F453894

General Info

Members Datasets Scaffolds Average Seq Length
490 237 980 263

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10013418|JGI25407J50210_100134182
Length 298
Sequence MTAAFRRAAAVAGRSDVKEAWFVKTIWKGAISFGLVTIPVRVYGATEEKSLRFHQLHAPDGGRVRYKRVCSVDGEEVDYADIVKGYEYEKDRYVILTDEELASLPVSSTKAIEIERFVEADEIDPIYFQKSYYLVPDGTGVKAYHLLREAMADDGKVALAKVAFRDKEHLAVLRLRDNVFVLETMYWPDEIRTPAFEVLDESVELRPQEIRMARSLIDSLTDAFKPDEFHDEYRAALEELVAKKVQGEEITYAEEAEPSKVVDLMEALRASVEAAKADRPSGAERKAGTRRRKKASGE

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
145 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
151 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.24
Rhizosphere 96.94
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10013418 3300003373 Bacteria 2106
2 JGI24751J29686_10000503 3300002459 Bacteria 11387
3 JGI25406J46586_10009975 3300003203 Bacteria 4236
4 JGI25407J50210_10024956 3300003373 Bacteria 1550
5 Ga0070683_100166106 3300005329 Bacteria 2094
6 Ga0070690_100038483 3300005330 Bacteria 3019
7 Ga0070670_100035647 3300005331 Bacteria 4282
8 Ga0068869_100298115 3300005334 Bacteria 1301
9 Ga0070680_100066211 3300005336 Bacteria 2962
10 Ga0070682_100207607 3300005337 Bacteria 1386
11 Ga0070689_100127958 3300005340 Unclassified 2034
12 Ga0070661_100003758 3300005344 Bacteria 10464
13 Ga0070675_100173131 3300005354 Bacteria 1862
14 Ga0070674_100027356 3300005356 Bacteria 3737
15 Ga0070688_100010551 3300005365 Bacteria 5100
16 Ga0070703_10000005 3300005406 Bacteria 127348
17 Ga0070703_10003230 3300005406 Bacteria 4650
18 Ga0070713_100006822 3300005436 Bacteria 7956
19 Ga0070710_10193704 3300005437 Bacteria 1280
20 Ga0070705_100199025 3300005440 Bacteria 1372
21 Ga0070705_100245702 3300005440 Bacteria 1253
22 Ga0070705_100309130 3300005440 Bacteria 1136
23 Ga0070700_100047753 3300005441 Bacteria 2650
24 Ga0070700_100227574 3300005441 Bacteria 1325
25 Ga0070700_100339058 3300005441 Bacteria 1110
26 Ga0070708_100000685 3300005445 Bacteria 25748
27 Ga0070708_100005080 3300005445 Bacteria 10413
28 Ga0070708_100015002 3300005445 Bacteria 6390
29 Ga0070708_100038534 3300005445 Bacteria 4176
30 Ga0070708_100056884 3300005445 Bacteria 3480
31 Ga0070708_100057068 3300005445 Bacteria 3475
32 Ga0070708_100099626 3300005445 Bacteria 2659
33 Ga0070708_100454785 3300005445 Bacteria 1208
34 Ga0070663_100222609 3300005455 Bacteria 1482
35 Ga0070662_100006179 3300005457 Bacteria 7706
36 Ga0070685_10223839 3300005466 Bacteria 1234
37 Ga0070706_100000536 3300005467 Bacteria 44180
38 Ga0070707_100002755 3300005468 Bacteria 16736
39 Ga0070707_100078669 3300005468 Bacteria 3182
40 Ga0070707_100083666 3300005468 Bacteria 3083
41 Ga0070707_100142064 3300005468 Bacteria 2336
42 Ga0070698_100002508 3300005471 Bacteria 20244
43 Ga0070698_100004412 3300005471 Bacteria 15460
44 Ga0070698_100156284 3300005471 Bacteria 2226
45 Ga0070699_100034674 3300005518 Bacteria 4361
46 Ga0070699_100073443 3300005518 Bacteria 2976
47 Ga0070699_100102641 3300005518 Bacteria 2507
48 Ga0070699_100149498 3300005518 Bacteria 2065
49 Ga0070699_100525473 3300005518 Bacteria 1076
50 Ga0070684_100004805 3300005535 Bacteria 10324
51 Ga0070697_100035659 3300005536 Bacteria 4014
52 Ga0070697_100091756 3300005536 Bacteria 2512
53 Ga0068853_100315682 3300005539 Bacteria 1448
54 Ga0070695_100385229 3300005545 Bacteria 1059
55 Ga0070696_100178044 3300005546 Bacteria 1576
56 Ga0070665_100191846 3300005548 Bacteria 2044
57 Ga0070704_100000938 3300005549 Bacteria 14720
58 Ga0070704_100050679 3300005549 Bacteria 2919
59 Ga0068855_100000061 3300005563 Bacteria 133834
60 Ga0068855_100112038 3300005563 Bacteria 3131
61 Ga0070664_100075751 3300005564 Bacteria 2890
62 Ga0068857_100624789 3300005577 Bacteria 1019
63 Ga0068854_100001683 3300005578 Bacteria 13462
64 Ga0068856_100181155 3300005614 Bacteria 2120
65 Ga0068852_100572698 3300005616 Bacteria 1131
66 Ga0068859_100391029 3300005617 Bacteria 1486
67 Ga0068864_100250446 3300005618 Bacteria 1644
68 Ga0068866_10004062 3300005718 Bacteria 6007
69 Ga0068861_100000452 3300005719 Bacteria 23894
70 Ga0068870_10003977 3300005840 Bacteria 6313
71 Ga0068863_100024141 3300005841 Bacteria 5801
72 Ga0068863_100085894 3300005841 Bacteria 2981
73 Ga0068863_100583110 3300005841 Bacteria 1106
74 Ga0068860_100583083 3300005843 Bacteria 1123
75 Ga0068862_100043251 3300005844 Bacteria 3839
76 Ga0081455_10006818 3300005937 Bacteria 12178
77 Ga0081455_10011012 3300005937 Bacteria 9112
78 Ga0081455_10052895 3300005937 Bacteria 3473
79 Ga0081455_10157162 3300005937 Bacteria 1746
80 Ga0081538_10002714 3300005981 Bacteria 17014
81 Ga0081538_10011352 3300005981 Bacteria 7224
82 Ga0081538_10011977 3300005981 Bacteria 6989
83 Ga0081538_10085926 3300005981 Bacteria 1650
84 Ga0081538_10122100 3300005981 Bacteria 1249
85 Ga0081540_1050206 3300005983 Bacteria 2074
86 Ga0081539_10002167 3300005985 Bacteria 28857
87 Ga0081539_10071619 3300005985 Bacteria 1855
88 Ga0081539_10095076 3300005985 Bacteria 1531
89 Ga0075432_10002571 3300006058 Bacteria 6058
90 Ga0075432_10045068 3300006058 Bacteria 1547
91 Ga0075427_10019129 3300006194 Bacteria 1078
92 Ga0075428_100006988 3300006844 Bacteria 12517
93 Ga0075428_100051025 3300006844 Bacteria 4536
94 Ga0075428_100159376 3300006844 Bacteria 2450
95 Ga0075428_100190964 3300006844 Bacteria 2215
96 Ga0075430_100027015 3300006846 Bacteria 4881
97 Ga0075430_100202200 3300006846 Bacteria 1649
98 Ga0075430_100236029 3300006846 Bacteria 1516
99 Ga0075430_100310589 3300006846 Bacteria 1304
100 Ga0075431_100001542 3300006847 Bacteria 21352
101 Ga0075433_10045054 3300006852 Bacteria 3833
102 Ga0075434_100001692 3300006871 Bacteria 18868
103 Ga0075434_100042670 3300006871 Bacteria 4497
104 Ga0075429_100112479 3300006880 Bacteria 2380
105 Ga0075429_100182869 3300006880 Bacteria 1837
106 Ga0075429_100225200 3300006880 Bacteria 1642
107 Ga0075429_100530697 3300006880 Bacteria 1031
108 Ga0068865_100026833 3300006881 Bacteria 3800
109 Ga0068865_100323071 3300006881 Bacteria 1242
110 Ga0097620_100390983 3300006931 Bacteria 1486
111 Ga0075435_100070281 3300007076 Bacteria 2857
112 Ga0075435_100100052 3300007076 Bacteria 2402
113 Ga0105251_10029857 3300009011 Bacteria 2743
114 Ga0111539_10338079 3300009094 Bacteria 1753
115 Ga0105245_10097053 3300009098 Bacteria 2721
116 Ga0105245_10285981 3300009098 Bacteria 1613
117 Ga0114129_10012289 3300009147 Bacteria 12182
118 Ga0114129_10034303 3300009147 Bacteria 7166
119 Ga0114129_10040493 3300009147 Bacteria 6568
120 Ga0114129_10138988 3300009147 Bacteria 3331
121 Ga0114129_10172723 3300009147 Bacteria 2945
122 Ga0114129_10258820 3300009147 Bacteria 2334
123 Ga0114129_10397010 3300009147 Unclassified 1818
124 Ga0114129_10547695 3300009147 Bacteria 1505
125 Ga0105243_10002971 3300009148 Bacteria 14010
126 Ga0105243_10024304 3300009148 Bacteria 4621
127 Ga0105243_10057437 3300009148 Bacteria 3099
128 Ga0105241_10011296 3300009174 Bacteria 6546
129 Ga0105242_10009161 3300009176 Bacteria 7599
130 Ga0105238_10189961 3300009551 Bacteria 2030
131 Ga0105249_10002166 3300009553 Bacteria 17019
132 Ga0105249_10005880 3300009553 Bacteria 10618
133 Ga0105249_10012577 3300009553 Bacteria 7460
134 Ga0105249_10161769 3300009553 Bacteria 2164
135 Ga0105249_10700007 3300009553 Bacteria 1073
136 Ga0105239_10072753 3300010375 Bacteria 3779
137 Ga0105239_10423387 3300010375 Bacteria 1509
138 Ga0157378_10016329 3300013297 Bacteria 6502
139 Ga0157378_10234016 3300013297 Bacteria 1752
140 Ga0157378_10541574 3300013297 Bacteria 1168
141 Ga0163162_10187825 3300013306 Bacteria 2194
142 Ga0157375_10045448 3300013308 Bacteria 4274
143 Ga0157375_10172243 3300013308 Bacteria 2312
144 Ga0163163_10011137 3300014325 Bacteria 8141
145 Ga0157377_10036635 3300014745 Bacteria 2700
146 Ga0157377_10290340 3300014745 Bacteria 1075
147 Ga0213875_10116006 3300021388 Unclassified 1251
148 Ga0207713_1036486 3300025735 Bacteria 2108
149 Ga0207653_10000002 3300025885 Bacteria 270513
150 Ga0207642_10054884 3300025899 Bacteria 1819
151 Ga0207647_10007131 3300025904 Bacteria 8104
152 Ga0207647_10050478 3300025904 Bacteria 2575
153 Ga0207643_10000097 3300025908 Bacteria 59365
154 Ga0207643_10160978 3300025908 Bacteria 1350
155 Ga0207684_10000123 3300025910 Bacteria 142518
156 Ga0207654_10035155 3300025911 Bacteria 2790
157 Ga0207707_10102592 3300025912 Bacteria 2500
158 Ga0207695_10008912 3300025913 Bacteria 12491
159 Ga0207671_10003482 3300025914 Bacteria 15657
160 Ga0207649_10032526 3300025920 Bacteria 3111
161 Ga0207646_10003812 3300025922 Bacteria 16764
162 Ga0207646_10170216 3300025922 Bacteria 1967
163 Ga0207646_10227545 3300025922 Bacteria 1685
164 Ga0207694_10016241 3300025924 Bacteria 5618
165 Ga0207650_10001239 3300025925 Bacteria 18564
166 Ga0207650_10016248 3300025925 Bacteria 5199
167 Ga0207659_10041847 3300025926 Bacteria 3210
168 Ga0207700_10044904 3300025928 Bacteria 3256
169 Ga0207706_10005506 3300025933 Bacteria 11807
170 Ga0207686_10009993 3300025934 Bacteria 5161
171 Ga0207670_10157567 3300025936 Bacteria 1691
172 Ga0207704_10045164 3300025938 Bacteria 2615
173 Ga0207689_10053354 3300025942 Bacteria 3331
174 Ga0207689_10370669 3300025942 Bacteria 1191
175 Ga0207661_10179987 3300025944 Bacteria 1846
176 Ga0207679_10067051 3300025945 Bacteria 2691
177 Ga0207667_10000105 3300025949 Bacteria 133856
178 Ga0207667_10080719 3300025949 Bacteria 3370
179 Ga0207712_10174358 3300025961 Bacteria 1684
180 Ga0207668_10012384 3300025972 Bacteria 5221
181 Ga0207640_10355440 3300025981 Bacteria 1178
182 Ga0207639_10110330 3300026041 Bacteria 2241
183 Ga0207678_10196260 3300026067 Bacteria 1725
184 Ga0207708_10003366 3300026075 Bacteria 11793
185 Ga0207708_10062855 3300026075 Bacteria 2836
186 Ga0207708_10095480 3300026075 Bacteria 2296
187 Ga0207708_10289060 3300026075 Unclassified 1330
188 Ga0207702_10154400 3300026078 Bacteria 2091
189 Ga0207641_10192419 3300026088 Bacteria 1875
190 Ga0207676_10023399 3300026095 Bacteria 4557
191 Ga0207674_10009296 3300026116 Bacteria 11258
192 Ga0207674_10158993 3300026116 Bacteria 2214
193 Ga0207675_100003931 3300026118 Bacteria 14427
194 Ga0207675_100017172 3300026118 Bacteria 6759
195 Ga0207675_100075354 3300026118 Bacteria 3158
196 Ga0207428_10000731 3300027907 Bacteria 37804
197 Ga0207428_10002112 3300027907 Bacteria 20029
198 Ga0207428_10003171 3300027907 Bacteria 16096
199 Ga0307408_100116603 3300031548 Bacteria 2061
200 Ga0316576_10000927 3300031727 Bacteria 14974
201 Ga0316576_10012907 3300031727 Bacteria 5529
202 Ga0307405_10015158 3300031731 Bacteria 4166
203 Ga0307405_10081694 3300031731 Bacteria 2113
204 Ga0316577_10009878 3300031733 Bacteria 5145
205 Ga0307413_10081086 3300031824 Bacteria 2079
206 Ga0307410_10033188 3300031852 Bacteria 3330
207 Ga0307406_10037224 3300031901 Bacteria 3003
208 Ga0307406_10272276 3300031901 Bacteria 1287
209 Ga0307407_10041459 3300031903 Bacteria 2574
210 Ga0307407_10082719 3300031903 Bacteria 1946
211 Ga0307416_100004468 3300032002 Bacteria 8437
212 Ga0307416_100004546 3300032002 Bacteria 8380
213 Ga0307416_100024630 3300032002 Bacteria 4397
214 Ga0307416_100051479 3300032002 Bacteria 3289
215 Ga0307416_100104481 3300032002 Bacteria 2476
216 Ga0307416_100131495 3300032002 Bacteria 2254
217 Ga0307416_100317657 3300032002 Bacteria 1558
218 Ga0307416_100569330 3300032002 Bacteria 1208
219 Ga0307414_10245725 3300032004 Bacteria 1484
220 Ga0307411_10107128 3300032005 Bacteria 1991
221 Ga0307411_10607741 3300032005 Bacteria 941
222 Ga0307415_100000122 3300032126 Bacteria 33458
223 Ga0307415_100016605 3300032126 Bacteria 4392
224 Ga0307415_100024881 3300032126 Bacteria 3748
225 Ga0307415_100025791 3300032126 Bacteria 3696
226 Ga0307415_100064207 3300032126 Bacteria 2554
227 Ga0307415_100068802 3300032126 Bacteria 2479
228 Ga0307415_100482422 3300032126 Bacteria 1079
229 Ga0316574_0131507 3300035398 Bacteria 1610
230 Ga0316574_0186703 3300035398 Unclassified 1333
231 Ga0316582_0023869 3300036647 Bacteria 3649
232 Ga0373925_0012483 3300037068 Bacteria 6154
233 Ga0395899_0089974 3300037312 Bacteria 2226
234 Ga0395899_0104159 3300037312 Bacteria 2045
235 Ga0395900_0014448 3300037418 Bacteria 8058
236 Ga0395900_0045634 3300037418 Bacteria 4514
237 Ga0395900_0155520 3300037418 Bacteria 2335
238 Ga0395900_0266735 3300037418 Bacteria 1708
239 Ga0395898_0007044 3300037466 Bacteria 11949
240 Ga0395898_0041642 3300037466 Bacteria 4536
241 Ga0395898_0061221 3300037466 Bacteria 3657
242 Ga0395898_0076178 3300037466 Bacteria 3239
243 Ga0395905_0016214 3300037471 Bacteria 7078
244 Ga0395905_0120403 3300037471 Bacteria 2467
245 Ga0395905_0144158 3300037471 Bacteria 2241
246 Ga0316581_0043032 3300037588 Bacteria 1378
247 Ga0436364_1034654 3300037853 Bacteria 2127
248 Ga0395901_0011623 3300038443 Bacteria 8917
249 Ga0395901_0065262 3300038443 Bacteria 3790
250 Ga0395901_0326004 3300038443 Bacteria 1588
251 Ga0395901_0370237 3300038443 Bacteria 1476
252 Ga0400485_15355 3300038735 Bacteria 3388
253 Ga0436365_0032153 3300039437 Bacteria 1449
254 Ga0439448_0000217 3300042005 Bacteria 12128
255 Ga0439448_0037997 3300042005 Bacteria 1549
256 Ga0439448_0046918 3300042005 Bacteria 1408
257 Ga0439450_000471 3300042008 Bacteria 5249
258 Ga0439450_011427 3300042008 Bacteria 1739
259 Ga0439456_002004 3300042013 Bacteria 4106
260 Ga0439463_000417 3300042016 Bacteria 11845
261 Ga0450888_002043 3300042126 Bacteria 1972
262 Ga0450905_003543 3300042142 Bacteria 2052
263 Ga0439435_0006052 3300042436 Bacteria 2700
264 Ga0439444_0006261 3300042437 Bacteria 1794
265 Ga0439464_0000883 3300042439 Bacteria 6679
266 Ga0439464_0004054 3300042439 Bacteria 3727
267 Ga0439460_0001987 3300042461 Bacteria 4890
268 Ga0439460_0068740 3300042461 Bacteria 1093
269 Ga0450893_0030988 3300042532 Bacteria 954
270 Ga0439440_0000054 3300042993 Bacteria 14196
271 Ga0439440_0004410 3300042993 Bacteria 2764
272 Ga0466969_0052620 3300044656 Bacteria 2000
273 Ga0453683_0119426 3300044673 Bacteria 1659
274 Ga0466961_0016656 3300044693 Bacteria 4726
275 Ga0466970_0004919 3300044765 Bacteria 6597
276 Ga0451576_0057414 3300045051 Bacteria 4068
277 Ga0466958_0050234 3300045836 Bacteria 2525
278 Ga0495603_0013248 3300046455 Bacteria 4986
279 Ga0495603_0026769 3300046455 Bacteria 3483
280 Ga0495603_0040417 3300046455 Bacteria 2792
281 Ga0495591_028442 3300046458 Bacteria 1710
282 Ga0495629_0001838 3300046459 Bacteria 16612
283 Ga0495651_0126735 3300046462 Bacteria 1869
284 Ga0495580_0130525 3300046472 Bacteria 1743
285 Ga0495582_0001304 3300046473 Bacteria 13997
286 Ga0495639_0005528 3300046475 Bacteria 5440
287 Ga0495639_0103525 3300046475 Unclassified 1346
288 Ga0495584_0045936 3300046491 Bacteria 2203
289 Ga0495584_0072261 3300046491 Bacteria 1734
290 Ga0495618_0332402 3300046514 Bacteria 939
291 Ga0495628_0079638 3300046516 Bacteria 2547
292 Ga0495631_0084118 3300046518 Bacteria 1371
293 Ga0495644_0005700 3300046523 Bacteria 4861
294 Ga0495644_0023473 3300046523 Bacteria 2347
295 Ga0495642_0094705 3300046528 Bacteria 1267
296 Ga0495642_0139552 3300046528 Bacteria 1046
297 Ga0495654_0069525 3300046530 Bacteria 1672
298 Ga0495609_0051114 3300046538 Bacteria 1841
299 Ga0495633_0082846 3300046558 Bacteria 1492
300 Ga0495656_0001641 3300046615 Bacteria 7320
301 Ga0495656_0088628 3300046615 Bacteria 1411
302 Ga0495611_0054620 3300046648 Bacteria 1806
303 Ga0495661_0055766 3300046665 Bacteria 2367
304 Ga0495588_0025033 3300046674 Bacteria 2971
305 Ga0495647_0027634 3300046681 Bacteria 2086
306 Ga0495658_0000768 3300046683 Bacteria 17344
307 Ga0495669_0043640 3300046684 Bacteria 1997
308 Ga0495613_0003428 3300046689 Bacteria 11851
309 Ga0495613_0056772 3300046689 Bacteria 2875
310 Ga0495670_0030145 3300046691 Bacteria 2694
311 Ga0495670_0088781 3300046691 Bacteria 1580
312 Ga0495670_0148066 3300046691 Bacteria 1230
313 Ga0495660_0138785 3300046810 Bacteria 1212
314 Ga0495636_0008802 3300047318 Bacteria 3978
315 Ga0495636_0016401 3300047318 Bacteria 2958
316 Ga0495636_0106626 3300047318 Unclassified 1230
317 Ga0495636_0131193 3300047318 Bacteria 1115
318 Ga0495674_0241685 3300047319 Bacteria 1488
319 Ga0495676_0051828 3300047321 Bacteria 3280
320 Ga0495676_0080048 3300047321 Bacteria 2482
321 Ga0495677_0029497 3300047445 Bacteria 1995
322 Ga0495685_046523 3300047447 Bacteria 1476
323 Ga0495684_0526581 3300047471 Bacteria 808
324 Ga0496100_0023459 3300048903 Bacteria 3749
325 Ga0496101_0059152 3300048904 Bacteria 2777
326 Ga0496106_0027067 3300048909 Bacteria 4269
327 Ga0496108_0041672 3300048911 Bacteria 3834
328 Ga0496108_0245161 3300048911 Bacteria 1559
329 Ga0496109_0019950 3300048912 Bacteria 5918
330 Ga0496109_0028854 3300048912 Bacteria 4967
331 Ga0496109_0582043 3300048912 Bacteria 1055
332 Ga0496110_0442225 3300048913 Bacteria 1185
333 Ga0496111_0090778 3300048914 Bacteria 2238
334 Ga0496113_0074577 3300048916 Bacteria 2587
335 Ga0501031_0003932 3300049568 Bacteria 9568
336 Ga0501031_0005578 3300049568 Bacteria 8199
337 Ga0501031_0006435 3300049568 Bacteria 7657
338 Ga0501031_0279484 3300049568 Bacteria 1083
339 Ga0501033_0106418 3300049570 Bacteria 2043
340 Ga0501036_0001077 3300049572 Bacteria 20685
341 Ga0501036_0005004 3300049572 Bacteria 10724
342 Ga0501036_0008134 3300049572 Bacteria 8596
343 Ga0501037_0005490 3300049573 Bacteria 9244
344 Ga0501037_0058977 3300049573 Bacteria 2800
345 Ga0501038_0003194 3300049574 Bacteria 15288
346 Ga0501038_0233927 3300049574 Bacteria 1461
347 Ga0501038_0688313 3300049574 Bacteria 767
348 Ga0501039_0003898 3300049575 Bacteria 11205
349 Ga0501039_0005954 3300049575 Bacteria 9241
350 Ga0501039_0027805 3300049575 Bacteria 4349
351 Ga0501039_0075551 3300049575 Bacteria 2619
352 Ga0501039_0386093 3300049575 Bacteria 1100
353 Ga0501040_0001478 3300049576 Bacteria 14915
354 Ga0501040_0001479 3300049576 Bacteria 14911
355 Ga0501040_0011307 3300049576 Bacteria 5840
356 Ga0501040_0016342 3300049576 Bacteria 4911
357 Ga0501040_0032951 3300049576 Bacteria 3508
358 Ga0501040_0049377 3300049576 Bacteria 2877
359 Ga0501040_0127145 3300049576 Bacteria 1790
360 Ga0501040_0195877 3300049576 Bacteria 1434
361 Ga0501040_0271787 3300049576 Bacteria 1210
362 Ga0501041_0000325 3300049577 Bacteria 23165
363 Ga0501041_0003270 3300049577 Bacteria 9316
364 Ga0501041_0016667 3300049577 Bacteria 4372
365 Ga0501041_0035906 3300049577 Bacteria 3003
366 Ga0501041_0053861 3300049577 Bacteria 2454
367 Ga0501041_0115596 3300049577 Bacteria 1666
368 Ga0501041_0189429 3300049577 Bacteria 1288
369 Ga0501042_0000595 3300049578 Bacteria 19236
370 Ga0501042_0002434 3300049578 Bacteria 11417
371 Ga0501042_0006450 3300049578 Bacteria 7616
372 Ga0501042_0027988 3300049578 Bacteria 3967
373 Ga0501042_0029682 3300049578 Bacteria 3857
374 Ga0501043_0104201 3300049579 Bacteria 2229
375 Ga0501043_0137230 3300049579 Bacteria 1916
376 Ga0501046_0000797 3300049580 Bacteria 30550
377 Ga0501046_0007015 3300049580 Bacteria 9926
378 Ga0501046_0007707 3300049580 Bacteria 9439
379 Ga0501046_0036266 3300049580 Bacteria 3970
380 Ga0501048_0001732 3300049582 Bacteria 16612
381 Ga0501048_0024837 3300049582 Bacteria 4371
382 Ga0501048_0074761 3300049582 Bacteria 2391
383 Ga0501048_0133809 3300049582 Bacteria 1751
384 Ga0501067_0061500 3300049583 Bacteria 2079
385 Ga0501068_0106974 3300049584 Bacteria 1737
386 Ga0501070_0059032 3300049586 Bacteria 3180
387 Ga0501070_0180370 3300049586 Bacteria 1738
388 Ga0501071_0001480 3300049587 Bacteria 13656
389 Ga0501071_0003391 3300049587 Bacteria 9954
390 Ga0501071_0014628 3300049587 Bacteria 5370
391 Ga0501071_0058509 3300049587 Bacteria 2787
392 Ga0501071_0098355 3300049587 Bacteria 2155
393 Ga0501071_0105297 3300049587 Bacteria 2082
394 Ga0501071_0127154 3300049587 Bacteria 1892
395 Ga0501072_0000496 3300049588 Bacteria 28299
396 Ga0501072_0006860 3300049588 Bacteria 8642
397 Ga0501072_0012930 3300049588 Bacteria 6385
398 Ga0501072_0017900 3300049588 Bacteria 5448
399 Ga0501072_0057164 3300049588 Bacteria 3074
400 Ga0501072_0224756 3300049588 Bacteria 1496
401 Ga0501072_0261765 3300049588 Bacteria 1377
402 Ga0501074_0000228 3300049590 Bacteria 31222
403 Ga0501074_0010030 3300049590 Bacteria 6875
404 Ga0501074_0191479 3300049590 Bacteria 1458
405 Ga0501074_0290565 3300049590 Bacteria 1162
406 Ga0501075_0002333 3300049591 Bacteria 12590
407 Ga0501075_0010707 3300049591 Bacteria 6455
408 Ga0501075_0019700 3300049591 Bacteria 4897
409 Ga0501075_0026559 3300049591 Bacteria 4264
410 Ga0501075_0082148 3300049591 Bacteria 2440
411 Ga0501075_0277319 3300049591 Bacteria 1277
412 Ga0501076_0000409 3300049592 Bacteria 26899
413 Ga0501076_0002848 3300049592 Bacteria 11970
414 Ga0501076_0011107 3300049592 Bacteria 6699
415 Ga0501076_0012017 3300049592 Bacteria 6469
416 Ga0501076_0026322 3300049592 Bacteria 4505
417 Ga0501076_0157504 3300049592 Bacteria 1849
418 Ga0501076_0337062 3300049592 Bacteria 1237
419 Ga0501077_0001264 3300049593 Bacteria 15259
420 Ga0501077_0004121 3300049593 Bacteria 8778
421 Ga0501077_0045724 3300049593 Bacteria 2781
422 Ga0501077_0085925 3300049593 Bacteria 1994
423 Ga0501079_0000072 3300049741 Bacteria 46737
424 Ga0501079_0000484 3300049741 Bacteria 26174
425 Ga0501079_0061802 3300049741 Bacteria 2889
426 Ga0501079_0084329 3300049741 Bacteria 2458
427 Ga0501079_0258108 3300049741 Bacteria 1362
428 Ga0501080_0006926 3300049742 Bacteria 10225
429 Ga0501080_0015806 3300049742 Bacteria 6962
430 Ga0501080_0195347 3300049742 Bacteria 1859
431 Ga0501081_0005295 3300049743 Bacteria 8317
432 Ga0501081_0007804 3300049743 Bacteria 6937
433 Ga0501081_0060629 3300049743 Bacteria 2622
434 Ga0501083_0030075 3300049744 Bacteria 3732
435 Ga0501035_0088990 3300049822 Bacteria 2720
436 Ga0501035_0220734 3300049822 Bacteria 1618
437 Ga0501045_0002227 3300049824 Bacteria 13169
438 Ga0501045_0068650 3300049824 Bacteria 2604
439 Ga0501045_0222379 3300049824 Bacteria 1406
440 nmdc:mga05p37_175249_c1 3300050507 Bacteria 2613
441 nmdc:mga05p37_20334_c1 3300050507 Bacteria 8032
442 nmdc:mga05p37_233966_c1 3300050507 Unclassified 1700
443 nmdc:mga05p37_318861_c1 3300050507 Bacteria 1840
444 nmdc:mga05p37_4037_c1 3300050507 Bacteria 17152
445 nmdc:mga05p37_59830_c1 3300050507 Bacteria 4691
446 nmdc:mga05p37_61880_c1 3300050507 Bacteria 2389
447 nmdc:mga05p37_66426_c1 3300050507 Bacteria 4436
448 nmdc:mga05p37_76229_c1 3300050507 Bacteria 4129
449 nmdc:mga09592_112726_c1 3300050508 Bacteria 2333
450 nmdc:mga09592_178891_c1 3300050508 Bacteria 1835
451 nmdc:mga09592_19832_c1 3300050508 Bacteria 5524
452 nmdc:mga09592_348104_c1 3300050508 Bacteria 1283
453 nmdc:mga0qj67_305280_c1 3300050509 Bacteria 1289
454 nmdc:mga0qj67_402148_c1 3300050509 Bacteria 1105
455 nmdc:mga0qj67_5085_c1 3300050509 Bacteria 9572
456 nmdc:mga06r32_29512_c1 3300050510 Bacteria 5142
457 nmdc:mga06r32_373801_c1 3300050510 Bacteria 1408
458 nmdc:mga06r32_4216_c1 3300050510 Bacteria 12880
459 nmdc:mga06r32_5542_c1 3300050510 Bacteria 11375
460 nmdc:mga08y16_203994_c1 3300050511 Bacteria 2049
461 nmdc:mga08y16_2952_c1 3300050511 Bacteria 17522
462 nmdc:mga08y16_3113_c1 3300050511 Bacteria 17184
463 nmdc:mga08y16_36545_c1 3300050511 Bacteria 5159
464 nmdc:mga0n895_149208_c1 3300050512 Bacteria 2368
465 nmdc:mga0n895_22847_c1 3300050512 Bacteria 5867
466 nmdc:mga0rr50_18388_c2 3300050513 Bacteria 2825
467 nmdc:mga0a205_37452_c1 3300050515 Bacteria 4664
468 nmdc:mga0a205_63391_c1 3300050515 Bacteria 3571
469 Ga0495601_0000088 3300053077 Bacteria 49285
470 Ga0495601_0015238 3300053077 Bacteria 4644
471 Ga0501084_0000305 3300054114 Bacteria 37251
472 Ga0501084_0000589 3300054114 Bacteria 27786
473 Ga0501084_0014825 3300054114 Bacteria 6463
474 Ga0501084_0026248 3300054114 Bacteria 4859
475 Ga0501084_0065180 3300054114 Bacteria 3047
476 Ga0501084_0083871 3300054114 Bacteria 2675
477 Ga0501084_0208560 3300054114 Bacteria 1649
478 Ga0501084_0349814 3300054114 Bacteria 1248
479 Ga0590077_002775 3300059426 Bacteria 3688
480 Ga0501082_0000727 3300060353 Bacteria 29005
481 Ga0501082_0008217 3300060353 Bacteria 9001
482 Ga0501082_0022013 3300060353 Bacteria 5496
483 Ga0501082_0032440 3300060353 Bacteria 4505
484 Ga0501082_0056762 3300060353 Bacteria 3373
485 Ga0501082_0159290 3300060353 Bacteria 1961
486 Ga0501082_0525058 3300060353 Bacteria 1035
487 Ga0530510_0001292 3300061734 Bacteria 16733
488 Ga0530510_0014974 3300061734 Bacteria 5476
489 Ga0530510_0023619 3300061734 Bacteria 4383
490 Ga0530510_0053647 3300061734 Bacteria 2913
491 JGI25407J50210_10013418
492 JGI24751J29686_10000503
493 JGI25406J46586_10009975
494 JGI25407J50210_10024956
495 Ga0070683_100166106
496 Ga0070690_100038483
497 Ga0070670_100035647
498 Ga0068869_100298115
499 Ga0070680_100066211
500 Ga0070682_100207607
501 Ga0070689_100127958
502 Ga0070661_100003758
503 Ga0070675_100173131
504 Ga0070674_100027356
505 Ga0070688_100010551
506 Ga0070703_10000005
507 Ga0070703_10003230
508 Ga0070713_100006822
509 Ga0070710_10193704
510 Ga0070705_100199025
511 Ga0070705_100245702
512 Ga0070705_100309130
513 Ga0070700_100047753
514 Ga0070700_100227574
515 Ga0070700_100339058
516 Ga0070708_100000685
517 Ga0070708_100005080
518 Ga0070708_100015002
519 Ga0070708_100038534
520 Ga0070708_100056884
521 Ga0070708_100057068
522 Ga0070708_100099626
523 Ga0070708_100454785
524 Ga0070663_100222609
525 Ga0070662_100006179
526 Ga0070685_10223839
527 Ga0070706_100000536
528 Ga0070707_100002755
529 Ga0070707_100078669
530 Ga0070707_100083666
531 Ga0070707_100142064
532 Ga0070698_100002508
533 Ga0070698_100004412
534 Ga0070698_100156284
535 Ga0070699_100034674
536 Ga0070699_100073443
537 Ga0070699_100102641
538 Ga0070699_100149498
539 Ga0070699_100525473
540 Ga0070684_100004805
541 Ga0070697_100035659
542 Ga0070697_100091756
543 Ga0068853_100315682
544 Ga0070695_100385229
545 Ga0070696_100178044
546 Ga0070665_100191846
547 Ga0070704_100000938
548 Ga0070704_100050679
549 Ga0068855_100000061
550 Ga0068855_100112038
551 Ga0070664_100075751
552 Ga0068857_100624789
553 Ga0068854_100001683
554 Ga0068856_100181155
555 Ga0068852_100572698
556 Ga0068859_100391029
557 Ga0068864_100250446
558 Ga0068866_10004062
559 Ga0068861_100000452
560 Ga0068870_10003977
561 Ga0068863_100024141
562 Ga0068863_100085894
563 Ga0068863_100583110
564 Ga0068860_100583083
565 Ga0068862_100043251
566 Ga0081455_10006818
567 Ga0081455_10011012
568 Ga0081455_10052895
569 Ga0081455_10157162
570 Ga0081538_10002714
571 Ga0081538_10011352
572 Ga0081538_10011977
573 Ga0081538_10085926
574 Ga0081538_10122100
575 Ga0081540_1050206
576 Ga0081539_10002167
577 Ga0081539_10071619
578 Ga0081539_10095076
579 Ga0075432_10002571
580 Ga0075432_10045068
581 Ga0075427_10019129
582 Ga0075428_100006988
583 Ga0075428_100051025
584 Ga0075428_100159376
585 Ga0075428_100190964
586 Ga0075430_100027015
587 Ga0075430_100202200
588 Ga0075430_100236029
589 Ga0075430_100310589
590 Ga0075431_100001542
591 Ga0075433_10045054
592 Ga0075434_100001692
593 Ga0075434_100042670
594 Ga0075429_100112479
595 Ga0075429_100182869
596 Ga0075429_100225200
597 Ga0075429_100530697
598 Ga0068865_100026833
599 Ga0068865_100323071
600 Ga0097620_100390983
601 Ga0075435_100070281
602 Ga0075435_100100052
603 Ga0105251_10029857
604 Ga0111539_10338079
605 Ga0105245_10097053
606 Ga0105245_10285981
607 Ga0114129_10012289
608 Ga0114129_10034303
609 Ga0114129_10040493
610 Ga0114129_10138988
611 Ga0114129_10172723
612 Ga0114129_10258820
613 Ga0114129_10397010
614 Ga0114129_10547695
615 Ga0105243_10002971
616 Ga0105243_10024304
617 Ga0105243_10057437
618 Ga0105241_10011296
619 Ga0105242_10009161
620 Ga0105238_10189961
621 Ga0105249_10002166
622 Ga0105249_10005880
623 Ga0105249_10012577
624 Ga0105249_10161769
625 Ga0105249_10700007
626 Ga0105239_10072753
627 Ga0105239_10423387
628 Ga0157378_10016329
629 Ga0157378_10234016
630 Ga0157378_10541574
631 Ga0163162_10187825
632 Ga0157375_10045448
633 Ga0157375_10172243
634 Ga0163163_10011137
635 Ga0157377_10036635
636 Ga0157377_10290340
637 Ga0213875_10116006
638 Ga0207713_1036486
639 Ga0207653_10000002
640 Ga0207642_10054884
641 Ga0207647_10007131
642 Ga0207647_10050478
643 Ga0207643_10000097
644 Ga0207643_10160978
645 Ga0207684_10000123
646 Ga0207654_10035155
647 Ga0207707_10102592
648 Ga0207695_10008912
649 Ga0207671_10003482
650 Ga0207649_10032526
651 Ga0207646_10003812
652 Ga0207646_10170216
653 Ga0207646_10227545
654 Ga0207694_10016241
655 Ga0207650_10001239
656 Ga0207650_10016248
657 Ga0207659_10041847
658 Ga0207700_10044904
659 Ga0207706_10005506
660 Ga0207686_10009993
661 Ga0207670_10157567
662 Ga0207704_10045164
663 Ga0207689_10053354
664 Ga0207689_10370669
665 Ga0207661_10179987
666 Ga0207679_10067051
667 Ga0207667_10000105
668 Ga0207667_10080719
669 Ga0207712_10174358
670 Ga0207668_10012384
671 Ga0207640_10355440
672 Ga0207639_10110330
673 Ga0207678_10196260
674 Ga0207708_10003366
675 Ga0207708_10062855
676 Ga0207708_10095480
677 Ga0207708_10289060
678 Ga0207702_10154400
679 Ga0207641_10192419
680 Ga0207676_10023399
681 Ga0207674_10009296
682 Ga0207674_10158993
683 Ga0207675_100003931
684 Ga0207675_100017172
685 Ga0207675_100075354
686 Ga0207428_10000731
687 Ga0207428_10002112
688 Ga0207428_10003171
689 Ga0307408_100116603
690 Ga0316576_10000927
691 Ga0316576_10012907
692 Ga0307405_10015158
693 Ga0307405_10081694
694 Ga0316577_10009878
695 Ga0307413_10081086
696 Ga0307410_10033188
697 Ga0307406_10037224
698 Ga0307406_10272276
699 Ga0307407_10041459
700 Ga0307407_10082719
701 Ga0307416_100004468
702 Ga0307416_100004546
703 Ga0307416_100024630
704 Ga0307416_100051479
705 Ga0307416_100104481
706 Ga0307416_100131495
707 Ga0307416_100317657
708 Ga0307416_100569330
709 Ga0307414_10245725
710 Ga0307411_10107128
711 Ga0307411_10607741
712 Ga0307415_100000122
713 Ga0307415_100016605
714 Ga0307415_100024881
715 Ga0307415_100025791
716 Ga0307415_100064207
717 Ga0307415_100068802
718 Ga0307415_100482422
719 Ga0316574_0131507
720 Ga0316574_0186703
721 Ga0316582_0023869
722 Ga0373925_0012483
723 Ga0395899_0089974
724 Ga0395899_0104159
725 Ga0395900_0014448
726 Ga0395900_0045634
727 Ga0395900_0155520
728 Ga0395900_0266735
729 Ga0395898_0007044
730 Ga0395898_0041642
731 Ga0395898_0061221
732 Ga0395898_0076178
733 Ga0395905_0016214
734 Ga0395905_0120403
735 Ga0395905_0144158
736 Ga0316581_0043032
737 Ga0436364_1034654
738 Ga0395901_0011623
739 Ga0395901_0065262
740 Ga0395901_0326004
741 Ga0395901_0370237
742 Ga0400485_15355
743 Ga0436365_0032153
744 Ga0439448_0000217
745 Ga0439448_0037997
746 Ga0439448_0046918
747 Ga0439450_000471
748 Ga0439450_011427
749 Ga0439456_002004
750 Ga0439463_000417
751 Ga0450888_002043
752 Ga0450905_003543
753 Ga0439435_0006052
754 Ga0439444_0006261
755 Ga0439464_0000883
756 Ga0439464_0004054
757 Ga0439460_0001987
758 Ga0439460_0068740
759 Ga0450893_0030988
760 Ga0439440_0000054
761 Ga0439440_0004410
762 Ga0466969_0052620
763 Ga0453683_0119426
764 Ga0466961_0016656
765 Ga0466970_0004919
766 Ga0451576_0057414
767 Ga0466958_0050234
768 Ga0495603_0013248
769 Ga0495603_0026769
770 Ga0495603_0040417
771 Ga0495591_028442
772 Ga0495629_0001838
773 Ga0495651_0126735
774 Ga0495580_0130525
775 Ga0495582_0001304
776 Ga0495639_0005528
777 Ga0495639_0103525
778 Ga0495584_0045936
779 Ga0495584_0072261
780 Ga0495618_0332402
781 Ga0495628_0079638
782 Ga0495631_0084118
783 Ga0495644_0005700
784 Ga0495644_0023473
785 Ga0495642_0094705
786 Ga0495642_0139552
787 Ga0495654_0069525
788 Ga0495609_0051114
789 Ga0495633_0082846
790 Ga0495656_0001641
791 Ga0495656_0088628
792 Ga0495611_0054620
793 Ga0495661_0055766
794 Ga0495588_0025033
795 Ga0495647_0027634
796 Ga0495658_0000768
797 Ga0495669_0043640
798 Ga0495613_0003428
799 Ga0495613_0056772
800 Ga0495670_0030145
801 Ga0495670_0088781
802 Ga0495670_0148066
803 Ga0495660_0138785
804 Ga0495636_0008802
805 Ga0495636_0016401
806 Ga0495636_0106626
807 Ga0495636_0131193
808 Ga0495674_0241685
809 Ga0495676_0051828
810 Ga0495676_0080048
811 Ga0495677_0029497
812 Ga0495685_046523
813 Ga0495684_0526581
814 Ga0496100_0023459
815 Ga0496101_0059152
816 Ga0496106_0027067
817 Ga0496108_0041672
818 Ga0496108_0245161
819 Ga0496109_0019950
820 Ga0496109_0028854
821 Ga0496109_0582043
822 Ga0496110_0442225
823 Ga0496111_0090778
824 Ga0496113_0074577
825 Ga0501031_0003932
826 Ga0501031_0005578
827 Ga0501031_0006435
828 Ga0501031_0279484
829 Ga0501033_0106418
830 Ga0501036_0001077
831 Ga0501036_0005004
832 Ga0501036_0008134
833 Ga0501037_0005490
834 Ga0501037_0058977
835 Ga0501038_0003194
836 Ga0501038_0233927
837 Ga0501038_0688313
838 Ga0501039_0003898
839 Ga0501039_0005954
840 Ga0501039_0027805
841 Ga0501039_0075551
842 Ga0501039_0386093
843 Ga0501040_0001478
844 Ga0501040_0001479
845 Ga0501040_0011307
846 Ga0501040_0016342
847 Ga0501040_0032951
848 Ga0501040_0049377
849 Ga0501040_0127145
850 Ga0501040_0195877
851 Ga0501040_0271787
852 Ga0501041_0000325
853 Ga0501041_0003270
854 Ga0501041_0016667
855 Ga0501041_0035906
856 Ga0501041_0053861
857 Ga0501041_0115596
858 Ga0501041_0189429
859 Ga0501042_0000595
860 Ga0501042_0002434
861 Ga0501042_0006450
862 Ga0501042_0027988
863 Ga0501042_0029682
864 Ga0501043_0104201
865 Ga0501043_0137230
866 Ga0501046_0000797
867 Ga0501046_0007015
868 Ga0501046_0007707
869 Ga0501046_0036266
870 Ga0501048_0001732
871 Ga0501048_0024837
872 Ga0501048_0074761
873 Ga0501048_0133809
874 Ga0501067_0061500
875 Ga0501068_0106974
876 Ga0501070_0059032
877 Ga0501070_0180370
878 Ga0501071_0001480
879 Ga0501071_0003391
880 Ga0501071_0014628
881 Ga0501071_0058509
882 Ga0501071_0098355
883 Ga0501071_0105297
884 Ga0501071_0127154
885 Ga0501072_0000496
886 Ga0501072_0006860
887 Ga0501072_0012930
888 Ga0501072_0017900
889 Ga0501072_0057164
890 Ga0501072_0224756
891 Ga0501072_0261765
892 Ga0501074_0000228
893 Ga0501074_0010030
894 Ga0501074_0191479
895 Ga0501074_0290565
896 Ga0501075_0002333
897 Ga0501075_0010707
898 Ga0501075_0019700
899 Ga0501075_0026559
900 Ga0501075_0082148
901 Ga0501075_0277319
902 Ga0501076_0000409
903 Ga0501076_0002848
904 Ga0501076_0011107
905 Ga0501076_0012017
906 Ga0501076_0026322
907 Ga0501076_0157504
908 Ga0501076_0337062
909 Ga0501077_0001264
910 Ga0501077_0004121
911 Ga0501077_0045724
912 Ga0501077_0085925
913 Ga0501079_0000072
914 Ga0501079_0000484
915 Ga0501079_0061802
916 Ga0501079_0084329
917 Ga0501079_0258108
918 Ga0501080_0006926
919 Ga0501080_0015806
920 Ga0501080_0195347
921 Ga0501081_0005295
922 Ga0501081_0007804
923 Ga0501081_0060629
924 Ga0501083_0030075
925 Ga0501035_0088990
926 Ga0501035_0220734
927 Ga0501045_0002227
928 Ga0501045_0068650
929 Ga0501045_0222379
930 nmdc:mga05p37_175249_c1
931 nmdc:mga05p37_20334_c1
932 nmdc:mga05p37_233966_c1
933 nmdc:mga05p37_318861_c1
934 nmdc:mga05p37_4037_c1
935 nmdc:mga05p37_59830_c1
936 nmdc:mga05p37_61880_c1
937 nmdc:mga05p37_66426_c1
938 nmdc:mga05p37_76229_c1
939 nmdc:mga09592_112726_c1
940 nmdc:mga09592_178891_c1
941 nmdc:mga09592_19832_c1
942 nmdc:mga09592_348104_c1
943 nmdc:mga0qj67_305280_c1
944 nmdc:mga0qj67_402148_c1
945 nmdc:mga0qj67_5085_c1
946 nmdc:mga06r32_29512_c1
947 nmdc:mga06r32_373801_c1
948 nmdc:mga06r32_4216_c1
949 nmdc:mga06r32_5542_c1
950 nmdc:mga08y16_203994_c1
951 nmdc:mga08y16_2952_c1
952 nmdc:mga08y16_3113_c1
953 nmdc:mga08y16_36545_c1
954 nmdc:mga0n895_149208_c1
955 nmdc:mga0n895_22847_c1
956 nmdc:mga0rr50_18388_c2
957 nmdc:mga0a205_37452_c1
958 nmdc:mga0a205_63391_c1
959 Ga0495601_0000088
960 Ga0495601_0015238
961 Ga0501084_0000305
962 Ga0501084_0000589
963 Ga0501084_0014825
964 Ga0501084_0026248
965 Ga0501084_0065180
966 Ga0501084_0083871
967 Ga0501084_0208560
968 Ga0501084_0349814
969 Ga0590077_002775
970 Ga0501082_0000727
971 Ga0501082_0008217
972 Ga0501082_0022013
973 Ga0501082_0032440
974 Ga0501082_0056762
975 Ga0501082_0159290
976 Ga0501082_0525058
977 Ga0530510_0001292
978 Ga0530510_0014974
979 Ga0530510_0023619
980 Ga0530510_0053647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

32

212

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q2v-assembly2.cif.gz_B crystal structure of spoc domain of human phd-finger protein 3 (phf3) 0.6821 92 165
5nbq-assembly3.cif.gz_I the structure of the tripartite complex between ospe, the c-terminal domains of factor h and c3dg 0.6557 136 165
8bor-assembly1.cif.gz_A photosensory module from drbphp without phy tongue 0.6469 137 164
8bor-assembly2.cif.gz_D photosensory module from drbphp without phy tongue 0.6374 137 164
5y58-assembly3.cif.gz_E crystal structure of ku70/80 and tlc1 0.6371 4 238
ID Description Score Start End Superfamily
af_Q8TC57_257_413_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.8491 88 176 2.40.290.10
af_D3ZVK0_237_416_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7935 92 182 2.40.290.10
af_P32807_339_451_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.772 74 167 2.40.290.10
af_A0A0R0FHN8_1156_1303_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.74 84 165 2.40.290.10
af_A0A1D6ETJ1_1_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7155 136 168 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1X9XVN8-F1-model_v4 Clade I nitrous oxide reductase 0.9235 88 166 GO:0003690
GO:0006303
AF-A0A536VMD1-F1-model_v4 Ku protein 0.9079 91 205 GO:0003690
GO:0006303
AF-A0A536VMD1-F1-model_v4 Ku protein 0.9006 91 205 GO:0003690
GO:0006303
AF-A0A1X9XVN8-F1-model_v4 Clade I nitrous oxide reductase 0.8716 88 166 GO:0003690
GO:0006303
AF-A0A536N1R9-F1-model_v4 Ku protein 0.8642 99 264 GO:0003690
GO:0006303

Map