F453898

General Info

Members Datasets Scaffolds Average Seq Length
490 218 980 82

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10294168|Ga0070677_102941681
Length 86
Sequence MSASLKRPFSRDQRTTIVYGMLVFVLIIVILQLWLLTATMNAWLGGDEAVVWPAAAVSAAGFALNAGLLAYLGRMERTRGGTGTQG

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
149 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
150 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
153 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
188 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
189 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
201 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
202 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
203 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
204 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
205 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
206 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
207 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 5.1
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 21.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10294168 3300005333 Bacteria 823
2 Ga0065712_10145435 3300005290 Bacteria 1413
3 Ga0065712_10152426 3300005290 Bacteria 1359
4 Ga0065712_10232608 3300005290 Bacteria 1007
5 Ga0065715_10000271 3300005293 Bacteria 31385
6 Ga0065715_10007901 3300005293 Bacteria 4334
7 Ga0065715_10009665 3300005293 Bacteria 2556
8 Ga0065715_10010525 3300005293 Bacteria 2383
9 Ga0065715_10102745 3300005293 Bacteria 3088
10 Ga0065715_10211489 3300005293 Bacteria 1312
11 Ga0065707_10015517 3300005295 Bacteria 2525
12 Ga0070676_10176209 3300005328 Bacteria 1387
13 Ga0070676_10514708 3300005328 Unclassified 851
14 Ga0070676_10874235 3300005328 Bacteria 668
15 Ga0070676_11078853 3300005328 Bacteria 606
16 Ga0070683_100979854 3300005329 Bacteria 811
17 Ga0070690_100619823 3300005330 Unclassified 823
18 Ga0070690_101293304 3300005330 Bacteria 584
19 Ga0070670_100010796 3300005331 Bacteria 7801
20 Ga0070670_100092102 3300005331 Bacteria 2606
21 Ga0070670_100845365 3300005331 Bacteria 828
22 Ga0070670_100915865 3300005331 Bacteria 795
23 Ga0070670_101884292 3300005331 Unclassified 551
24 Ga0070677_10157372 3300005333 Bacteria 1063
25 Ga0070677_10342826 3300005333 Bacteria 772
26 Ga0070677_10516511 3300005333 Unclassified 650
27 Ga0070677_10580464 3300005333 Unclassified 618
28 Ga0070677_10872932 3300005333 Bacteria 518
29 Ga0068869_100137463 3300005334 Bacteria 1884
30 Ga0068869_100608441 3300005334 Bacteria 924
31 Ga0068869_100917286 3300005334 Unclassified 759
32 Ga0070666_10409369 3300005335 Bacteria 976
33 Ga0070682_101112526 3300005337 Unclassified 662
34 Ga0068868_100741517 3300005338 Bacteria 882
35 Ga0070689_101346141 3300005340 Bacteria 644
36 Ga0070661_100688333 3300005344 Bacteria 832
37 Ga0070661_100872021 3300005344 Bacteria 742
38 Ga0070668_100205845 3300005347 Bacteria 1617
39 Ga0070668_100206491 3300005347 Bacteria 1614
40 Ga0070668_100318463 3300005347 Bacteria 1309
41 Ga0070668_101371900 3300005347 Unclassified 644
42 Ga0070669_100010475 3300005353 Bacteria 6585
43 Ga0070669_100032838 3300005353 Bacteria 3750
44 Ga0070669_100144985 3300005353 Bacteria 1834
45 Ga0070669_100929632 3300005353 Unclassified 744
46 Ga0070669_101501066 3300005353 Bacteria 586
47 Ga0070675_100023720 3300005354 Bacteria 4908
48 Ga0070675_100104948 3300005354 Bacteria 2384
49 Ga0070675_100155418 3300005354 Bacteria 1964
50 Ga0070675_100185048 3300005354 Bacteria 1802
51 Ga0070675_100449878 3300005354 Bacteria 1155
52 Ga0070675_100449891 3300005354 Bacteria 1155
53 Ga0070675_101014146 3300005354 Unclassified 762
54 Ga0070675_101240046 3300005354 Unclassified 687
55 Ga0070675_101907909 3300005354 Bacteria 548
56 Ga0070675_102131527 3300005354 Unclassified 517
57 Ga0070671_100345568 3300005355 Bacteria 1269
58 Ga0070671_100389215 3300005355 Unclassified 1192
59 Ga0070671_101004384 3300005355 Bacteria 731
60 Ga0070674_100045855 3300005356 Bacteria 2988
61 Ga0070674_100315449 3300005356 Bacteria 1251
62 Ga0070674_100341830 3300005356 Bacteria 1206
63 Ga0070674_100432037 3300005356 Bacteria 1083
64 Ga0070674_100720427 3300005356 Bacteria 854
65 Ga0070673_100026810 3300005364 Bacteria 4262
66 Ga0070673_100043739 3300005364 Bacteria 3463
67 Ga0070673_100396522 3300005364 Bacteria 1233
68 Ga0070673_100625324 3300005364 Bacteria 984
69 Ga0070673_100841338 3300005364 Bacteria 849
70 Ga0070688_100013884 3300005365 Bacteria 4555
71 Ga0070688_101186453 3300005365 Bacteria 613
72 Ga0070688_101342356 3300005365 Bacteria 578
73 Ga0070688_101414728 3300005365 Unclassified 564
74 Ga0070688_101468607 3300005365 Unclassified 554
75 Ga0070659_100336030 3300005366 Bacteria 1265
76 Ga0070667_100529166 3300005367 Bacteria 1082
77 Ga0070667_100760958 3300005367 Bacteria 898
78 Ga0070701_10154616 3300005438 Bacteria 1324
79 Ga0070701_10235270 3300005438 Bacteria 1099
80 Ga0070701_10510628 3300005438 Bacteria 782
81 Ga0070700_100030472 3300005441 Bacteria 3224
82 Ga0070700_101455722 3300005441 Bacteria 581
83 Ga0070700_101507173 3300005441 Unclassified 572
84 Ga0070700_101694545 3300005441 Bacteria 542
85 Ga0070663_100231926 3300005455 Bacteria 1454
86 Ga0070663_100724633 3300005455 Unclassified 847
87 Ga0070678_100058666 3300005456 Bacteria 2826
88 Ga0070678_100158251 3300005456 Bacteria 1832
89 Ga0070678_100210830 3300005456 Bacteria 1609
90 Ga0070678_100233851 3300005456 Bacteria 1533
91 Ga0070678_100288675 3300005456 Bacteria 1390
92 Ga0070678_102076811 3300005456 Bacteria 538
93 Ga0070662_100161679 3300005457 Bacteria 1752
94 Ga0070662_100477116 3300005457 Bacteria 1038
95 Ga0070662_100513456 3300005457 Unclassified 1000
96 Ga0070681_11211213 3300005458 Bacteria 677
97 Ga0068867_100416062 3300005459 Bacteria 1137
98 Ga0068867_101533174 3300005459 Bacteria 621
99 Ga0070685_10002812 3300005466 Bacteria 8888
100 Ga0070685_10201165 3300005466 Bacteria 1295
101 Ga0070685_10635180 3300005466 Bacteria 772
102 Ga0070685_11561215 3300005466 Bacteria 510
103 Ga0070698_100912733 3300005471 Unclassified 824
104 Ga0068853_100368733 3300005539 Unclassified 1339
105 Ga0068853_100939650 3300005539 Bacteria 831
106 Ga0070672_100006637 3300005543 Bacteria 7796
107 Ga0070672_100038012 3300005543 Bacteria 3676
108 Ga0070672_100145451 3300005543 Bacteria 1958
109 Ga0070672_100462470 3300005543 Unclassified 1094
110 Ga0070686_100208648 3300005544 Bacteria 1405
111 Ga0070686_100577300 3300005544 Bacteria 883
112 Ga0070693_100865621 3300005547 Bacteria 675
113 Ga0070665_100588075 3300005548 Bacteria 1126
114 Ga0070665_101997490 3300005548 Bacteria 585
115 Ga0070704_101598618 3300005549 Unclassified 601
116 Ga0070664_100320746 3300005564 Bacteria 1404
117 Ga0070664_101076421 3300005564 Bacteria 757
118 Ga0068857_100105951 3300005577 Bacteria 2525
119 Ga0068857_100682982 3300005577 Bacteria 975
120 Ga0070702_100155392 3300005615 Bacteria 1473
121 Ga0070702_100178176 3300005615 Bacteria 1388
122 Ga0070702_101318140 3300005615 Bacteria 587
123 Ga0068852_100086812 3300005616 Bacteria 2790
124 Ga0068852_100868933 3300005616 Unclassified 918
125 Ga0068852_101503326 3300005616 Unclassified 696
126 Ga0068859_100123467 3300005617 Bacteria 2657
127 Ga0068859_102376514 3300005617 Unclassified 584
128 Ga0068859_102507195 3300005617 Bacteria 568
129 Ga0068864_100002364 3300005618 Bacteria 15608
130 Ga0068864_100297342 3300005618 Bacteria 1510
131 Ga0068861_100217827 3300005719 Bacteria 1612
132 Ga0068861_100682002 3300005719 Unclassified 953
133 Ga0068861_100978457 3300005719 Bacteria 806
134 Ga0068861_101736629 3300005719 Bacteria 618
135 Ga0068851_10076467 3300005834 Bacteria 1741
136 Ga0068870_10050449 3300005840 Bacteria 2199
137 Ga0068870_10186155 3300005840 Bacteria 1250
138 Ga0068870_10846876 3300005840 Unclassified 642
139 Ga0068870_11253269 3300005840 Unclassified 539
140 Ga0068863_100030996 3300005841 Bacteria 5106
141 Ga0068858_101958908 3300005842 Bacteria 579
142 Ga0068860_101350133 3300005843 Bacteria 734
143 Ga0068862_100039597 3300005844 Bacteria 4003
144 Ga0068862_100475013 3300005844 Bacteria 1183
145 Ga0068862_100708528 3300005844 Bacteria 976
146 Ga0068862_101044715 3300005844 Bacteria 810
147 Ga0075367_10345261 3300006178 Bacteria 939
148 Ga0097621_100338673 3300006237 Bacteria 1335
149 Ga0097621_100580141 3300006237 Bacteria 1023
150 Ga0068871_100006916 3300006358 Bacteria 8080
151 Ga0068871_100361002 3300006358 Bacteria 1287
152 Ga0068871_100473453 3300006358 Bacteria 1126
153 Ga0075428_100001990 3300006844 Bacteria 22025
154 Ga0075430_100011277 3300006846 Bacteria 7579
155 Ga0075430_100038772 3300006846 Bacteria 4035
156 Ga0075430_100184437 3300006846 Unclassified 1735
157 Ga0075430_101686931 3300006846 Bacteria 520
158 Ga0075431_100003585 3300006847 Bacteria 15045
159 Ga0075431_100007033 3300006847 Bacteria 11174
160 Ga0075433_10467656 3300006852 Bacteria 1111
161 Ga0075434_101650610 3300006871 Bacteria 649
162 Ga0075429_100008714 3300006880 Bacteria 8823
163 Ga0068865_100078357 3300006881 Bacteria 2364
164 Ga0068865_101655936 3300006881 Bacteria 576
165 Ga0068865_102001130 3300006881 Unclassified 526
166 Ga0097620_100123459 3300006931 Bacteria 2657
167 Ga0097620_102377601 3300006931 Unclassified 584
168 Ga0097620_102507026 3300006931 Bacteria 568
169 Ga0111539_10001047 3300009094 Bacteria 36383
170 Ga0111539_10078168 3300009094 Bacteria 3893
171 Ga0111539_10140536 3300009094 Bacteria 2827
172 Ga0111539_10451468 3300009094 Bacteria 1497
173 Ga0111539_10583849 3300009094 Bacteria 1301
174 Ga0111539_10589738 3300009094 Bacteria 1294
175 Ga0111539_10971209 3300009094 Bacteria 988
176 Ga0111539_11007610 3300009094 Bacteria 968
177 Ga0111539_11789902 3300009094 Bacteria 712
178 Ga0105245_10498557 3300009098 Bacteria 1233
179 Ga0105245_10919152 3300009098 Bacteria 917
180 Ga0105245_11287747 3300009098 Bacteria 780
181 Ga0105245_11291709 3300009098 Unclassified 779
182 Ga0105245_11658793 3300009098 Unclassified 691
183 Ga0105247_11087383 3300009101 Bacteria 630
184 Ga0114129_10000746 3300009147 Bacteria 41323
185 Ga0114129_10048680 3300009147 Bacteria 5956
186 Ga0105243_11986686 3300009148 Bacteria 616
187 Ga0105243_12779235 3300009148 Bacteria 530
188 Ga0105241_10021904 3300009174 Bacteria 4730
189 Ga0105242_10012750 3300009176 Bacteria 6473
190 Ga0105242_10051815 3300009176 Bacteria 3346
191 Ga0105242_13027245 3300009176 Unclassified 520
192 Ga0105248_10036165 3300009177 Bacteria 5523
193 Ga0105248_10103888 3300009177 Bacteria 3203
194 Ga0105248_10373939 3300009177 Bacteria 1604
195 Ga0105248_11327743 3300009177 Bacteria 813
196 Ga0105248_11728070 3300009177 Bacteria 709
197 Ga0105248_12128098 3300009177 Bacteria 638
198 Ga0105248_12622772 3300009177 Bacteria 575
199 Ga0105249_10004466 3300009553 Bacteria 12093
200 Ga0105249_10067342 3300009553 Bacteria 3299
201 Ga0105249_11117268 3300009553 Bacteria 858
202 Ga0105249_11348378 3300009553 Bacteria 785
203 Ga0105239_10182794 3300010375 Bacteria 2346
204 Ga0105246_10131363 3300011119 Bacteria 1871
205 Ga0105246_10897451 3300011119 Unclassified 794
206 Ga0157370_10565785 3300013104 Bacteria 1042
207 Ga0157374_10864347 3300013296 Bacteria 921
208 Ga0157374_11553502 3300013296 Bacteria 685
209 Ga0157374_12635096 3300013296 Bacteria 530
210 Ga0157378_11096838 3300013297 Bacteria 833
211 Ga0163162_10019084 3300013306 Bacteria 6724
212 Ga0163162_10245631 3300013306 Bacteria 1922
213 Ga0163162_10629051 3300013306 Unclassified 1198
214 Ga0163162_10647803 3300013306 Bacteria 1180
215 Ga0157375_10015843 3300013308 Bacteria 6755
216 Ga0157375_10153234 3300013308 Bacteria 2442
217 Ga0157375_10199921 3300013308 Bacteria 2154
218 Ga0157375_11822185 3300013308 Unclassified 722
219 Ga0163163_10091973 3300014325 Bacteria 3048
220 Ga0163163_10379868 3300014325 Unclassified 1470
221 Ga0163163_10460105 3300014325 Bacteria 1333
222 Ga0163163_10885552 3300014325 Bacteria 956
223 Ga0163163_11503043 3300014325 Bacteria 735
224 Ga0157380_10043931 3300014326 Unclassified 3499
225 Ga0157380_10187691 3300014326 Bacteria 1822
226 Ga0157380_10482456 3300014326 Bacteria 1199
227 Ga0157380_10759360 3300014326 Unclassified 982
228 Ga0157380_11212864 3300014326 Bacteria 798
229 Ga0157380_11259030 3300014326 Bacteria 785
230 Ga0157380_11308787 3300014326 Bacteria 772
231 Ga0157379_11803378 3300014968 Bacteria 601
232 Ga0157376_10024370 3300014969 Bacteria 4749
233 Ga0157376_10184236 3300014969 Bacteria 1910
234 Ga0157376_10206348 3300014969 Bacteria 1811
235 Ga0157376_10424473 3300014969 Bacteria 1291
236 Ga0157376_11244124 3300014969 Bacteria 773
237 Ga0157376_11710331 3300014969 Unclassified 664
238 Ga0163161_10072767 3300017792 Unclassified 2517
239 Ga0163161_11061191 3300017792 Bacteria 694
240 Ga0207697_10002073 3300025315 Bacteria 10552
241 Ga0207697_10183493 3300025315 Bacteria 917
242 Ga0207697_10199763 3300025315 Bacteria 879
243 Ga0207682_10007893 3300025893 Bacteria 4226
244 Ga0207682_10064794 3300025893 Bacteria 1536
245 Ga0207682_10185706 3300025893 Bacteria 951
246 Ga0207682_10245967 3300025893 Bacteria 832
247 Ga0207688_10000713 3300025901 Bacteria 16448
248 Ga0207688_10216865 3300025901 Bacteria 1151
249 Ga0207688_10479723 3300025901 Unclassified 777
250 Ga0207688_10789060 3300025901 Bacteria 602
251 Ga0207680_10342802 3300025903 Unclassified 1048
252 Ga0207680_11078395 3300025903 Bacteria 574
253 Ga0207647_10798096 3300025904 Bacteria 508
254 Ga0207645_10130871 3300025907 Unclassified 1633
255 Ga0207645_10734506 3300025907 Bacteria 671
256 Ga0207643_10014485 3300025908 Bacteria 4285
257 Ga0207643_10058276 3300025908 Bacteria 2201
258 Ga0207643_10152282 3300025908 Bacteria 1387
259 Ga0207643_10659578 3300025908 Bacteria 675
260 Ga0207643_11049704 3300025908 Bacteria 526
261 Ga0207654_10250103 3300025911 Bacteria 1188
262 Ga0207662_10803436 3300025918 Unclassified 663
263 Ga0207649_10606129 3300025920 Bacteria 843
264 Ga0207649_10969599 3300025920 Bacteria 668
265 Ga0207681_10026287 3300025923 Bacteria 3753
266 Ga0207681_10298007 3300025923 Bacteria 1275
267 Ga0207681_10442297 3300025923 Bacteria 1056
268 Ga0207681_10754983 3300025923 Unclassified 811
269 Ga0207681_10756185 3300025923 Bacteria 810
270 Ga0207681_11401582 3300025923 Bacteria 587
271 Ga0207650_10024051 3300025925 Bacteria 4326
272 Ga0207650_11422335 3300025925 Unclassified 590
273 Ga0207650_11882320 3300025925 Unclassified 505
274 Ga0207650_11889737 3300025925 Unclassified 504
275 Ga0207659_10003315 3300025926 Bacteria 9650
276 Ga0207659_10009582 3300025926 Bacteria 6058
277 Ga0207659_10148012 3300025926 Unclassified 1831
278 Ga0207659_10563391 3300025926 Bacteria 969
279 Ga0207659_10869789 3300025926 Unclassified 775
280 Ga0207659_11243295 3300025926 Bacteria 640
281 Ga0207659_11646086 3300025926 Bacteria 547
282 Ga0207687_10306072 3300025927 Bacteria 1281
283 Ga0207687_10417783 3300025927 Bacteria 1106
284 Ga0207687_10651211 3300025927 Bacteria 891
285 Ga0207644_10390946 3300025931 Bacteria 1135
286 Ga0207690_10398094 3300025932 Bacteria 1098
287 Ga0207706_10221464 3300025933 Bacteria 1657
288 Ga0207706_10263340 3300025933 Bacteria 1505
289 Ga0207686_11355958 3300025934 Bacteria 585
290 Ga0207709_10795864 3300025935 Unclassified 763
291 Ga0207670_10183716 3300025936 Bacteria 1577
292 Ga0207670_10811923 3300025936 Bacteria 780
293 Ga0207670_11376838 3300025936 Unclassified 599
294 Ga0207670_11803058 3300025936 Unclassified 520
295 Ga0207669_10043542 3300025937 Bacteria 2630
296 Ga0207669_10355940 3300025937 Bacteria 1133
297 Ga0207669_10729742 3300025937 Unclassified 816
298 Ga0207704_10504763 3300025938 Unclassified 975
299 Ga0207691_10009895 3300025940 Bacteria 9154
300 Ga0207691_10015301 3300025940 Bacteria 7298
301 Ga0207691_10056709 3300025940 Bacteria 3568
302 Ga0207691_10153723 3300025940 Bacteria 2022
303 Ga0207691_10157094 3300025940 Bacteria 1997
304 Ga0207691_10277427 3300025940 Bacteria 1443
305 Ga0207711_10031258 3300025941 Bacteria 4494
306 Ga0207711_10304391 3300025941 Bacteria 1471
307 Ga0207711_10568612 3300025941 Unclassified 1057
308 Ga0207689_10074150 3300025942 Bacteria 2796
309 Ga0207689_10299213 3300025942 Bacteria 1333
310 Ga0207651_10126041 3300025960 Bacteria 1951
311 Ga0207651_10207695 3300025960 Bacteria 1574
312 Ga0207651_10457580 3300025960 Bacteria 1096
313 Ga0207712_10082808 3300025961 Bacteria 2340
314 Ga0207668_10027340 3300025972 Bacteria 3715
315 Ga0207668_10080191 3300025972 Bacteria 2364
316 Ga0207668_10629880 3300025972 Unclassified 937
317 Ga0207668_11524530 3300025972 Unclassified 603
318 Ga0207640_10482679 3300025981 Bacteria 1028
319 Ga0207640_11840619 3300025981 Unclassified 547
320 Ga0207658_10100203 3300025986 Bacteria 2268
321 Ga0207658_10935984 3300025986 Unclassified 790
322 Ga0207677_10640886 3300026023 Bacteria 937
323 Ga0207703_12105277 3300026035 Bacteria 540
324 Ga0207639_10698553 3300026041 Bacteria 941
325 Ga0207678_10073027 3300026067 Unclassified 2940
326 Ga0207678_10206699 3300026067 Bacteria 1679
327 Ga0207678_11182500 3300026067 Bacteria 677
328 Ga0207708_10053561 3300026075 Bacteria 3074
329 Ga0207708_10089079 3300026075 Bacteria 2378
330 Ga0207708_10563016 3300026075 Bacteria 962
331 Ga0207641_10629560 3300026088 Bacteria 1052
332 Ga0207648_10045477 3300026089 Bacteria 3850
333 Ga0207648_10054968 3300026089 Bacteria 3476
334 Ga0207648_11582470 3300026089 Unclassified 616
335 Ga0207676_10004585 3300026095 Bacteria 9789
336 Ga0207676_10039294 3300026095 Bacteria 3619
337 Ga0207676_10815898 3300026095 Unclassified 911
338 Ga0207674_10030800 3300026116 Bacteria 5639
339 Ga0207675_100020481 3300026118 Bacteria 6164
340 Ga0207675_101116690 3300026118 Bacteria 808
341 Ga0207683_10034584 3300026121 Bacteria 4392
342 Ga0207683_10129320 3300026121 Bacteria 2271
343 Ga0207683_10498626 3300026121 Bacteria 1124
344 Ga0207683_11017488 3300026121 Bacteria 769
345 Ga0207683_11320223 3300026121 Unclassified 668
346 Ga0207698_10254995 3300026142 Bacteria 1608
347 Ga0207698_11059024 3300026142 Unclassified 823
348 Ga0207698_11281851 3300026142 Unclassified 747
349 Ga0207428_10014070 3300027907 Bacteria 6968
350 Ga0207428_10166217 3300027907 Unclassified 1673
351 Ga0207428_10375831 3300027907 Bacteria 1043
352 Ga0268266_12110525 3300028379 Bacteria 536
353 Ga0268266_12125635 3300028379 Bacteria 534
354 Ga0268265_10173181 3300028380 Bacteria 1847
355 Ga0268265_10188133 3300028380 Bacteria 1780
356 Ga0268265_10300174 3300028380 Bacteria 1446
357 Ga0268265_11067564 3300028380 Unclassified 800
358 Ga0268264_10259702 3300028381 Bacteria 1617
359 Ga0268264_11674246 3300028381 Bacteria 647
360 Ga0307408_100334727 3300031548 Bacteria 1279
361 Ga0307408_100727488 3300031548 Unclassified 894
362 Ga0307408_102040755 3300031548 Unclassified 552
363 Ga0307405_11072957 3300031731 Unclassified 691
364 Ga0307405_11183413 3300031731 Unclassified 660
365 Ga0307405_11184874 3300031731 Unclassified 660
366 Ga0307413_10131634 3300031824 Bacteria 1713
367 Ga0307410_11252882 3300031852 Unclassified 647
368 Ga0307410_12089144 3300031852 Bacteria 506
369 Ga0307406_10120967 3300031901 Bacteria 1820
370 Ga0307406_11234320 3300031901 Unclassified 650
371 Ga0307412_10054894 3300031911 Bacteria 2647
372 Ga0307412_10376971 3300031911 Unclassified 1147
373 Ga0307412_11799196 3300031911 Unclassified 563
374 Ga0307409_100791484 3300031995 Unclassified 955
375 Ga0307409_101671585 3300031995 Unclassified 665
376 Ga0307416_100037552 3300032002 Bacteria 3728
377 Ga0307416_100069774 3300032002 Bacteria 2910
378 Ga0307416_100070714 3300032002 Bacteria 2895
379 Ga0307416_101310300 3300032002 Unclassified 830
380 Ga0307414_11275605 3300032004 Unclassified 681
381 Ga0307411_10060796 3300032005 Bacteria 2511
382 Ga0307411_10089595 3300032005 Bacteria 2143
383 Ga0307411_10303810 3300032005 Unclassified 1281
384 Ga0307415_100072480 3300032126 Bacteria 2426
385 Ga0307415_100394136 3300032126 Bacteria 1180
386 Ga0307415_100484707 3300032126 Bacteria 1077
387 Ga0373944_0295025 3300035089 Unclassified 607
388 Ga0373949_0259856 3300035090 Bacteria 540
389 Ga0373932_0183286 3300035112 Bacteria 736
390 Ga0373955_0322013 3300035172 Bacteria 934
391 Ga0373947_0031866 3300035725 Bacteria 3105
392 Ga0373937_0280285 3300036401 Unclassified 1574
393 Ga0451791_1748595 3300041451 Bacteria 801
394 Ga0451798_0200014 3300041458 Bacteria 547
395 Ga0451800_0245258 3300041459 Bacteria 782
396 Ga0451845_0589553 3300041501 Bacteria 779
397 Ga0451845_0833202 3300041501 Unclassified 534
398 Ga0451853_0123142 3300041512 Bacteria 568
399 Ga0451853_0926306 3300041512 Bacteria 506
400 Ga0451853_1873046 3300041512 Unclassified 727
401 Ga0439433_0223181 3300041999 Bacteria 503
402 Ga0450896_098225 3300042133 Bacteria 505
403 Ga0439464_0107194 3300042439 Bacteria 853
404 Ga0439460_0008483 3300042461 Bacteria 2597
405 Ga0450918_084285 3300042531 Unclassified 609
406 Ga0451576_2045234 3300045051 Bacteria 590
407 Ga0495653_0118695 3300046463 Bacteria 1889
408 Ga0495580_0076193 3300046472 Bacteria 2340
409 Ga0495639_0254607 3300046475 Bacteria 869
410 Ga0495639_0587217 3300046475 Unclassified 572
411 Ga0495608_0295451 3300046511 Bacteria 1004
412 Ga0495630_0248870 3300046517 Unclassified 1358
413 Ga0495631_0333245 3300046518 Bacteria 646
414 Ga0495586_0244342 3300046535 Unclassified 1023
415 Ga0495598_0080354 3300046537 Bacteria 1045
416 Ga0495633_0132630 3300046558 Bacteria 1153
417 Ga0495667_0616853 3300046559 Unclassified 675
418 Ga0495656_0029346 3300046615 Bacteria 2214
419 Ga0495635_0137043 3300046663 Bacteria 1668
420 Ga0495658_0678792 3300046683 Bacteria 660
421 Ga0495613_0455961 3300046689 Unclassified 866
422 Ga0495600_0128184 3300046809 Bacteria 1650
423 Ga0496100_0147458 3300048903 Bacteria 1675
424 Ga0496101_0062320 3300048904 Bacteria 2711
425 Ga0496101_0378714 3300048904 Bacteria 1113
426 Ga0496101_0721347 3300048904 Unclassified 787
427 Ga0496104_0026090 3300048907 Bacteria 5390
428 Ga0496105_0079828 3300048908 Bacteria 2702
429 Ga0496106_0285219 3300048909 Bacteria 1323
430 Ga0496107_1028907 3300048910 Bacteria 597
431 Ga0496108_0013453 3300048911 Bacteria 6676
432 Ga0496108_0261154 3300048911 Bacteria 1507
433 Ga0496108_0261483 3300048911 Bacteria 1506
434 Ga0496109_0000817 3300048912 Bacteria 25948
435 Ga0496109_1116857 3300048912 Unclassified 725
436 Ga0496109_1282814 3300048912 Bacteria 668
437 Ga0496110_0286853 3300048913 Bacteria 1499
438 Ga0496110_0383011 3300048913 Unclassified 1282
439 Ga0496110_0693504 3300048913 Bacteria 919
440 Ga0496111_0465769 3300048914 Bacteria 932
441 Ga0496112_0001125 3300048915 Bacteria 19892
442 Ga0496112_0252313 3300048915 Bacteria 1715
443 Ga0496113_0001636 3300048916 Bacteria 12629
444 Ga0496114_0146299 3300048917 Bacteria 2048
445 Ga0501291_001270 3300049514 Bacteria 2921
446 Ga0501291_013225 3300049514 Unclassified 1218
447 Ga0501293_008654 3300049516 Bacteria 858
448 Ga0501295_155545 3300049518 Unclassified 566
449 Ga0501299_007327 3300049522 Bacteria 1758
450 Ga0501299_015457 3300049522 Bacteria 1341
451 Ga0501034_0530380 3300049571 Bacteria 1088
452 Ga0501040_1218461 3300049576 Bacteria 546
453 Ga0501041_0576635 3300049577 Bacteria 718
454 Ga0501047_0107019 3300049581 Bacteria 2678
455 Ga0501048_1348994 3300049582 Bacteria 513
456 Ga0501071_0985757 3300049587 Bacteria 651
457 Ga0501202_229013 3300049652 Bacteria 517
458 Ga0501207_018351 3300049654 Unclassified 1099
459 Ga0501208_017267 3300049655 Bacteria 1135
460 Ga0501216_022913 3300049660 Bacteria 1107
461 Ga0501217_014698 3300049661 Bacteria 1772
462 Ga0501217_117507 3300049661 Unclassified 769
463 Ga0501243_007631 3300049675 Bacteria 1656
464 Ga0501249_032651 3300049679 Bacteria 1164
465 Ga0501251_107798 3300049681 Unclassified 516
466 Ga0501221_040904 3300049704 Unclassified 1010
467 Ga0501265_003731 3300049762 Bacteria 1732
468 Ga0501268_123891 3300049765 Unclassified 575
469 Ga0501272_012553 3300049769 Bacteria 963
470 Ga0501283_009999 3300049779 Bacteria 1391
471 nmdc:mga0k408_139127_c1 3300050493 Bacteria 1443
472 nmdc:mga06z11_277618_c1 3300050494 Bacteria 992
473 nmdc:mga05p37_143582_c1 3300050507 Bacteria 2923
474 nmdc:mga05p37_545_c1 3300050507 Bacteria 41442
475 nmdc:mga09592_19149_c1 3300050508 Bacteria 5617
476 nmdc:mga09592_6947_c1 3300050508 Bacteria 9204
477 nmdc:mga09592_910578_c1 3300050508 Unclassified 739
478 nmdc:mga0qj67_13202_c1 3300050509 Bacteria 6234
479 nmdc:mga0qj67_331762_c1 3300050509 Unclassified 1231
480 nmdc:mga0qj67_78364_c1 3300050509 Bacteria 2645
481 nmdc:mga06r32_28238_c1 3300050510 Bacteria 5247
482 nmdc:mga06r32_7924_c1 3300050510 Bacteria 9551
483 nmdc:mga08y16_1203371_c1 3300050511 Bacteria 728
484 nmdc:mga08y16_1367314_c1 3300050511 Bacteria 672
485 nmdc:mga08y16_151302_c1 3300050511 Bacteria 2412
486 nmdc:mga08y16_391798_c1 3300050511 Bacteria 1423
487 nmdc:mga08y16_89691_c1 3300050511 Unclassified 3204
488 nmdc:mga0a205_64656_c1 3300050515 Bacteria 3534
489 Ga0495601_0020441 3300053077 Bacteria 4045
490 Ga0495619_0004885 3300053085 Bacteria 8511
491 Ga0070677_10294168
492 Ga0065712_10145435
493 Ga0065712_10152426
494 Ga0065712_10232608
495 Ga0065715_10000271
496 Ga0065715_10007901
497 Ga0065715_10009665
498 Ga0065715_10010525
499 Ga0065715_10102745
500 Ga0065715_10211489
501 Ga0065707_10015517
502 Ga0070676_10176209
503 Ga0070676_10514708
504 Ga0070676_10874235
505 Ga0070676_11078853
506 Ga0070683_100979854
507 Ga0070690_100619823
508 Ga0070690_101293304
509 Ga0070670_100010796
510 Ga0070670_100092102
511 Ga0070670_100845365
512 Ga0070670_100915865
513 Ga0070670_101884292
514 Ga0070677_10157372
515 Ga0070677_10342826
516 Ga0070677_10516511
517 Ga0070677_10580464
518 Ga0070677_10872932
519 Ga0068869_100137463
520 Ga0068869_100608441
521 Ga0068869_100917286
522 Ga0070666_10409369
523 Ga0070682_101112526
524 Ga0068868_100741517
525 Ga0070689_101346141
526 Ga0070661_100688333
527 Ga0070661_100872021
528 Ga0070668_100205845
529 Ga0070668_100206491
530 Ga0070668_100318463
531 Ga0070668_101371900
532 Ga0070669_100010475
533 Ga0070669_100032838
534 Ga0070669_100144985
535 Ga0070669_100929632
536 Ga0070669_101501066
537 Ga0070675_100023720
538 Ga0070675_100104948
539 Ga0070675_100155418
540 Ga0070675_100185048
541 Ga0070675_100449878
542 Ga0070675_100449891
543 Ga0070675_101014146
544 Ga0070675_101240046
545 Ga0070675_101907909
546 Ga0070675_102131527
547 Ga0070671_100345568
548 Ga0070671_100389215
549 Ga0070671_101004384
550 Ga0070674_100045855
551 Ga0070674_100315449
552 Ga0070674_100341830
553 Ga0070674_100432037
554 Ga0070674_100720427
555 Ga0070673_100026810
556 Ga0070673_100043739
557 Ga0070673_100396522
558 Ga0070673_100625324
559 Ga0070673_100841338
560 Ga0070688_100013884
561 Ga0070688_101186453
562 Ga0070688_101342356
563 Ga0070688_101414728
564 Ga0070688_101468607
565 Ga0070659_100336030
566 Ga0070667_100529166
567 Ga0070667_100760958
568 Ga0070701_10154616
569 Ga0070701_10235270
570 Ga0070701_10510628
571 Ga0070700_100030472
572 Ga0070700_101455722
573 Ga0070700_101507173
574 Ga0070700_101694545
575 Ga0070663_100231926
576 Ga0070663_100724633
577 Ga0070678_100058666
578 Ga0070678_100158251
579 Ga0070678_100210830
580 Ga0070678_100233851
581 Ga0070678_100288675
582 Ga0070678_102076811
583 Ga0070662_100161679
584 Ga0070662_100477116
585 Ga0070662_100513456
586 Ga0070681_11211213
587 Ga0068867_100416062
588 Ga0068867_101533174
589 Ga0070685_10002812
590 Ga0070685_10201165
591 Ga0070685_10635180
592 Ga0070685_11561215
593 Ga0070698_100912733
594 Ga0068853_100368733
595 Ga0068853_100939650
596 Ga0070672_100006637
597 Ga0070672_100038012
598 Ga0070672_100145451
599 Ga0070672_100462470
600 Ga0070686_100208648
601 Ga0070686_100577300
602 Ga0070693_100865621
603 Ga0070665_100588075
604 Ga0070665_101997490
605 Ga0070704_101598618
606 Ga0070664_100320746
607 Ga0070664_101076421
608 Ga0068857_100105951
609 Ga0068857_100682982
610 Ga0070702_100155392
611 Ga0070702_100178176
612 Ga0070702_101318140
613 Ga0068852_100086812
614 Ga0068852_100868933
615 Ga0068852_101503326
616 Ga0068859_100123467
617 Ga0068859_102376514
618 Ga0068859_102507195
619 Ga0068864_100002364
620 Ga0068864_100297342
621 Ga0068861_100217827
622 Ga0068861_100682002
623 Ga0068861_100978457
624 Ga0068861_101736629
625 Ga0068851_10076467
626 Ga0068870_10050449
627 Ga0068870_10186155
628 Ga0068870_10846876
629 Ga0068870_11253269
630 Ga0068863_100030996
631 Ga0068858_101958908
632 Ga0068860_101350133
633 Ga0068862_100039597
634 Ga0068862_100475013
635 Ga0068862_100708528
636 Ga0068862_101044715
637 Ga0075367_10345261
638 Ga0097621_100338673
639 Ga0097621_100580141
640 Ga0068871_100006916
641 Ga0068871_100361002
642 Ga0068871_100473453
643 Ga0075428_100001990
644 Ga0075430_100011277
645 Ga0075430_100038772
646 Ga0075430_100184437
647 Ga0075430_101686931
648 Ga0075431_100003585
649 Ga0075431_100007033
650 Ga0075433_10467656
651 Ga0075434_101650610
652 Ga0075429_100008714
653 Ga0068865_100078357
654 Ga0068865_101655936
655 Ga0068865_102001130
656 Ga0097620_100123459
657 Ga0097620_102377601
658 Ga0097620_102507026
659 Ga0111539_10001047
660 Ga0111539_10078168
661 Ga0111539_10140536
662 Ga0111539_10451468
663 Ga0111539_10583849
664 Ga0111539_10589738
665 Ga0111539_10971209
666 Ga0111539_11007610
667 Ga0111539_11789902
668 Ga0105245_10498557
669 Ga0105245_10919152
670 Ga0105245_11287747
671 Ga0105245_11291709
672 Ga0105245_11658793
673 Ga0105247_11087383
674 Ga0114129_10000746
675 Ga0114129_10048680
676 Ga0105243_11986686
677 Ga0105243_12779235
678 Ga0105241_10021904
679 Ga0105242_10012750
680 Ga0105242_10051815
681 Ga0105242_13027245
682 Ga0105248_10036165
683 Ga0105248_10103888
684 Ga0105248_10373939
685 Ga0105248_11327743
686 Ga0105248_11728070
687 Ga0105248_12128098
688 Ga0105248_12622772
689 Ga0105249_10004466
690 Ga0105249_10067342
691 Ga0105249_11117268
692 Ga0105249_11348378
693 Ga0105239_10182794
694 Ga0105246_10131363
695 Ga0105246_10897451
696 Ga0157370_10565785
697 Ga0157374_10864347
698 Ga0157374_11553502
699 Ga0157374_12635096
700 Ga0157378_11096838
701 Ga0163162_10019084
702 Ga0163162_10245631
703 Ga0163162_10629051
704 Ga0163162_10647803
705 Ga0157375_10015843
706 Ga0157375_10153234
707 Ga0157375_10199921
708 Ga0157375_11822185
709 Ga0163163_10091973
710 Ga0163163_10379868
711 Ga0163163_10460105
712 Ga0163163_10885552
713 Ga0163163_11503043
714 Ga0157380_10043931
715 Ga0157380_10187691
716 Ga0157380_10482456
717 Ga0157380_10759360
718 Ga0157380_11212864
719 Ga0157380_11259030
720 Ga0157380_11308787
721 Ga0157379_11803378
722 Ga0157376_10024370
723 Ga0157376_10184236
724 Ga0157376_10206348
725 Ga0157376_10424473
726 Ga0157376_11244124
727 Ga0157376_11710331
728 Ga0163161_10072767
729 Ga0163161_11061191
730 Ga0207697_10002073
731 Ga0207697_10183493
732 Ga0207697_10199763
733 Ga0207682_10007893
734 Ga0207682_10064794
735 Ga0207682_10185706
736 Ga0207682_10245967
737 Ga0207688_10000713
738 Ga0207688_10216865
739 Ga0207688_10479723
740 Ga0207688_10789060
741 Ga0207680_10342802
742 Ga0207680_11078395
743 Ga0207647_10798096
744 Ga0207645_10130871
745 Ga0207645_10734506
746 Ga0207643_10014485
747 Ga0207643_10058276
748 Ga0207643_10152282
749 Ga0207643_10659578
750 Ga0207643_11049704
751 Ga0207654_10250103
752 Ga0207662_10803436
753 Ga0207649_10606129
754 Ga0207649_10969599
755 Ga0207681_10026287
756 Ga0207681_10298007
757 Ga0207681_10442297
758 Ga0207681_10754983
759 Ga0207681_10756185
760 Ga0207681_11401582
761 Ga0207650_10024051
762 Ga0207650_11422335
763 Ga0207650_11882320
764 Ga0207650_11889737
765 Ga0207659_10003315
766 Ga0207659_10009582
767 Ga0207659_10148012
768 Ga0207659_10563391
769 Ga0207659_10869789
770 Ga0207659_11243295
771 Ga0207659_11646086
772 Ga0207687_10306072
773 Ga0207687_10417783
774 Ga0207687_10651211
775 Ga0207644_10390946
776 Ga0207690_10398094
777 Ga0207706_10221464
778 Ga0207706_10263340
779 Ga0207686_11355958
780 Ga0207709_10795864
781 Ga0207670_10183716
782 Ga0207670_10811923
783 Ga0207670_11376838
784 Ga0207670_11803058
785 Ga0207669_10043542
786 Ga0207669_10355940
787 Ga0207669_10729742
788 Ga0207704_10504763
789 Ga0207691_10009895
790 Ga0207691_10015301
791 Ga0207691_10056709
792 Ga0207691_10153723
793 Ga0207691_10157094
794 Ga0207691_10277427
795 Ga0207711_10031258
796 Ga0207711_10304391
797 Ga0207711_10568612
798 Ga0207689_10074150
799 Ga0207689_10299213
800 Ga0207651_10126041
801 Ga0207651_10207695
802 Ga0207651_10457580
803 Ga0207712_10082808
804 Ga0207668_10027340
805 Ga0207668_10080191
806 Ga0207668_10629880
807 Ga0207668_11524530
808 Ga0207640_10482679
809 Ga0207640_11840619
810 Ga0207658_10100203
811 Ga0207658_10935984
812 Ga0207677_10640886
813 Ga0207703_12105277
814 Ga0207639_10698553
815 Ga0207678_10073027
816 Ga0207678_10206699
817 Ga0207678_11182500
818 Ga0207708_10053561
819 Ga0207708_10089079
820 Ga0207708_10563016
821 Ga0207641_10629560
822 Ga0207648_10045477
823 Ga0207648_10054968
824 Ga0207648_11582470
825 Ga0207676_10004585
826 Ga0207676_10039294
827 Ga0207676_10815898
828 Ga0207674_10030800
829 Ga0207675_100020481
830 Ga0207675_101116690
831 Ga0207683_10034584
832 Ga0207683_10129320
833 Ga0207683_10498626
834 Ga0207683_11017488
835 Ga0207683_11320223
836 Ga0207698_10254995
837 Ga0207698_11059024
838 Ga0207698_11281851
839 Ga0207428_10014070
840 Ga0207428_10166217
841 Ga0207428_10375831
842 Ga0268266_12110525
843 Ga0268266_12125635
844 Ga0268265_10173181
845 Ga0268265_10188133
846 Ga0268265_10300174
847 Ga0268265_11067564
848 Ga0268264_10259702
849 Ga0268264_11674246
850 Ga0307408_100334727
851 Ga0307408_100727488
852 Ga0307408_102040755
853 Ga0307405_11072957
854 Ga0307405_11183413
855 Ga0307405_11184874
856 Ga0307413_10131634
857 Ga0307410_11252882
858 Ga0307410_12089144
859 Ga0307406_10120967
860 Ga0307406_11234320
861 Ga0307412_10054894
862 Ga0307412_10376971
863 Ga0307412_11799196
864 Ga0307409_100791484
865 Ga0307409_101671585
866 Ga0307416_100037552
867 Ga0307416_100069774
868 Ga0307416_100070714
869 Ga0307416_101310300
870 Ga0307414_11275605
871 Ga0307411_10060796
872 Ga0307411_10089595
873 Ga0307411_10303810
874 Ga0307415_100072480
875 Ga0307415_100394136
876 Ga0307415_100484707
877 Ga0373944_0295025
878 Ga0373949_0259856
879 Ga0373932_0183286
880 Ga0373955_0322013
881 Ga0373947_0031866
882 Ga0373937_0280285
883 Ga0451791_1748595
884 Ga0451798_0200014
885 Ga0451800_0245258
886 Ga0451845_0589553
887 Ga0451845_0833202
888 Ga0451853_0123142
889 Ga0451853_0926306
890 Ga0451853_1873046
891 Ga0439433_0223181
892 Ga0450896_098225
893 Ga0439464_0107194
894 Ga0439460_0008483
895 Ga0450918_084285
896 Ga0451576_2045234
897 Ga0495653_0118695
898 Ga0495580_0076193
899 Ga0495639_0254607
900 Ga0495639_0587217
901 Ga0495608_0295451
902 Ga0495630_0248870
903 Ga0495631_0333245
904 Ga0495586_0244342
905 Ga0495598_0080354
906 Ga0495633_0132630
907 Ga0495667_0616853
908 Ga0495656_0029346
909 Ga0495635_0137043
910 Ga0495658_0678792
911 Ga0495613_0455961
912 Ga0495600_0128184
913 Ga0496100_0147458
914 Ga0496101_0062320
915 Ga0496101_0378714
916 Ga0496101_0721347
917 Ga0496104_0026090
918 Ga0496105_0079828
919 Ga0496106_0285219
920 Ga0496107_1028907
921 Ga0496108_0013453
922 Ga0496108_0261154
923 Ga0496108_0261483
924 Ga0496109_0000817
925 Ga0496109_1116857
926 Ga0496109_1282814
927 Ga0496110_0286853
928 Ga0496110_0383011
929 Ga0496110_0693504
930 Ga0496111_0465769
931 Ga0496112_0001125
932 Ga0496112_0252313
933 Ga0496113_0001636
934 Ga0496114_0146299
935 Ga0501291_001270
936 Ga0501291_013225
937 Ga0501293_008654
938 Ga0501295_155545
939 Ga0501299_007327
940 Ga0501299_015457
941 Ga0501034_0530380
942 Ga0501040_1218461
943 Ga0501041_0576635
944 Ga0501047_0107019
945 Ga0501048_1348994
946 Ga0501071_0985757
947 Ga0501202_229013
948 Ga0501207_018351
949 Ga0501208_017267
950 Ga0501216_022913
951 Ga0501217_014698
952 Ga0501217_117507
953 Ga0501243_007631
954 Ga0501249_032651
955 Ga0501251_107798
956 Ga0501221_040904
957 Ga0501265_003731
958 Ga0501268_123891
959 Ga0501272_012553
960 Ga0501283_009999
961 nmdc:mga0k408_139127_c1
962 nmdc:mga06z11_277618_c1
963 nmdc:mga05p37_143582_c1
964 nmdc:mga05p37_545_c1
965 nmdc:mga09592_19149_c1
966 nmdc:mga09592_6947_c1
967 nmdc:mga09592_910578_c1
968 nmdc:mga0qj67_13202_c1
969 nmdc:mga0qj67_331762_c1
970 nmdc:mga0qj67_78364_c1
971 nmdc:mga06r32_28238_c1
972 nmdc:mga06r32_7924_c1
973 nmdc:mga08y16_1203371_c1
974 nmdc:mga08y16_1367314_c1
975 nmdc:mga08y16_151302_c1
976 nmdc:mga08y16_391798_c1
977 nmdc:mga08y16_89691_c1
978 nmdc:mga0a205_64656_c1
979 Ga0495601_0020441
980 Ga0495619_0004885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20540

DUF6755

Family of unknown function (DUF6755)

5

79

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qnl-assembly1.cif.gz_AAA lov2-darpin fusion - d4_deltalov 0.9763 20 67
1ji4-assembly1.cif.gz_A nap protein from helicobacter pylori 0.9672 23 71
5d8x-assembly1.cif.gz_M 1.50a resolution structure of bfrb (l68a e81a) from pseudomonas aeruginosa 0.9631 24 77
5d8r-assembly1.cif.gz_D-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.963 24 77
3iq1-assembly1.cif.gz_B crystal structure of dps protein from vibrio cholerae o1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins 0.9613 18 71
ID Description Score Start End Superfamily
af_Q23194_451_1026_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9751 18 69 1.25.40.10
af_Q4DXQ3_183_259_1.10.3660.10 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9575 17 67 1.10.3660.10
1n1qA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9571 24 71 1.20.1260.10
af_Q9BPX3_363_558_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9567 15 72 1.25.10.10
4evcA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.955 23 71 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3R9QK27-F1-model_v4 Uncharacterized protein 0.9929 13 69
AF-A0A7W7H129-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9809 13 79 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A7C6Y1D3-F1-model_v4 CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein 0.9643 9 70 GO:0004713
GO:0005886
AF-A0A397V469-F1-model_v4 Uncharacterized protein 0.9612 21 82
AF-A0A0E3DB48-F1-model_v4 Cytochrome c oxidase subunit 3 0.9598 20 74 GO:0004129
GO:0005739
GO:0016020
GO:0019646

Map