga0207694_10973027 Ga0207694_109730272 135
44 3300035115 Ga0373941_0037862 Ga0373941_0037862_63_470 135
45 3300037853 Ga0436364_1022764 Ga0436364_1022764_4877_5290 135
46 3300039437 Ga0436365_1377844 Ga0436365_1377844_459_872 135
47 3300039437 Ga0436365_1744049 Ga0436365_1744049_76_483 135
48 3300041443 Ga0451789_1271217 Ga0451789_1271217_121_528 135
49 3300041460 Ga0451802_2070460 Ga0451802_2070460_139_546 135
50 3300041496 Ga0451839_0072854 Ga0451839_0072854_384_791 135
51 3300041505 Ga0451849_0315567 Ga0451849_0315567_18_425 135
52 3300044656 Ga0466969_0093754 Ga0466969_0093754_17_430 135
53 3300044684 Ga0466966_0025491 Ga0466966_0025491_195_608 135
54 3300044684 Ga0466966_0084272 Ga0466966_0084272_550_963 135
55 3300044693 Ga0466961_0041781 Ga0466961_0041781_867_1280 135
56 3300044694 Ga0466963_0613275 Ga0466963_0613275_134_547 135
57 3300044765 Ga0466970_0017412 Ga0466970_0017412_2619_3032 135
58 3300044765 Ga0466970_0313793 Ga0466970_0313793_449_862 135
59 3300045049 Ga0466959_0035220 Ga0466959_0035220_1546_1959 135
60 3300045836 Ga0466958_0051767 Ga0466958_0051767_215_628 135
61 3300045976 Ga0466967_2612026 Ga0466967_2612026_70_483 135
62 3300046457 Ga0495590_0148574 Ga0495590_0148574_199_606 135
63 3300046460 Ga0495638_0031855 Ga0495638_0031855_768_1184 135
64 3300046680 Ga0495646_0543150 Ga0495646_0543150_56_466 135
65 3300048904 Ga0496101_0101363 Ga0496101_0101363_957_1367 135
66 3300048905 Ga0496102_0159761 Ga0496102_0159761_442_852 135
67 3300048905 Ga0496102_0531821 Ga0496102_0531821_73_480 135
68 3300048906 Ga0496103_0176171 Ga0496103_0176171_708_1118 135
69 3300048907 Ga0496104_0488133 Ga0496104_0488133_401_811 135
70 3300048907 Ga0496104_0531905 Ga0496104_0531905_257_664 135
71 3300048909 Ga0496106_0066749 Ga0496106_0066749_607_1017 135
72 3300048910 Ga0496107_1006317 Ga0496107_1006317_125_535 135
73 3300048911 Ga0496108_0093262 Ga0496108_0093262_952_1359 135
74 3300048912 Ga0496109_0039251 Ga0496109_0039251_2963_3370 135
75 3300048912 Ga0496109_2024346 Ga0496109_2024346_45_455 135
76 3300048913 Ga0496110_0482730 Ga0496110_0482730_707_1114 135
77 3300048913 Ga0496110_0884840 Ga0496110_0884840_201_611 135
78 3300048914 Ga0496111_0683314 Ga0496111_0683314_168_575 135
79 3300048915 Ga0496112_0047627 Ga0496112_0047627_2184_2591 135
80 3300048916 Ga0496113_0678103 Ga0496113_0678103_180_587 135
81 3300048917 Ga0496114_1212876 Ga0496114_1212876_32_442 135
82 3300048918 Ga0496115_0515077 Ga0496115_0515077_392_799 135
83 3300048924 Ga0496121_0196767 Ga0496121_0196767_480_887 135
84 3300049571 Ga0501034_1644091 Ga0501034_1644091_74_484 135
85 3300049579 Ga0501043_0675836 Ga0501043_0675836_166_576 135
86 3300050490 nmdc:mga03n38_289399_c1 nmdc:mga03n38_289399_c1_434_841 135
87 3300050490 nmdc:mga03n38_86408_c1 nmdc:mga03n38_86408_c1_659_1066 135
88 3300050490 nmdc:mga03n38_97903_c1 nmdc:mga03n38_97903_c1_104_511 135
89 3300050491 nmdc:mga00v17_1074438_c1 nmdc:mga00v17_1074438_c1_62_469 135
90 3300050491 nmdc:mga00v17_121687_c1 nmdc:mga00v17_121687_c1_656_1063 135
91 3300050491 nmdc:mga00v17_7667_c1 nmdc:mga00v17_7667_c1_844_1251 135
92 3300050492 nmdc:mga0yw44_42360_c1 nmdc:mga0yw44_42360_c1_1484_1891 135
93 3300050495 nmdc:mga04h51_270635_c1 nmdc:mga04h51_270635_c1_40_447 135
94 3300050496 nmdc:mga07m45_1959_c1 nmdc:mga07m45_1959_c1_191_598 135
95 3300050496 nmdc:mga07m45_266689_c1 nmdc:mga07m45_266689_c1_126_533 135
96 3300050496 nmdc:mga07m45_36476_c1 nmdc:mga07m45_36476_c1_1825_2232 135
97 3300050516 nmdc:mga0sz30_454914_c1 nmdc:mga0sz30_454914_c1_51_458 135
98 3300050516 nmdc:mga0sz30_482289_c1 nmdc:mga0sz30_482289_c1_76_483 135
99 3300053083 Ga0495655_0005732 Ga0495655_0005732_895_1302 135
100 3300053087 Ga0500643_008471 Ga0500643_008471_719_1126 135
101 3300053108 Ga0500562_013697 Ga0500562_013697_1608_2024 135
102 3300053131 Ga0500652_012040 Ga0500652_012040_400_807 135
103 3300053139 Ga0500568_0083091 Ga0500568_0083091_757_1173 135
104 3300053153 Ga0500616_0042721 Ga0500616_0042721_1763_2170 135
105 3300053730 Ga0500645_015753 Ga0500645_015753_884_1297 135
106 3300006038 Ga0075365_10112734 Ga0075365_101127342 142
107 3300006051 Ga0075364_10228923 Ga0075364_102289232 142
108 3300006177 Ga0075362_10056074 Ga0075362_100560742 142
109 3300006186 Ga0075369_10015976 Ga0075369_100159765 142
110 3300006353 Ga0075370_10000287 Ga0075370_1000028712 142
111 iso_pu_bacteria 2902792274 2902798482 142
112 3300044683 Ga0466965_0045585 Ga0466965_0045585_395_847 143
113 3300044694 Ga0466963_0291977 Ga0466963_0291977_88_540 143
114 3300045976 Ga0466967_0117244 Ga0466967_0117244_717_1169 143
115 3300049586 Ga0501070_0134172 Ga0501070_0134172_980_1432 143
116 3300049742 Ga0501080_0796554 Ga0501080_0796554_119_571 143
117 iso_pu_bacteria 2738541274 2738708085 143
118 iso_pu_bacteria 2738543028 2739334337 143
119 iso_pu_bacteria 2929212328 2929214972 143
120 3300005347 Ga0070668_100002934 Ga0070668_1000029345 145
121 3300005365 Ga0070688_100908445 Ga0070688_1009084451 145
122 3300005535 Ga0070684_100109457 Ga0070684_1001094574 145
123 3300005544 Ga0070686_100232858 Ga0070686_1002328581 145
124 3300005547 Ga0070693_101245355 Ga0070693_1012453551 145
125 3300005548 Ga0070665_100698241 Ga0070665_1006982412 145
126 3300005578 Ga0068854_100154083 Ga0068854_1001540833 145
127 3300005616 Ga0068852_100400566 Ga0068852_1004005662 145
128 3300006048 Ga0075363_100036748 Ga0075363_1000367483 145
129 3300011119 Ga0105246_10152188 Ga0105246_101521883 145
130 3300013297 Ga0157378_11162375 Ga0157378_111623751 145
131 3300013308 Ga0157375_10166434 Ga0157375_101664343 145
132 3300025972 Ga0207668_10000619 Ga0207668_1000061916 145
133 3300025981 Ga0207640_10108529 Ga0207640_101085292 145
134 3300046663 Ga0495635_0082005 Ga0495635_0082005_65_520 145
135 3300048091 Ga0495626_0029280 Ga0495626_0029280_1737_2192 145
136 3300048903 Ga0496100_0420436 Ga0496100_0420436_320_775 145
137 3300048905 Ga0496102_1668690 Ga0496102_1668690_80_535 145
138 3300048910 Ga0496107_0510924 Ga0496107_0510924_165_620 145
139 3300048911 Ga0496108_0006358 Ga0496108_0006358_7557_8012 145
140 3300048912 Ga0496109_0222696 Ga0496109_0222696_1093_1548 145
141 3300048915 Ga0496112_0168726 Ga0496112_0168726_314_769 145
142 3300048916 Ga0496113_0111164 Ga0496113_0111164_1652_2107 145
143 3300048929 Ga0496126_0167137 Ga0496126_0167137_353_808 145
144 3300050490 nmdc:mga03n38_22130_c1 nmdc:mga03n38_22130_c1_767_1222 145
145 3300053080 Ga0500635_0001125 Ga0500635_0001125_3740_4195 145
146 3300053108 Ga0500562_012970 Ga0500562_012970_444_899 145
147 3300053131 Ga0500652_000343 Ga0500652_000343_384_839 145
148 iso_pu_bacteria 2939582691 2939587352 145
149 3300005336 Ga0070680_100152412 Ga0070680_1001524122 146
150 3300005343 Ga0070687_100047653 Ga0070687_1000476532 146
151 3300005353 Ga0070669_100003554 Ga0070669_10000355410 146
152 3300005356 Ga0070674_100641988 Ga0070674_1006419882 146
153 3300005367 Ga0070667_100000408 Ga0070667_10000040842 146
154 3300005434 Ga0070709_10018972 Ga0070709_100189724 146
155 3300005435 Ga0070714_102197493 Ga0070714_1021974931 146
156 3300005437 Ga0070710_10036828 Ga0070710_100368283 146
157 3300005439 Ga0070711_100035334 Ga0070711_1000353344 146
158 3300005440 Ga0070705_100425533 Ga0070705_1004255332 146
159 3300005455 Ga0070663_100637150 Ga0070663_1006371502 146
160 3300005459 Ga0068867_100110512 Ga0068867_1001105124 146
161 3300005546 Ga0070696_100159615 Ga0070696_1001596153 146
162 3300005547 Ga0070693_100127606 Ga0070693_1001276062 146
163 3300005548 Ga0070665_100003972 Ga0070665_1000039726 146
164 3300005548 Ga0070665_100446358 Ga0070665_1004463582 146
165 3300005563 Ga0068855_100036427 Ga0068855_1000364273 146
166 3300005615 Ga0070702_100014257 Ga0070702_1000142573 146
167 3300005617 Ga0068859_100000542 Ga0068859_10000054212 146
168 3300005618 Ga0068864_100702206 Ga0068864_1007022062 146
169 3300005718 Ga0068866_10075528 Ga0068866_100755282 146
170 3300005841 Ga0068863_100000352 Ga0068863_10000035214 146
171 3300005841 Ga0068863_102187825 Ga0068863_1021878251 146
172 3300005842 Ga0068858_100016485 Ga0068858_1000164856 146
173 3300005843 Ga0068860_100000542 Ga0068860_10000054243 146
174 3300005843 Ga0068860_100230379 Ga0068860_1002303792 146
175 3300005844 Ga0068862_100000422 Ga0068862_10000042241 146
176 3300005844 Ga0068862_101613373 Ga0068862_1016133731 146
177 3300006038 Ga0075365_10102960 Ga0075365_101029603 146
178 3300006051 Ga0075364_10090486 Ga0075364_100904863 146
179 3300006358 Ga0068871_100057314 Ga0068871_1000573142 146
180 3300006844 Ga0075428_100035815 Ga0075428_1000358156 146
181 3300006846 Ga0075430_100214819 Ga0075430_1002148192 146
182 3300006931 Ga0097620_100000542 Ga0097620_10000054212 146
183 3300009094 Ga0111539_12719788 Ga0111539_127197881 146
184 3300009101 Ga0105247_10000058 Ga0105247_1000005842 146
185 3300009147 Ga0114129_10108396 Ga0114129_101083963 146
186 3300009176 Ga0105242_10279488 Ga0105242_102794883 146
187 3300009177 Ga0105248_10000465 Ga0105248_1000046543 146
188 3300009177 Ga0105248_10036073 Ga0105248_100360732 146
189 3300009551 Ga0105238_10947671 Ga0105238_109476712 146
190 3300009553 Ga0105249_10000087 Ga0105249_1000008795 146
191 3300009553 Ga0105249_10627356 Ga0105249_106273561 146
192 3300009553 Ga0105249_10699595 Ga0105249_106995952 146
193 3300013102 Ga0157371_10165008 Ga0157371_101650082 146
194 3300013306 Ga0163162_11304972 Ga0163162_113049722 146
195 3300013306 Ga0163162_12666959 Ga0163162_126669591 146
196 3300013306 Ga0163162_12999203 Ga0163162_129992031 146
197 3300013307 Ga0157372_10055211 Ga0157372_100552115 146
198 3300014325 Ga0163163_10009561 Ga0163163_100095619 146
199 3300014326 Ga0157380_10695762 Ga0157380_106957622 146
200 3300014745 Ga0157377_10006511 Ga0157377_100065114 146
201 3300014968 Ga0157379_11347689 Ga0157379_113476892 146
202 3300017792 Ga0163161_10023632 Ga0163161_100236322 146
203 3300025898 Ga0207692_10081224 Ga0207692_100812243 146
204 3300025900 Ga0207710_10000085 Ga0207710_1000008541 146
205 3300025901 Ga0207688_10526800 Ga0207688_105268002 146
206 3300025908 Ga0207643_10231842 Ga0207643_102318421 146
207 3300025914 Ga0207671_10004495 Ga0207671_100044954 146
208 3300025915 Ga0207693_10002292 Ga0207693_100022926 146
209 3300025916 Ga0207663_10344331 Ga0207663_103443312 146
210 3300025918 Ga0207662_10104698 Ga0207662_101046982 146
211 3300025923 Ga0207681_10136028 Ga0207681_101360283 146
212 3300025924 Ga0207694_10901042 Ga0207694_109010421 146
213 3300025934 Ga0207686_10223741 Ga0207686_102237412 146
214 3300025938 Ga0207704_10188890 Ga0207704_101888902 146
215 3300025941 Ga0207711_10000071 Ga0207711_1000007157 146
216 3300025949 Ga0207667_10092333 Ga0207667_100923333 146
217 3300025961 Ga0207712_10000040 Ga0207712_10000040145 146
218 3300025961 Ga0207712_11435063 Ga0207712_114350631 146
219 3300025986 Ga0207658_10000121 Ga0207658_1000012127 146
220 3300025986 Ga0207658_10354579 Ga0207658_103545792 146
221 3300026035 Ga0207703_10002898 Ga0207703_100028981 146
222 3300026041 Ga0207639_10736567 Ga0207639_107365672 146
223 3300026067 Ga0207678_10024309 Ga0207678_100243095 146
224 3300026067 Ga0207678_10495950 Ga0207678_104959502 146
225 3300026067 Ga0207678_10515906 Ga0207678_105159062 146
226 3300026088 Ga0207641_10000485 Ga0207641_1000048538 146
227 3300026088 Ga0207641_11982435 Ga0207641_119824351 146
228 3300026089 Ga0207648_10020697 Ga0207648_100206972 146
229 3300026095 Ga0207676_11198876 Ga0207676_111988762 146
230 3300026118 Ga0207675_100013470 Ga0207675_1000134704 146
231 3300028379 Ga0268266_10005247 Ga0268266_1000524711 146
232 3300028380 Ga0268265_10000004 Ga0268265_10000004492 146
233 3300028381 Ga0268264_10000133 Ga0268264_10000133145 146
234 3300028381 Ga0268264_10224076 Ga0268264_102240762 146
235 3300031995 Ga0307409_100039188 Ga0307409_1000391884 146
236 3300034817 Ga0373948_0048341 Ga0373948_0048341_136_597 146
237 3300035242 Ga0373962_0067467 Ga0373962_0067467_540_1001 146
238 3300035691 Ga0373931_0039772 Ga0373931_0039772_1334_1795 146
239 3300041452 Ga0451793_1408289 Ga0451793_1408289_15_467 146
240 3300044658 Ga0466972_0023220 Ga0466972_0023220_2085_2537 146
241 3300044694 Ga0466963_0021446 Ga0466963_0021446_3517_3957 146
242 3300044706 Ga0466964_0200181 Ga0466964_0200181_210_662 146
243 3300044719 Ga0466971_0244321 Ga0466971_0244321_402_842 146
244 3300044765 Ga0466970_0021752 Ga0466970_0021752_1058_1510 146
245 3300044765 Ga0466970_0840608 Ga0466970_0840608_64_516 146
246 3300044842 Ga0466957_0021264 Ga0466957_0021264_1296_1736 146
247 3300044901 Ga0466960_0000334 Ga0466960_0000334_7645_8085 146
248 3300045049 Ga0466959_0264137 Ga0466959_0264137_520_960 146
249 3300046519 Ga0495632_0512697 Ga0495632_0512697_39_500 146
250 3300046524 Ga0495648_0001738 Ga0495648_0001738_4194_4634 146
251 3300046530 Ga0495654_0016166 Ga0495654_0016166_111_551 146
252 3300046533 Ga0495640_0110051 Ga0495640_0110051_411_863 146
253 3300046616 Ga0495668_0010557 Ga0495668_0010557_1851_2291 146
254 3300047320 Ga0495672_0001155 Ga0495672_0001155_15130_15570 146
255 3300047320 Ga0495672_0190038 Ga0495672_0190038_103_564 146
256 3300047443 Ga0495687_211589 Ga0495687_211589_105_545 146
257 3300047469 Ga0495673_0000708 Ga0495673_0000708_4063_4503 146
258 3300048903 Ga0496100_0032983 Ga0496100_0032983_1260_1700 146
259 3300048903 Ga0496100_0065540 Ga0496100_0065540_1549_2010 146
260 3300048904 Ga0496101_0058786 Ga0496101_0058786_977_1417 146
261 3300048904 Ga0496101_0563076 Ga0496101_0563076_311_754 146
262 3300048905 Ga0496102_0000251 Ga0496102_0000251_36588_37028 146
263 3300048905 Ga0496102_0551653 Ga0496102_0551653_73_525 146
264 3300048906 Ga0496103_0000990 Ga0496103_0000990_9217_9657 146
265 3300048909 Ga0496106_0105320 Ga0496106_0105320_794_1234 146
266 3300048909 Ga0496106_0894292 Ga0496106_0894292_169_609 146
267 3300048910 Ga0496107_0297426 Ga0496107_0297426_552_1013 146
268 3300048911 Ga0496108_0076119 Ga0496108_0076119_2159_2611 146
269 3300048912 Ga0496109_0119959 Ga0496109_0119959_20_472 146
270 3300048914 Ga0496111_0109413 Ga0496111_0109413_1475_1936 146
271 3300048915 Ga0496112_0068021 Ga0496112_0068021_2313_2756 146
272 3300048915 Ga0496112_0299924 Ga0496112_0299924_119_580 146
273 3300048916 Ga0496113_0441424 Ga0496113_0441424_320_763 146
274 3300048917 Ga0496114_0092760 Ga0496114_0092760_1483_1935 146
275 3300048918 Ga0496115_0745830 Ga0496115_0745830_127_570 146
276 3300048919 Ga0496116_0004515 Ga0496116_0004515_11332_11772 146
277 3300048920 Ga0496117_0002020 Ga0496117_0002020_12492_12932 146
278 3300048921 Ga0496118_0010892 Ga0496118_0010892_2493_2933 146
279 3300048922 Ga0496119_0003106 Ga0496119_0003106_11451_11891 146
280 3300048923 Ga0496120_0123509 Ga0496120_0123509_89_532 146
281 3300048924 Ga0496121_0013630 Ga0496121_0013630_614_1054 146
282 3300048925 Ga0496122_0029757 Ga0496122_0029757_1579_2022 146
283 3300048926 Ga0496123_0008267 Ga0496123_0008267_2997_3440 146
284 3300048927 Ga0496124_0422098 Ga0496124_0422098_231_671 146
285 3300048928 Ga0496125_0065418 Ga0496125_0065418_352_792 146
286 3300048929 Ga0496126_0015261 Ga0496126_0015261_6148_6588 146
287 3300048929 Ga0496126_0019987 Ga0496126_0019987_2056_2499 146
288 3300049569 Ga0501032_0004377 Ga0501032_0004377_9025_9465 146
289 3300049571 Ga0501034_0010937 Ga0501034_0010937_6125_6565 146
290 3300049573 Ga0501037_0001890 Ga0501037_0001890_3215_3655 146
291 3300049574 Ga0501038_0008303 Ga0501038_0008303_93_533 146
292 3300049575 Ga0501039_0000951 Ga0501039_0000951_9166_9606 146
293 3300049576 Ga0501040_0506733 Ga0501040_0506733_155_595 146
294 3300049579 Ga0501043_0011675 Ga0501043_0011675_5849_6289 146
295 3300049581 Ga0501047_1222985 Ga0501047_1222985_88_528 146
296 3300049586 Ga0501070_0001052 Ga0501070_0001052_3724_4164 146
297 3300049586 Ga0501070_0423005 Ga0501070_0423005_348_788 146
298 3300049587 Ga0501071_0243671 Ga0501071_0243671_795_1235 146
299 3300049589 Ga0501073_0286202 Ga0501073_0286202_54_494 146
300 3300049823 Ga0501044_0161564 Ga0501044_0161564_982_1422 146
301 3300050491 nmdc:mga00v17_368118_c1 nmdc:mga00v17_368118_c1_268_708 146
302 3300050509 nmdc:mga0qj67_39151_c1 nmdc:mga0qj67_39151_c1_159_605 146
303 3300050510 nmdc:mga06r32_200500_c1 nmdc:mga06r32_200500_c1_1525_1971 146
304 3300053155 Ga0500620_131943 Ga0500620_131943_416_856 146
305 3300002075 JGI24738J21930_10010963 JGI24738J21930_100109632 147
306 3300002076 JGI24749J21850_1006896 JGI24749J21850_10068962 147
307 3300002077 JGI24744J21845_10002222 JGI24744J21845_100022224 147
308 3300002244 JGI24742J22300_10001339 JGI24742J22300_100013394 147
309 3300005330 Ga0070690_100023626 Ga0070690_1000236263 147
310 3300005334 Ga0068869_100121105 Ga0068869_1001211053 147
311 3300005338 Ga0068868_100004288 Ga0068868_1000042882 147
312 3300005340 Ga0070689_100060551 Ga0070689_1000605512 147
313 3300005340 Ga0070689_101394414 Ga0070689_1013944141 147
314 3300005341 Ga0070691_10002040 Ga0070691_100020403 147
315 3300005345 Ga0070692_10014408 Ga0070692_100144083 147
316 3300005347 Ga0070668_100000140 Ga0070668_10000014034 147
317 3300005347 Ga0070668_100000721 Ga0070668_10000072112 147
318 3300005355 Ga0070671_100290174 Ga0070671_1002901742 147
319 3300005355 Ga0070671_100343940 Ga0070671_1003439402 147
320 3300005356 Ga0070674_100001316 Ga0070674_10000131613 147
321 3300005356 Ga0070674_100749188 Ga0070674_1007491882 147
322 3300005365 Ga0070688_100209432 Ga0070688_1002094322 147
323 3300005366 Ga0070659_100341895 Ga0070659_1003418952 147
324 3300005434 Ga0070709_10035233 Ga0070709_100352332 147
325 3300005437 Ga0070710_10002975 Ga0070710_100029757 147
326 3300005438 Ga0070701_10011176 Ga0070701_100111764 147
327 3300005439 Ga0070711_100001002 Ga0070711_1000010027 147
328 3300005440 Ga0070705_100616038 Ga0070705_1006160382 147
329 3300005441 Ga0070700_100010766 Ga0070700_1000107664 147
330 3300005441 Ga0070700_101012888 Ga0070700_1010128881 147
331 3300005455 Ga0070663_102166415 Ga0070663_1021664151 147
332 3300005456 Ga0070678_100000061 Ga0070678_10000006125 147
333 3300005457 Ga0070662_100015415 Ga0070662_1000154156 147
334 3300005459 Ga0068867_100004454 Ga0068867_1000044545 147
335 3300005459 Ga0068867_101797112 Ga0068867_1017971121 147
336 3300005466 Ga0070685_10228342 Ga0070685_102283422 147
337 3300005539 Ga0068853_100000950 Ga0068853_10000095020 147
338 3300005544 Ga0070686_100298331 Ga0070686_1002983312 147
339 3300005544 Ga0070686_101611491 Ga0070686_1016114911 147
340 3300005545 Ga0070695_100254520 Ga0070695_1002545202 147
341 3300005546 Ga0070696_100005654 Ga0070696_10000565411 147
342 3300005547 Ga0070693_100006413 Ga0070693_1000064135 147
343 3300005548 Ga0070665_100319855 Ga0070665_1003198552 147
344 3300005548 Ga0070665_100516843 Ga0070665_1005168432 147
345 3300005549 Ga0070704_100003425 Ga0070704_1000034254 147
346 3300005614 Ga0068856_100228765 Ga0068856_1002287652 147
347 3300005615 Ga0070702_100001059 Ga0070702_10000105911 147
348 3300005615 Ga0070702_100599707 Ga0070702_1005997072 147
349 3300005617 Ga0068859_100014454 Ga0068859_1000144547 147
350 3300005617 Ga0068859_100990880 Ga0068859_1009908802 147
351 3300005618 Ga0068864_101025002 Ga0068864_1010250022 147
352 3300005718 Ga0068866_10000351 Ga0068866_100003516 147
353 3300005719 Ga0068861_100000122 Ga0068861_10000012218 147
354 3300005841 Ga0068863_100546541 Ga0068863_1005465411 147
355 3300005842 Ga0068858_100005649 Ga0068858_10000564910 147
356 3300005842 Ga0068858_101177954 Ga0068858_1011779542 147
357 3300005843 Ga0068860_100001605 Ga0068860_10000160512 147
358 3300005844 Ga0068862_100019043 Ga0068862_1000190432 147
359 3300006038 Ga0075365_10000611 Ga0075365_1000061112 147
360 3300006048 Ga0075363_100000524 Ga0075363_1000005243 147
361 3300006048 Ga0075363_100004827 Ga0075363_1000048277 147
362 3300006048 Ga0075363_100102336 Ga0075363_1001023362 147
363 3300006048 Ga0075363_100129878 Ga0075363_1001298783 147
364 3300006048 Ga0075363_100624165 Ga0075363_1006241652 147
365 3300006051 Ga0075364_10006860 Ga0075364_100068608 147
366 3300006051 Ga0075364_10431815 Ga0075364_104318151 147
367 3300006173 Ga0070716_100025336 Ga0070716_1000253363 147
368 3300006175 Ga0070712_100003776 Ga0070712_10000377612 147
369 3300006177 Ga0075362_10064755 Ga0075362_100647552 147
370 3300006178 Ga0075367_10051136 Ga0075367_100511363 147
371 3300006186 Ga0075369_10319200 Ga0075369_103192002 147
372 3300006353 Ga0075370_10040515 Ga0075370_100405154 147
373 3300006353 Ga0075370_10110179 Ga0075370_101101793 147
374 3300006846 Ga0075430_100042642 Ga0075430_1000426423 147
375 3300006846 Ga0075430_100201255 Ga0075430_1002012553 147
376 3300006881 Ga0068865_100000197 Ga0068865_10000019726 147
377 3300006931 Ga0097620_100014454 Ga0097620_1000144545 147
378 3300006931 Ga0097620_100990920 Ga0097620_1009909202 147
379 3300007076 Ga0075435_100508039 Ga0075435_1005080392 147
380 3300009092 Ga0105250_10020032 Ga0105250_100200322 147
381 3300009098 Ga0105245_10011166 Ga0105245_100111664 147
382 3300009148 Ga0105243_10006505 Ga0105243_100065052 147
383 3300009148 Ga0105243_10889006 Ga0105243_108890062 147
384 3300009176 Ga0105242_10002141 Ga0105242_100021413 147
385 3300009177 Ga0105248_10002640 Ga0105248_1000264019 147
386 3300009177 Ga0105248_10224861 Ga0105248_102248612 147
387 3300009553 Ga0105249_10001439 Ga0105249_1000143915 147
388 3300010375 Ga0105239_10006651 Ga0105239_1000665112 147
389 3300011119 Ga0105246_10321235 Ga0105246_103212352 147
390 3300013297 Ga0157378_10001662 Ga0157378_1000166221 147
391 3300013297 Ga0157378_10792211 Ga0157378_107922111 147
392 3300013306 Ga0163162_10035965 Ga0163162_100359654 147
393 3300013307 Ga0157372_10002481 Ga0157372_100024815 147
394 3300013308 Ga0157375_10036672 Ga0157375_100366723 147
395 3300014745 Ga0157377_10164470 Ga0157377_101644702 147
396 3300014968 Ga0157379_10397106 Ga0157379_103971062 147
397 3300014968 Ga0157379_10790510 Ga0157379_107905102 147
398 3300014969 Ga0157376_10134775 Ga0157376_101347753 147
399 3300021361 Ga0213872_10316685 Ga0213872_103166852 147
400 3300025711 Ga0207696_1063363 Ga0207696_10633632 147
401 3300025898 Ga0207692_10018227 Ga0207692_100182271 147
402 3300025899 Ga0207642_10000428 Ga0207642_1000042813 147
403 3300025901 Ga0207688_10016267 Ga0207688_100162673 147
404 3300025904 Ga0207647_10108365 Ga0207647_101083652 147
405 3300025905 Ga0207685_10058418 Ga0207685_100584182 147
406 3300025914 Ga0207671_10125212 Ga0207671_101252122 147
407 3300025915 Ga0207693_10000189 Ga0207693_1000018948 147
408 3300025923 Ga0207681_10240743 Ga0207681_102407431 147
409 3300025927 Ga0207687_10024573 Ga0207687_100245735 147
410 3300025931 Ga0207644_10799016 Ga0207644_107990161 147
411 3300025932 Ga0207690_10401361 Ga0207690_104013612 147
412 3300025933 Ga0207706_10001089 Ga0207706_1000108916 147
413 3300025934 Ga0207686_10036351 Ga0207686_100363512 147
414 3300025935 Ga0207709_10011503 Ga0207709_100115034 147
415 3300025936 Ga0207670_10025908 Ga0207670_100259083 147
416 3300025937 Ga0207669_10004455 Ga0207669_100044554 147
417 3300025937 Ga0207669_10335076 Ga0207669_103350762 147
418 3300025938 Ga0207704_10110323 Ga0207704_101103232 147
419 3300025939 Ga0207665_10002245 Ga0207665_1000224514 147
420 3300025941 Ga0207711_10113386 Ga0207711_101133862 147
421 3300025941 Ga0207711_10119731 Ga0207711_101197313 147
422 3300025942 Ga0207689_10095097 Ga0207689_100950973 147
423 3300025961 Ga0207712_10033268 Ga0207712_100332686 147
424 3300025972 Ga0207668_10000208 Ga0207668_1000020827 147
425 3300025972 Ga0207668_10094721 Ga0207668_100947212 147
426 3300026023 Ga0207677_10000688 Ga0207677_1000068810 147
427 3300026035 Ga0207703_10004038 Ga0207703_100040384 147
428 3300026035 Ga0207703_10704510 Ga0207703_107045102 147
429 3300026035 Ga0207703_11410837 Ga0207703_114108372 147
430 3300026041 Ga0207639_10020341 Ga0207639_100203414 147
431 3300026075 Ga0207708_10019312 Ga0207708_100193124 147
432 3300026089 Ga0207648_10001727 Ga0207648_1000172710 147
433 3300026095 Ga0207676_11049643 Ga0207676_110496431 147
434 3300026118 Ga0207675_100000325 Ga0207675_10000032522 147
435 3300026121 Ga0207683_10009488 Ga0207683_100094883 147
436 3300028379 Ga0268266_10244021 Ga0268266_102440212 147
437 3300028380 Ga0268265_10033732 Ga0268265_100337322 147
438 3300028381 Ga0268264_10091843 Ga0268264_100918432 147
439 3300031995 Ga0307409_100099414 Ga0307409_1000994144 147
440 3300035691 Ga0373931_0037707 Ga0373931_0037707_870_1313 147
441 3300039437 Ga0436365_1161830 Ga0436365_1161830_4527_4970 147
442 3300039447 Ga0436361_0104508 Ga0436361_0104508_335_778 147
443 3300044658 Ga0466972_0035610 Ga0466972_0035610_1794_2237 147
444 3300044683 Ga0466965_0509035 Ga0466965_0509035_68_511 147
445 3300044684 Ga0466966_0001105 Ga0466966_0001105_141_590 147
446 3300044693 Ga0466961_0023893 Ga0466961_0023893_2165_2614 147
447 3300044719 Ga0466971_0275379 Ga0466971_0275379_283_735 147
448 3300044719 Ga0466971_0635906 Ga0466971_0635906_64_513 147
449 3300044735 Ga0466968_0051197 Ga0466968_0051197_216_665 147
450 3300044765 Ga0466970_0075401 Ga0466970_0075401_645_1094 147
451 3300044842 Ga0466957_0017452 Ga0466957_0017452_1292_1741 147
452 3300044842 Ga0466957_0252169 Ga0466957_0252169_651_1094 147
453 3300044842 Ga0466957_0535127 Ga0466957_0535127_131_580 147
454 3300045049 Ga0466959_0000774 Ga0466959_0000774_797_1246 147
455 3300045836 Ga0466958_0053813 Ga0466958_0053813_1391_1840 147
456 3300045836 Ga0466958_0118552 Ga0466958_0118552_847_1296 147
457 3300045976 Ga0466967_0089756 Ga0466967_0089756_2307_2750 147
458 3300047320 Ga0495672_0159502 Ga0495672_0159502_197_643 147
459 3300048903 Ga0496100_0101068 Ga0496100_0101068_1167_1610 147
460 3300048903 Ga0496100_0594902 Ga0496100_0594902_206_682 147
461 3300048904 Ga0496101_0007749 Ga0496101_0007749_4820_5263 147
462 3300048904 Ga0496101_0025301 Ga0496101_0025301_1071_1547 147
463 3300048905 Ga0496102_0010228 Ga0496102_0010228_7518_7961 147
464 3300048906 Ga0496103_0001967 Ga0496103_0001967_11771_12214 147
465 3300048907 Ga0496104_0004444 Ga0496104_0004444_1842_2318 147
466 3300048909 Ga0496106_0001893 Ga0496106_0001893_12731_13174 147
467 3300048909 Ga0496106_0022496 Ga0496106_0022496_4074_4550 147
468 3300048910 Ga0496107_0002822 Ga0496107_0002822_10463_10906 147
469 3300048915 Ga0496112_1810981 Ga0496112_1810981_51_497 147
470 3300048917 Ga0496114_0000849 Ga0496114_0000849_9937_10380 147
471 3300048917 Ga0496114_0039504 Ga0496114_0039504_2019_2495 147
472 3300048918 Ga0496115_0358607 Ga0496115_0358607_616_1092 147
473 3300048922 Ga0496119_0025597 Ga0496119_0025597_2420_2863 147
474 3300048923 Ga0496120_0396886 Ga0496120_0396886_79_522 147
475 3300048928 Ga0496125_0239646 Ga0496125_0239646_119_562 147
476 3300048929 Ga0496126_0007292 Ga0496126_0007292_9038_9481 147
477 3300048929 Ga0496126_0058874 Ga0496126_0058874_2385_2828 147
478 3300049571 Ga0501034_0453523 Ga0501034_0453523_43_486 147
479 3300049579 Ga0501043_0230336 Ga0501043_0230336_339_782 147
480 3300049581 Ga0501047_1097956 Ga0501047_1097956_33_479 147
481 3300050490 nmdc:mga03n38_379707_c1 nmdc:mga03n38_379707_c1_90_533 147
482 3300050491 nmdc:mga00v17_32838_c1 nmdc:mga00v17_32838_c1_2574_3017 147
483 3300050509 nmdc:mga0qj67_61779_c1 nmdc:mga0qj67_61779_c1_370_813 147
484 3300050516 nmdc:mga0sz30_122671_c1 nmdc:mga0sz30_122671_c1_157_600 147
485 3300050516 nmdc:mga0sz30_296962_c1 nmdc:mga0sz30_296962_c1_64_507 147
486 3300050516 nmdc:mga0sz30_543550_c1 nmdc:mga0sz30_543550_c1_49_492 147
487 3300053080 Ga0500635_0096312 Ga0500635_0096312_563_1012 147
488 3300053131 Ga0500652_000098 Ga0500652_000098_20789_21235 147
489 3300053136 Ga0500559_0230404 Ga0500559_0230404_180_629 147
490 3300053730 Ga0500645_000039 Ga0500645_000039_2302_2745 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

18

124

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7963 29 145
2nr4-assembly1.cif.gz_A crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447 0.7938 30 82
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7767 29 145
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.726 15 146
8d4w-assembly1.cif.gz_A-2 asymmetric ene-reduction of alpha,beta-unsaturated compounds using msmeg_2850 0.7191 10 146
ID Description Score Start End Superfamily
af_M9MSI4_327_472_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7702 30 57 3.80.10.10
af_O86340_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7135 25 123 2.30.110.10
4y9iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7099 29 144 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7003 29 146 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6994 1 146 2.30.110.10
ID Description Score Start End GO Terms
AF-X7ZF26-F1-model_v4 deleted 0.9924 32 147
AF-A0A1A3KBI2-F1-model_v4 Deazaflavin-dependent nitroreductase 0.988 2 146 GO:0016491
AF-A0A1A2XDC6-F1-model_v4 deleted 0.9851 1 146
AF-A0A1X0E2D4-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9785 1 147 GO:0016491
AF-A0A1A2XDC6-F1-model_v4 deleted 0.9784 1 146

Feature Viewer

pLDDT pTM Quality
89.08 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map