F453850

General Info

Members Datasets Scaffolds Average Seq Length
489 311 979 176

Family's Representative Sequence

Representative Sequence 3300046794|Ga0495589_0072141|Ga0495589_0072141_265_873
Length 202
Sequence MLTTLKTSYTDTRAADLAWTLGREPLPALATLDLELDGSKLQLRLLGASHQVLLEEERGSCSETVACIPGSSTPLPLGVAKRVGDWEYEFAARVEVLSPGSFAGRAQELLALVSDHPHGLAGVFPGSPHAFTALLAQRHEGQVHWRTWHAYPQDGQLVATRTRVGVRVAAGVAGAWGGDPDTPSPTRSAIKRRGSTRVGDEA

Samples

Sample ID Description Type Environment
1 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
52 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
74 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
75 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
79 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
84 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
85 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
86 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
89 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
90 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
217 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
225 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
226 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
227 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
228 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
229 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
230 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
231 2643221548 Streptomyces sp. Root55 Isolate Unclassified
232 2643221578 Streptomyces sp. Root63 Isolate Unclassified
233 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
234 2643221647 Streptomyces sp. Root369 Isolate Unclassified
235 2643221670 Streptomyces sp. Root431 Isolate Unclassified
236 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
237 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
238 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
239 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
240 2643221714 Streptomyces sp. Root264 Isolate Unclassified
241 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
242 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
243 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
244 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
245 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
246 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
247 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
248 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
249 2808606448 Streptomyces sp. 193411 Isolate Unclassified
250 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
251 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
252 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
253 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
254 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
255 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
256 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
257 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
258 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
259 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
260 2862574272 Streptomyces sp. AcE210 Isolate Nodule
261 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
262 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
263 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
264 2867369537 Streptomyces sp. Z26 Isolate Unclassified
265 2867428634 Streptomyces sp. RP5T Isolate Unclassified
266 2867475112 Streptomyces sp. TM32 Isolate Unclassified
267 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
268 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
269 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
270 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
271 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
272 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
273 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
274 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
275 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
276 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
277 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
278 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
279 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
280 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
281 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
282 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
283 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
284 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
285 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
286 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
287 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
288 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
289 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
290 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
291 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
292 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
293 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
294 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
295 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
296 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
297 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
298 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
299 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
300 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
301 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
302 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
303 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
304 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
305 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
306 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
307 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
308 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
309 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
310 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
311 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.37
Metatranscriptomes 1.23
Isolates 18.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0.61
Rhizoplane 0.82
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495589_0072141 3300046794 Bacteria 1687
2 JGI24739J22299_10054495 3300001989 Bacteria 1281
3 JGI24735J21928_10081721 3300002067 Bacteria 926
4 JGI24738J21930_10021111 3300002075 Bacteria 1351
5 rootH1_10009305 3300003316 Bacteria 3051
6 rootH1_10009317 3300003316 Bacteria 2451
7 rootH2_10036953 3300003320 Bacteria 2684
8 rootH2_10047266 3300003320 Bacteria 2582
9 rootL2_10018875 3300003322 Bacteria 2904
10 rootH1_10008176 3300003316 Unclassified 2863
11 rootH1_10008176 3300003323 Bacteria 1555
12 rootH1_10014976 3300003323 Bacteria 1623
13 Ga0006562J51391_1156980 3300003578 Bacteria 2720
14 Ga0006562J51391_1156981 3300003578 Bacteria 2583
15 Ga0006562J51391_1171327 3300003578 Bacteria 2659
16 Ga0006562J51391_1171328 3300003578 Bacteria 2460
17 Ga0006562J51391_1172042 3300003578 Bacteria 1153
18 Ga0006562J51391_1172043 3300003578 Bacteria 850
19 Ga0058692_1044180 3300003856 Bacteria 766
20 Ga0070670_100339498 3300005331 Bacteria 1318
21 Ga0068853_100556163 3300005539 Bacteria 1087
22 Ga0070672_100204528 3300005543 Bacteria 1652
23 Ga0070665_100157853 3300005548 Bacteria 2270
24 Ga0068856_100220509 3300005614 Bacteria 1912
25 Ga0068851_10396583 3300005834 Bacteria 811
26 Ga0075368_10153916 3300006042 Bacteria 961
27 Ga0075363_100039269 3300006048 Bacteria 2491
28 Ga0075363_100207335 3300006048 Bacteria 1121
29 Ga0075367_10093768 3300006178 Bacteria 1829
30 Ga0075370_10199176 3300006353 Bacteria 1181
31 Ga0075434_101112029 3300006871 Bacteria 803
32 Ga0105251_10017617 3300009011 Bacteria 3822
33 Ga0105250_10178311 3300009092 Bacteria 891
34 Ga0105245_10043577 3300009098 Bacteria 4002
35 Ga0105243_10298257 3300009148 Bacteria 1459
36 Ga0105243_10511133 3300009148 Bacteria 1140
37 Ga0105242_12022007 3300009176 Bacteria 619
38 Ga0105248_10097169 3300009177 Bacteria 3319
39 Ga0105239_10272653 3300010375 Bacteria 1903
40 Ga0105246_10003768 3300011119 Bacteria 9190
41 Ga0105246_10238708 3300011119 Bacteria 1436
42 Ga0105246_10904647 3300011119 Bacteria 792
43 Ga0105246_11180221 3300011119 Bacteria 703
44 Ga0157372_11225548 3300013307 Bacteria 867
45 Ga0157375_11409264 3300013308 Bacteria 821
46 Ga0182008_10007351 3300014497 Bacteria 6088
47 Ga0182006_1030994 3300015261 Bacteria 2157
48 Ga0182007_10007433 3300015262 Bacteria 4594
49 Ga0183367_1015 3300015688 Bacteria 298435
50 Ga0213875_10008623 3300021388 Bacteria 5208
51 Ga0209758_1018349 3300025297 Bacteria 3431
52 Ga0207426_1002789 3300025302 Bacteria 10493
53 Ga0207426_1011202 3300025302 Bacteria 3435
54 Ga0207426_1011303 3300025302 Bacteria 3408
55 Ga0207647_10019778 3300025904 Bacteria 4522
56 Ga0207687_10026195 3300025927 Bacteria 3903
57 Ga0207709_10023379 3300025935 Bacteria 3517
58 Ga0207709_10416437 3300025935 Bacteria 1031
59 Ga0207711_10205595 3300025941 Bacteria 1798
60 Ga0207640_11160124 3300025981 Bacteria 685
61 Ga0207639_10511705 3300026041 Bacteria 1098
62 Ga0207702_10251350 3300026078 Bacteria 1660
63 Ga0209371_1015650 3300027312 Bacteria 2029
64 Ga0209371_1034586 3300027312 Bacteria 1070
65 Ga0209813_10145198 3300027866 Bacteria 846
66 Ga0268266_10085584 3300028379 Bacteria 2755
67 Ga0307515_10029652 3300028794 Bacteria 9235
68 Ga0307515_10246295 3300028794 Bacteria 1548
69 Ga0268256_1006954 3300030500 Bacteria 4125
70 Ga0268256_1039090 3300030500 Bacteria 1074
71 Ga0307511_10001252 3300030521 Bacteria 26858
72 Ga0307511_10042772 3300030521 Bacteria 3799
73 Ga0307512_10014623 3300030522 Bacteria 7305
74 Ga0307513_10081469 3300031456 Bacteria 3335
75 Ga0307513_10105939 3300031456 Bacteria 2819
76 Ga0307513_10183278 3300031456 Bacteria 1954
77 Ga0307509_10012425 3300031507 Bacteria 10185
78 Ga0307509_10070100 3300031507 Bacteria 3662
79 Ga0307509_10072081 3300031507 Bacteria 3601
80 Ga0307508_10006351 3300031616 Bacteria 11121
81 Ga0307508_10011600 3300031616 Bacteria 8051
82 Ga0307514_10064813 3300031649 Bacteria 2769
83 Ga0307514_10174737 3300031649 Bacteria 1395
84 Ga0307516_10004706 3300031730 Bacteria 16687
85 Ga0307516_10015687 3300031730 Bacteria 7965
86 Ga0307518_10034439 3300031838 Bacteria 3675
87 Ga0307518_10230490 3300031838 Bacteria 1199
88 Ga0307416_100118173 3300032002 Bacteria 2355
89 Ga0307411_10486881 3300032005 Bacteria 1040
90 Ga0307507_10078311 3300033179 Bacteria 2931
91 Ga0307510_10009831 3300033180 Bacteria 11383
92 Ga0307510_10016364 3300033180 Bacteria 8752
93 Ga0307510_10034454 3300033180 Bacteria 5668
94 Ga0395900_0013264 3300037418 Bacteria 8424
95 Ga0395898_0006970 3300037466 Bacteria 12014
96 Ga0395898_0132008 3300037466 Bacteria 2392
97 Ga0395898_0237690 3300037466 Bacteria 1737
98 Ga0395905_0668473 3300037471 Bacteria 941
99 Ga0436364_1096745 3300037853 Bacteria 11722
100 Ga0395901_0083150 3300038443 Bacteria 3346
101 Ga0395901_0309969 3300038443 Bacteria 1635
102 Ga0439436_0000958 3300041404 Bacteria 7968
103 Ga0439436_0092438 3300041404 Bacteria 842
104 Ga0439439_0016955 3300041406 Bacteria 1787
105 Ga0439439_0062877 3300041406 Bacteria 987
106 Ga0451791_0838397 3300041451 Bacteria 755
107 Ga0451833_0729462 3300041491 Bacteria 1131
108 Ga0451837_0925161 3300041494 Bacteria 2931
109 Ga0451841_1010329 3300041498 Bacteria 896
110 Ga0451845_0601681 3300041501 Bacteria 871
111 Ga0451843_1514523 3300041509 Bacteria 676
112 Ga0451853_0350742 3300041512 Bacteria 2348
113 Ga0451853_1568221 3300041512 Bacteria 3678
114 Ga0439431_0139461 3300041997 Bacteria 684
115 Ga0439433_0043312 3300041999 Bacteria 1050
116 Ga0439442_046422 3300042002 Bacteria 915
117 Ga0439442_047803 3300042002 Bacteria 902
118 Ga0439432_010627 3300042006 Bacteria 3184
119 Ga0439449_0001039 3300042007 Bacteria 10932
120 Ga0439449_0010985 3300042007 Bacteria 3416
121 Ga0439449_0059229 3300042007 Bacteria 1414
122 Ga0439457_002883 3300042014 Bacteria 4792
123 Ga0450898_001555 3300042134 Bacteria 3053
124 Ga0450898_011096 3300042134 Bacteria 1470
125 Ga0450900_018543 3300042136 Bacteria 955
126 Ga0450902_026512 3300042137 Bacteria 969
127 Ga0450903_012750 3300042138 Bacteria 1339
128 Ga0450906_004262 3300042145 Bacteria 3003
129 Ga0439458_0042850 3300042157 Bacteria 1102
130 Ga0439458_0062612 3300042157 Bacteria 930
131 Ga0439458_0105695 3300042157 Bacteria 733
132 Ga0450908_003157 3300042184 Bacteria 3207
133 Ga0450901_007737 3300042533 Bacteria 1106
134 Ga0466969_0051791 3300044656 Bacteria 2019
135 Ga0466972_0001891 3300044658 Bacteria 10282
136 Ga0466972_0001950 3300044658 Bacteria 10125
137 Ga0466972_0014472 3300044658 Bacteria 3951
138 Ga0466972_0054814 3300044658 Bacteria 1918
139 Ga0466965_0001392 3300044683 Bacteria 9718
140 Ga0466965_0009475 3300044683 Bacteria 4523
141 Ga0466965_0450846 3300044683 Bacteria 716
142 Ga0466966_0003542 3300044684 Bacteria 10308
143 Ga0466966_0066477 3300044684 Bacteria 2265
144 Ga0466966_0244154 3300044684 Bacteria 1082
145 Ga0466961_0009577 3300044693 Bacteria 6167
146 Ga0466961_0023062 3300044693 Bacteria 4003
147 Ga0466961_0298450 3300044693 Bacteria 984
148 Ga0466963_0000365 3300044694 Bacteria 20535
149 Ga0466963_0016789 3300044694 Bacteria 4556
150 Ga0466964_0007152 3300044706 Bacteria 4174
151 Ga0466964_0220993 3300044706 Bacteria 920
152 Ga0466971_0001264 3300044719 Bacteria 10534
153 Ga0466971_0040710 3300044719 Bacteria 2087
154 Ga0466968_0033621 3300044735 Bacteria 2137
155 Ga0466968_0156092 3300044735 Bacteria 1051
156 Ga0466970_0008339 3300044765 Bacteria 5212
157 Ga0466970_0013981 3300044765 Bacteria 4118
158 Ga0466970_0057252 3300044765 Bacteria 2084
159 Ga0466957_0000443 3300044842 Bacteria 20418
160 Ga0466960_0038350 3300044901 Bacteria 2252
161 Ga0466960_0112383 3300044901 Bacteria 1417
162 Ga0466959_0001598 3300045049 Bacteria 13978
163 Ga0466959_0070142 3300045049 Bacteria 2539
164 Ga0466958_0002454 3300045836 Bacteria 9312
165 Ga0466958_0660889 3300045836 Bacteria 680
166 Ga0466967_0016603 3300045976 Bacteria 5814
167 Ga0466967_0030342 3300045976 Bacteria 4536
168 Ga0466967_0098794 3300045976 Bacteria 2665
169 Ga0495627_031540 3300046453 Bacteria 1673
170 Ga0495627_033272 3300046453 Bacteria 1617
171 Ga0495592_0102343 3300046454 Bacteria 2039
172 Ga0495603_0000619 3300046455 Bacteria 19882
173 Ga0495603_0007793 3300046455 Bacteria 6453
174 Ga0495603_0010613 3300046455 Bacteria 5582
175 Ga0495603_0013813 3300046455 Bacteria 4887
176 Ga0495603_0016358 3300046455 Bacteria 4487
177 Ga0495603_0018338 3300046455 Bacteria 4233
178 Ga0495603_0287671 3300046455 Bacteria 944
179 Ga0495590_0193987 3300046457 Bacteria 745
180 Ga0495629_0001332 3300046459 Bacteria 19415
181 Ga0495629_0007432 3300046459 Bacteria 8069
182 Ga0495629_0013386 3300046459 Bacteria 5918
183 Ga0495629_0013675 3300046459 Bacteria 5856
184 Ga0495629_0014203 3300046459 Bacteria 5734
185 Ga0495629_0015699 3300046459 Bacteria 5436
186 Ga0495638_0136142 3300046460 Bacteria 1438
187 Ga0495638_0460062 3300046460 Bacteria 648
188 Ga0495641_0033689 3300046461 Bacteria 2429
189 Ga0495651_0022685 3300046462 Bacteria 4878
190 Ga0495651_0059428 3300046462 Bacteria 2931
191 Ga0495653_0028880 3300046463 Bacteria 4434
192 Ga0495582_0190037 3300046473 Bacteria 1171
193 Ga0495582_0248692 3300046473 Bacteria 1019
194 Ga0495605_0001984 3300046474 Bacteria 12958
195 Ga0495639_0005996 3300046475 Bacteria 5226
196 Ga0495662_0006311 3300046476 Bacteria 5926
197 Ga0495662_0032029 3300046476 Bacteria 2539
198 Ga0495662_0081534 3300046476 Bacteria 1573
199 Ga0495664_0012005 3300046477 Bacteria 4896
200 Ga0495584_0424649 3300046491 Bacteria 676
201 Ga0495594_0002069 3300046499 Bacteria 10437
202 Ga0495594_0003029 3300046499 Bacteria 8709
203 Ga0495594_0254418 3300046499 Bacteria 1000
204 Ga0495594_0423440 3300046499 Bacteria 757
205 Ga0495594_0572273 3300046499 Bacteria 641
206 Ga0495596_0036248 3300046500 Bacteria 1954
207 Ga0495607_0148883 3300046501 Bacteria 1200
208 Ga0495607_0178444 3300046501 Bacteria 1066
209 Ga0495583_0011414 3300046506 Bacteria 5102
210 Ga0495583_0055714 3300046506 Bacteria 1786
211 Ga0495606_0022814 3300046507 Bacteria 4549
212 Ga0495606_0201650 3300046507 Bacteria 1133
213 Ga0495608_0229553 3300046511 Bacteria 1162
214 Ga0495610_0076089 3300046512 Bacteria 1553
215 Ga0495616_0055103 3300046513 Bacteria 1970
216 Ga0495618_0003520 3300046514 Bacteria 9728
217 Ga0495620_0009014 3300046515 Bacteria 5328
218 Ga0495620_0142280 3300046515 Bacteria 937
219 Ga0495628_0011436 3300046516 Bacteria 7506
220 Ga0495628_0576857 3300046516 Bacteria 805
221 Ga0495628_0596088 3300046516 Bacteria 789
222 Ga0495630_0002260 3300046517 Bacteria 13411
223 Ga0495630_0872841 3300046517 Bacteria 686
224 Ga0495631_0048473 3300046518 Bacteria 1862
225 Ga0495632_0121818 3300046519 Bacteria 1219
226 Ga0495637_0180238 3300046520 Bacteria 783
227 Ga0495643_0087553 3300046522 Bacteria 1611
228 Ga0495644_0052714 3300046523 Bacteria 1528
229 Ga0495648_0180248 3300046524 Bacteria 1074
230 Ga0495648_0294294 3300046524 Bacteria 763
231 Ga0495666_0034655 3300046526 Bacteria 2462
232 Ga0495652_0046235 3300046529 Bacteria 3738
233 Ga0495654_0057039 3300046530 Bacteria 1887
234 Ga0495665_0326999 3300046531 Bacteria 783
235 Ga0495640_0005496 3300046533 Bacteria 10076
236 Ga0495587_0010305 3300046536 Bacteria 5957
237 Ga0495587_0277132 3300046536 Bacteria 940
238 Ga0495609_0108141 3300046538 Bacteria 1201
239 Ga0495597_0060350 3300046542 Bacteria 1654
240 Ga0495645_0217977 3300046543 Bacteria 1285
241 Ga0495645_0218170 3300046543 Bacteria 1284
242 Ga0495622_0007872 3300046557 Bacteria 4946
243 Ga0495633_0045702 3300046558 Bacteria 2072
244 Ga0495633_0511767 3300046558 Bacteria 541
245 Ga0495667_0195576 3300046559 Bacteria 1295
246 Ga0495668_0003453 3300046616 Bacteria 11820
247 Ga0495668_0104626 3300046616 Bacteria 1548
248 Ga0495634_0002980 3300046642 Bacteria 13813
249 Ga0495611_0221956 3300046648 Bacteria 879
250 Ga0495611_0360545 3300046648 Bacteria 666
251 Ga0495625_0082852 3300046660 Bacteria 2230
252 Ga0495625_0177428 3300046660 Bacteria 1419
253 Ga0495625_0225891 3300046660 Bacteria 1224
254 Ga0495625_0391404 3300046660 Bacteria 870
255 Ga0495635_0005850 3300046663 Bacteria 8569
256 Ga0495635_0013686 3300046663 Bacteria 5676
257 Ga0495661_0012057 3300046665 Bacteria 5848
258 Ga0495588_0004355 3300046674 Bacteria 6252
259 Ga0495588_0006669 3300046674 Bacteria 5214
260 Ga0495588_0104261 3300046674 Bacteria 1492
261 Ga0495588_0158331 3300046674 Bacteria 1197
262 Ga0495588_0230672 3300046674 Bacteria 977
263 Ga0495588_0252112 3300046674 Bacteria 930
264 Ga0495657_0007334 3300046675 Bacteria 8527
265 Ga0495657_0094966 3300046675 Bacteria 1906
266 Ga0495657_0107481 3300046675 Bacteria 1770
267 Ga0495657_0120998 3300046675 Bacteria 1648
268 Ga0495599_0201151 3300046678 Bacteria 1224
269 Ga0495599_0633702 3300046678 Bacteria 620
270 Ga0495623_0090334 3300046679 Bacteria 1881
271 Ga0495646_0000454 3300046680 Bacteria 21689
272 Ga0495646_0022063 3300046680 Bacteria 4019
273 Ga0495658_0013128 3300046683 Bacteria 4214
274 Ga0495613_0002076 3300046689 Bacteria 15232
275 Ga0495613_0006399 3300046689 Bacteria 8800
276 Ga0495613_0165447 3300046689 Bacteria 1571
277 Ga0495670_0125995 3300046691 Bacteria 1333
278 Ga0495670_0437231 3300046691 Bacteria 708
279 Ga0495670_0485276 3300046691 Bacteria 671
280 Ga0495649_0004300 3300046694 Bacteria 9343
281 Ga0495589_0005319 3300046794 Bacteria 6798
282 Ga0495589_0007258 3300046794 Bacteria 5804
283 Ga0495589_0033691 3300046794 Bacteria 2571
284 Ga0495589_0259043 3300046794 Bacteria 811
285 Ga0495600_0030849 3300046809 Bacteria 3471
286 Ga0495600_0050777 3300046809 Bacteria 2706
287 Ga0495600_0230178 3300046809 Bacteria 1183
288 Ga0495581_0022078 3300047315 Bacteria 3688
289 Ga0495581_0029499 3300047315 Bacteria 3179
290 Ga0495604_0001366 3300047317 Bacteria 19975
291 Ga0495604_0383940 3300047317 Bacteria 927
292 Ga0495636_0035869 3300047318 Bacteria 2043
293 Ga0495636_0069470 3300047318 Bacteria 1501
294 Ga0495636_0245321 3300047318 Bacteria 827
295 Ga0495636_0350045 3300047318 Bacteria 697
296 Ga0495674_0016879 3300047319 Bacteria 6810
297 Ga0495674_0504500 3300047319 Bacteria 967
298 Ga0495676_0006749 3300047321 Bacteria 10555
299 Ga0495676_0045839 3300047321 Bacteria 3554
300 Ga0495676_0046468 3300047321 Bacteria 3522
301 Ga0495676_0047415 3300047321 Bacteria 3474
302 Ga0495680_0004348 3300047322 Bacteria 13571
303 Ga0495683_0117645 3300047323 Bacteria 1264
304 Ga0495683_0175261 3300047323 Bacteria 983
305 Ga0495687_001423 3300047443 Bacteria 22031
306 Ga0495687_009578 3300047443 Bacteria 5399
307 Ga0495687_015950 3300047443 Bacteria 3794
308 Ga0495675_0134707 3300047444 Bacteria 1534
309 Ga0495675_0139499 3300047444 Bacteria 1503
310 Ga0495677_0019346 3300047445 Bacteria 2470
311 Ga0495685_005511 3300047447 Bacteria 4133
312 Ga0495685_008350 3300047447 Bacteria 3437
313 Ga0495685_014531 3300047447 Bacteria 2676
314 Ga0495685_024385 3300047447 Bacteria 2081
315 Ga0495685_199278 3300047447 Bacteria 642
316 Ga0495681_0105762 3300047470 Bacteria 1224
317 Ga0495681_0112806 3300047470 Bacteria 1175
318 Ga0495684_0198855 3300047471 Bacteria 1478
319 Ga0495684_0390492 3300047471 Bacteria 979
320 Ga0495686_0047147 3300047472 Bacteria 2722
321 Ga0495593_0001872 3300047673 Bacteria 12531
322 Ga0495593_0040020 3300047673 Bacteria 2525
323 Ga0495593_0141094 3300047673 Bacteria 1220
324 Ga0495593_0275630 3300047673 Bacteria 841
325 Ga0495602_0025346 3300048088 Bacteria 5741
326 Ga0495602_0237849 3300048088 Bacteria 1364
327 Ga0495614_0001567 3300048089 Bacteria 9923
328 Ga0495614_0047684 3300048089 Bacteria 1837
329 Ga0495614_0152424 3300048089 Bacteria 1031
330 Ga0495626_0008054 3300048091 Bacteria 5815
331 Ga0496109_0091883 3300048912 Bacteria 2807
332 Ga0496110_0779439 3300048913 Bacteria 860
333 Ga0496113_0565704 3300048916 Bacteria 911
334 Ga0495678_043660 3300049459 Bacteria 1778
335 Ga0495682_0131560 3300049460 Bacteria 895
336 Ga0501031_0006551 3300049568 Bacteria 7593
337 Ga0501031_0069683 3300049568 Bacteria 2291
338 Ga0501032_0039950 3300049569 Bacteria 3190
339 Ga0501032_0270910 3300049569 Bacteria 1100
340 Ga0501033_0000908 3300049570 Bacteria 27052
341 Ga0501033_0111613 3300049570 Bacteria 1989
342 Ga0501033_0231690 3300049570 Bacteria 1312
343 Ga0501034_0013001 3300049571 Bacteria 8581
344 Ga0501034_0214444 3300049571 Bacteria 1879
345 Ga0501036_0015072 3300049572 Bacteria 6451
346 Ga0501036_0019987 3300049572 Bacteria 5622
347 Ga0501036_0599138 3300049572 Bacteria 914
348 Ga0501037_0069802 3300049573 Bacteria 2557
349 Ga0501037_0182875 3300049573 Bacteria 1487
350 Ga0501038_0001803 3300049574 Bacteria 19828
351 Ga0501038_0071146 3300049574 Bacteria 2951
352 Ga0501038_0106497 3300049574 Bacteria 2327
353 Ga0501039_0004631 3300049575 Bacteria 10398
354 Ga0501039_0701725 3300049575 Bacteria 791
355 Ga0501043_0001081 3300049579 Bacteria 23969
356 Ga0501043_0031255 3300049579 Bacteria 4186
357 Ga0501046_0016000 3300049580 Bacteria 6292
358 Ga0501046_0293811 3300049580 Bacteria 1188
359 Ga0501047_0027103 3300049581 Bacteria 5519
360 Ga0501047_0133568 3300049581 Bacteria 2362
361 Ga0501047_0135433 3300049581 Bacteria 2343
362 Ga0501047_0329772 3300049581 Bacteria 1365
363 Ga0501047_0592715 3300049581 Bacteria 930
364 Ga0501048_0006354 3300049582 Bacteria 8985
365 Ga0501048_0550543 3300049582 Bacteria 828
366 Ga0501068_0371425 3300049584 Bacteria 920
367 Ga0501070_0002314 3300049586 Bacteria 16716
368 Ga0501070_0072362 3300049586 Bacteria 2854
369 Ga0501070_0511607 3300049586 Bacteria 964
370 Ga0501070_0902391 3300049586 Bacteria 689
371 Ga0501073_0631719 3300049589 Bacteria 739
372 Ga0501074_0009824 3300049590 Bacteria 6950
373 Ga0501080_0109838 3300049742 Bacteria 2556
374 Ga0501080_0859362 3300049742 Bacteria 793
375 Ga0501035_0000307 3300049822 Bacteria 57471
376 Ga0501035_0003070 3300049822 Bacteria 16025
377 Ga0501035_0169385 3300049822 Bacteria 1887
378 Ga0501035_0220564 3300049822 Bacteria 1619
379 Ga0501044_0003114 3300049823 Bacteria 18797
380 Ga0501044_0006356 3300049823 Bacteria 13061
381 Ga0501044_0026891 3300049823 Bacteria 6089
382 Ga0501044_0107126 3300049823 Bacteria 2806
383 Ga0501044_0209269 3300049823 Bacteria 1905
384 nmdc:mga03n38_152786_c1 3300050490 Bacteria 1163
385 nmdc:mga06z11_70877_c1 3300050494 Bacteria 1844
386 nmdc:mga04h51_169618_c1 3300050495 Bacteria 844
387 nmdc:mga07m45_186780_c1 3300050496 Bacteria 1205
388 Ga0495612_0178187 3300053078 Bacteria 932
389 Ga0495619_0249652 3300053085 Bacteria 1229
390 Ga0500578_0318190 3300053086 Bacteria 918
391 Ga0500640_004162 3300053095 Bacteria 5213
392 Ga0500553_098653 3300053101 Bacteria 1263
393 Ga0500572_071006 3300053111 Bacteria 1076
394 Ga0500573_0075150 3300053140 Bacteria 1924
395 Ga0500600_0185842 3300053149 Bacteria 995
396 Ga0500600_0299122 3300053149 Bacteria 690
397 Ga0500624_003470 3300053157 Bacteria 2068
398 Ga0501084_0652257 3300054114 Bacteria 889
399 Ga0466962_0000225 3300061719 Bacteria 23463
400 Ga0466962_0100775 3300061719 Bacteria 1387
401 2547406338 2547132111 Bacteria 8013147
402 2554257713 2554235005 Bacteria 6457341
403 2585297883 2582581312 Bacteria 7308206
404 2585305409 2582581313 Bacteria 10042643
405 2585312857 2582581314 Bacteria 11452267
406 2616702291 2616644814 Bacteria 11555299
407 2616904481 2616644941 Bacteria 8510691
408 2643763355 2643221548 Bacteria 8053412
409 2643900450 2643221578 Bacteria 9213798
410 2643947474 2643221587 Bacteria 7586415
411 2644268529 2643221647 Bacteria 10741251
412 2644390399 2643221670 Bacteria 6497041
413 2644405328 2643221673 Bacteria 9196637
414 2644435166 2643221677 Bacteria 7584031
415 2644437411 2643221678 Bacteria 9540101
416 2644463775 2643221682 Bacteria 6743283
417 2644628186 2643221714 Bacteria 9015452
418 2768642726 2767802112 Bacteria 6465194
419 2784589257 2784132148 Bacteria 8627943
420 2785342381 2784746763 Bacteria 9783172
421 2785370298 2784746768 Bacteria 10036182
422 2786671407 2786546132 Bacteria 10419719
423 2804846132 2802429296 Bacteria 7227771
424 2808842808 2808606359 Bacteria 9866990
425 2808842816 2808606359 Bacteria 9866990
426 2808842826 2808606359 Bacteria 9866990
427 2808921225 2808606375 Bacteria 9466072
428 2809232869 2808606448 Bacteria 8656184
429 2811845503 2808606982 Bacteria 7791042
430 2812357238 2811994879 Bacteria 9313447
431 2812479917 2811994917 Bacteria 7761064
432 2819700040 2818991463 Bacteria 7948711
433 2852639872 2852635781 Bacteria 8251373
434 2862182093 2862178590 Bacteria 8583590
435 2862286478 2862281513 Bacteria 9621493
436 2862291400 2862290372 Bacteria 7471434
437 2862383514 2862382967 Bacteria 10317375
438 2862510113 2862507626 Bacteria 9425308
439 2862578624 2862574272 Bacteria 10567477
440 2862705391 2862705112 Bacteria 6563286
441 2863412145 2863404153 Bacteria 9672205
442 2867347730 2867346516 Bacteria 7608576
443 2867372257 2867369537 Bacteria 6501581
444 2867433455 2867428634 Bacteria 9590268
445 2867479930 2867475112 Bacteria 6909112
446 2873155154 2873151551 Bacteria 8625867
447 2875394876 2875391855 Bacteria 7600475
448 2877680327 2877676314 Bacteria 9512378
449 2912718962 2912715099 Bacteria 9460473
450 2912724170 2912723979 Bacteria 8557534
451 2912761669 2912757875 Bacteria 7940295
452 2918504829 2918501144 Bacteria 8668083
453 2919471272 2919468124 Bacteria 9133025
454 2935395629 2935390628 Bacteria 7043367
455 2946049201 2946045630 Bacteria 8527308
456 2946068625 2946064051 Bacteria 8957905
457 2946076628 2946072368 Bacteria 8999607
458 2947228265 2947224130 Bacteria 9938529
459 2954006365 2954002825 Bacteria 9173742
460 2954385360 2954380949 Bacteria 10050426
461 2954677733 2954673503 Bacteria 9685905
462 2954686421 2954682443 Bacteria 9862841
463 2954696091 2954691527 Bacteria 10720516
464 2954711263 2954701450 Bacteria 10834262
465 2954715496 2954711539 Bacteria 10867210
466 2954725414 2954721474 Bacteria 10456478
467 2954736379 2954731030 Bacteria 10243860
468 2954744350 2954740390 Bacteria 10229294
469 2954755228 2954749733 Bacteria 10366972
470 2954763322 2954759201 Bacteria 9358192
471 2966602334 2966598605 Bacteria 7676064
472 2990048961 2990044586 Bacteria 6603797
473 2990067120 2990059506 Bacteria 9321252
474 2990092857 2990088156 Bacteria 6657676
475 2997454661 2997451912 Bacteria 8492419
476 3006397063 3006393351 Bacteria 6615579
477 3006500210 3006493962 Bacteria 8825450
478 8008487080 8008485437 Bacteria 7198341
479 8008565996 8008558824 Bacteria 10610750
480 8008578241 8008574985 Bacteria 7815457
481 8023630042 8023623736 Bacteria 8593882
482 8025415665 8025413630 Bacteria 7014048
483 8025485535 8025478263 Bacteria 8209203
484 8025525159 8025524527 Bacteria 7197316
485 8025538346 8025530807 Bacteria 8495698
486 8033688540 8033684223 Bacteria 6906479
487 8048410817 8048406513 Bacteria 8936924
488 8054162998 8054160619 Bacteria 7783213
489 8056672339 8056667051 Bacteria 6953971
490 8056837798 8056829672 Bacteria 9045328
491 Ga0495589_0072141
492 JGI24739J22299_10054495
493 JGI24735J21928_10081721
494 JGI24738J21930_10021111
495 rootH1_10009305
496 rootH1_10009317
497 rootH2_10036953
498 rootH2_10047266
499 rootL2_10018875
500 rootH1_10008176
501 rootH1_10014976
502 Ga0006562J51391_1156980
503 Ga0006562J51391_1156981
504 Ga0006562J51391_1171327
505 Ga0006562J51391_1171328
506 Ga0006562J51391_1172042
507 Ga0006562J51391_1172043
508 Ga0058692_1044180
509 Ga0070670_100339498
510 Ga0068853_100556163
511 Ga0070672_100204528
512 Ga0070665_100157853
513 Ga0068856_100220509
514 Ga0068851_10396583
515 Ga0075368_10153916
516 Ga0075363_100039269
517 Ga0075363_100207335
518 Ga0075367_10093768
519 Ga0075370_10199176
520 Ga0075434_101112029
521 Ga0105251_10017617
522 Ga0105250_10178311
523 Ga0105245_10043577
524 Ga0105243_10298257
525 Ga0105243_10511133
526 Ga0105242_12022007
527 Ga0105248_10097169
528 Ga0105239_10272653
529 Ga0105246_10003768
530 Ga0105246_10238708
531 Ga0105246_10904647
532 Ga0105246_11180221
533 Ga0157372_11225548
534 Ga0157375_11409264
535 Ga0182008_10007351
536 Ga0182006_1030994
537 Ga0182007_10007433
538 Ga0183367_1015
539 Ga0213875_10008623
540 Ga0209758_1018349
541 Ga0207426_1002789
542 Ga0207426_1011202
543 Ga0207426_1011303
544 Ga0207647_10019778
545 Ga0207687_10026195
546 Ga0207709_10023379
547 Ga0207709_10416437
548 Ga0207711_10205595
549 Ga0207640_11160124
550 Ga0207639_10511705
551 Ga0207702_10251350
552 Ga0209371_1015650
553 Ga0209371_1034586
554 Ga0209813_10145198
555 Ga0268266_10085584
556 Ga0307515_10029652
557 Ga0307515_10246295
558 Ga0268256_1006954
559 Ga0268256_1039090
560 Ga0307511_10001252
561 Ga0307511_10042772
562 Ga0307512_10014623
563 Ga0307513_10081469
564 Ga0307513_10105939
565 Ga0307513_10183278
566 Ga0307509_10012425
567 Ga0307509_10070100
568 Ga0307509_10072081
569 Ga0307508_10006351
570 Ga0307508_10011600
571 Ga0307514_10064813
572 Ga0307514_10174737
573 Ga0307516_10004706
574 Ga0307516_10015687
575 Ga0307518_10034439
576 Ga0307518_10230490
577 Ga0307416_100118173
578 Ga0307411_10486881
579 Ga0307507_10078311
580 Ga0307510_10009831
581 Ga0307510_10016364
582 Ga0307510_10034454
583 Ga0395900_0013264
584 Ga0395898_0006970
585 Ga0395898_0132008
586 Ga0395898_0237690
587 Ga0395905_0668473
588 Ga0436364_1096745
589 Ga0395901_0083150
590 Ga0395901_0309969
591 Ga0439436_0000958
592 Ga0439436_0092438
593 Ga0439439_0016955
594 Ga0439439_0062877
595 Ga0451791_0838397
596 Ga0451833_0729462
597 Ga0451837_0925161
598 Ga0451841_1010329
599 Ga0451845_0601681
600 Ga0451843_1514523
601 Ga0451853_0350742
602 Ga0451853_1568221
603 Ga0439431_0139461
604 Ga0439433_0043312
605 Ga0439442_046422
606 Ga0439442_047803
607 Ga0439432_010627
608 Ga0439449_0001039
609 Ga0439449_0010985
610 Ga0439449_0059229
611 Ga0439457_002883
612 Ga0450898_001555
613 Ga0450898_011096
614 Ga0450900_018543
615 Ga0450902_026512
616 Ga0450903_012750
617 Ga0450906_004262
618 Ga0439458_0042850
619 Ga0439458_0062612
620 Ga0439458_0105695
621 Ga0450908_003157
622 Ga0450901_007737
623 Ga0466969_0051791
624 Ga0466972_0001891
625 Ga0466972_0001950
626 Ga0466972_0014472
627 Ga0466972_0054814
628 Ga0466965_0001392
629 Ga0466965_0009475
630 Ga0466965_0450846
631 Ga0466966_0003542
632 Ga0466966_0066477
633 Ga0466966_0244154
634 Ga0466961_0009577
635 Ga0466961_0023062
636 Ga0466961_0298450
637 Ga0466963_0000365
638 Ga0466963_0016789
639 Ga0466964_0007152
640 Ga0466964_0220993
641 Ga0466971_0001264
642 Ga0466971_0040710
643 Ga0466968_0033621
644 Ga0466968_0156092
645 Ga0466970_0008339
646 Ga0466970_0013981
647 Ga0466970_0057252
648 Ga0466957_0000443
649 Ga0466960_0038350
650 Ga0466960_0112383
651 Ga0466959_0001598
652 Ga0466959_0070142
653 Ga0466958_0002454
654 Ga0466958_0660889
655 Ga0466967_0016603
656 Ga0466967_0030342
657 Ga0466967_0098794
658 Ga0495627_031540
659 Ga0495627_033272
660 Ga0495592_0102343
661 Ga0495603_0000619
662 Ga0495603_0007793
663 Ga0495603_0010613
664 Ga0495603_0013813
665 Ga0495603_0016358
666 Ga0495603_0018338
667 Ga0495603_0287671
668 Ga0495590_0193987
669 Ga0495629_0001332
670 Ga0495629_0007432
671 Ga0495629_0013386
672 Ga0495629_0013675
673 Ga0495629_0014203
674 Ga0495629_0015699
675 Ga0495638_0136142
676 Ga0495638_0460062
677 Ga0495641_0033689
678 Ga0495651_0022685
679 Ga0495651_0059428
680 Ga0495653_0028880
681 Ga0495582_0190037
682 Ga0495582_0248692
683 Ga0495605_0001984
684 Ga0495639_0005996
685 Ga0495662_0006311
686 Ga0495662_0032029
687 Ga0495662_0081534
688 Ga0495664_0012005
689 Ga0495584_0424649
690 Ga0495594_0002069
691 Ga0495594_0003029
692 Ga0495594_0254418
693 Ga0495594_0423440
694 Ga0495594_0572273
695 Ga0495596_0036248
696 Ga0495607_0148883
697 Ga0495607_0178444
698 Ga0495583_0011414
699 Ga0495583_0055714
700 Ga0495606_0022814
701 Ga0495606_0201650
702 Ga0495608_0229553
703 Ga0495610_0076089
704 Ga0495616_0055103
705 Ga0495618_0003520
706 Ga0495620_0009014
707 Ga0495620_0142280
708 Ga0495628_0011436
709 Ga0495628_0576857
710 Ga0495628_0596088
711 Ga0495630_0002260
712 Ga0495630_0872841
713 Ga0495631_0048473
714 Ga0495632_0121818
715 Ga0495637_0180238
716 Ga0495643_0087553
717 Ga0495644_0052714
718 Ga0495648_0180248
719 Ga0495648_0294294
720 Ga0495666_0034655
721 Ga0495652_0046235
722 Ga0495654_0057039
723 Ga0495665_0326999
724 Ga0495640_0005496
725 Ga0495587_0010305
726 Ga0495587_0277132
727 Ga0495609_0108141
728 Ga0495597_0060350
729 Ga0495645_0217977
730 Ga0495645_0218170
731 Ga0495622_0007872
732 Ga0495633_0045702
733 Ga0495633_0511767
734 Ga0495667_0195576
735 Ga0495668_0003453
736 Ga0495668_0104626
737 Ga0495634_0002980
738 Ga0495611_0221956
739 Ga0495611_0360545
740 Ga0495625_0082852
741 Ga0495625_0177428
742 Ga0495625_0225891
743 Ga0495625_0391404
744 Ga0495635_0005850
745 Ga0495635_0013686
746 Ga0495661_0012057
747 Ga0495588_0004355
748 Ga0495588_0006669
749 Ga0495588_0104261
750 Ga0495588_0158331
751 Ga0495588_0230672
752 Ga0495588_0252112
753 Ga0495657_0007334
754 Ga0495657_0094966
755 Ga0495657_0107481
756 Ga0495657_0120998
757 Ga0495599_0201151
758 Ga0495599_0633702
759 Ga0495623_0090334
760 Ga0495646_0000454
761 Ga0495646_0022063
762 Ga0495658_0013128
763 Ga0495613_0002076
764 Ga0495613_0006399
765 Ga0495613_0165447
766 Ga0495670_0125995
767 Ga0495670_0437231
768 Ga0495670_0485276
769 Ga0495649_0004300
770 Ga0495589_0005319
771 Ga0495589_0007258
772 Ga0495589_0033691
773 Ga0495589_0259043
774 Ga0495600_0030849
775 Ga0495600_0050777
776 Ga0495600_0230178
777 Ga0495581_0022078
778 Ga0495581_0029499
779 Ga0495604_0001366
780 Ga0495604_0383940
781 Ga0495636_0035869
782 Ga0495636_0069470
783 Ga0495636_0245321
784 Ga0495636_0350045
785 Ga0495674_0016879
786 Ga0495674_0504500
787 Ga0495676_0006749
788 Ga0495676_0045839
789 Ga0495676_0046468
790 Ga0495676_0047415
791 Ga0495680_0004348
792 Ga0495683_0117645
793 Ga0495683_0175261
794 Ga0495687_001423
795 Ga0495687_009578
796 Ga0495687_015950
797 Ga0495675_0134707
798 Ga0495675_0139499
799 Ga0495677_0019346
800 Ga0495685_005511
801 Ga0495685_008350
802 Ga0495685_014531
803 Ga0495685_024385
804 Ga0495685_199278
805 Ga0495681_0105762
806 Ga0495681_0112806
807 Ga0495684_0198855
808 Ga0495684_0390492
809 Ga0495686_0047147
810 Ga0495593_0001872
811 Ga0495593_0040020
812 Ga0495593_0141094
813 Ga0495593_0275630
814 Ga0495602_0025346
815 Ga0495602_0237849
816 Ga0495614_0001567
817 Ga0495614_0047684
818 Ga0495614_0152424
819 Ga0495626_0008054
820 Ga0496109_0091883
821 Ga0496110_0779439
822 Ga0496113_0565704
823 Ga0495678_043660
824 Ga0495682_0131560
825 Ga0501031_0006551
826 Ga0501031_0069683
827 Ga0501032_0039950
828 Ga0501032_0270910
829 Ga0501033_0000908
830 Ga0501033_0111613
831 Ga0501033_0231690
832 Ga0501034_0013001
833 Ga0501034_0214444
834 Ga0501036_0015072
835 Ga0501036_0019987
836 Ga0501036_0599138
837 Ga0501037_0069802
838 Ga0501037_0182875
839 Ga0501038_0001803
840 Ga0501038_0071146
841 Ga0501038_0106497
842 Ga0501039_0004631
843 Ga0501039_0701725
844 Ga0501043_0001081
845 Ga0501043_0031255
846 Ga0501046_0016000
847 Ga0501046_0293811
848 Ga0501047_0027103
849 Ga0501047_0133568
850 Ga0501047_0135433
851 Ga0501047_0329772
852 Ga0501047_0592715
853 Ga0501048_0006354
854 Ga0501048_0550543
855 Ga0501068_0371425
856 Ga0501070_0002314
857 Ga0501070_0072362
858 Ga0501070_0511607
859 Ga0501070_0902391
860 Ga0501073_0631719
861 Ga0501074_0009824
862 Ga0501080_0109838
863 Ga0501080_0859362
864 Ga0501035_0000307
865 Ga0501035_0003070
866 Ga0501035_0169385
867 Ga0501035_0220564
868 Ga0501044_0003114
869 Ga0501044_0006356
870 Ga0501044_0026891
871 Ga0501044_0107126
872 Ga0501044_0209269
873 nmdc:mga03n38_152786_c1
874 nmdc:mga06z11_70877_c1
875 nmdc:mga04h51_169618_c1
876 nmdc:mga07m45_186780_c1
877 Ga0495612_0178187
878 Ga0495619_0249652
879 Ga0500578_0318190
880 Ga0500640_004162
881 Ga0500553_098653
882 Ga0500572_071006
883 Ga0500573_0075150
884 Ga0500600_0185842
885 Ga0500600_0299122
886 Ga0500624_003470
887 Ga0501084_0652257
888 Ga0466962_0000225
889 Ga0466962_0100775
890 2547406338
891 2554257713
892 2585297883
893 2585305409
894 2585312857
895 2616702291
896 2616904481
897 2643763355
898 2643900450
899 2643947474
900 2644268529
901 2644390399
902 2644405328
903 2644435166
904 2644437411
905 2644463775
906 2644628186
907 2768642726
908 2784589257
909 2785342381
910 2785370298
911 2786671407
912 2804846132
913 2808842808
914 2808842816
915 2808842826
916 2808921225
917 2809232869
918 2811845503
919 2812357238
920 2812479917
921 2819700040
922 2852639872
923 2862182093
924 2862286478
925 2862291400
926 2862383514
927 2862510113
928 2862578624
929 2862705391
930 2863412145
931 2867347730
932 2867372257
933 2867433455
934 2867479930
935 2873155154
936 2875394876
937 2877680327
938 2912718962
939 2912724170
940 2912761669
941 2918504829
942 2919471272
943 2935395629
944 2946049201
945 2946068625
946 2946076628
947 2947228265
948 2954006365
949 2954385360
950 2954677733
951 2954686421
952 2954696091
953 2954711263
954 2954715496
955 2954725414
956 2954736379
957 2954744350
958 2954755228
959 2954763322
960 2966602334
961 2990048961
962 2990067120
963 2990092857
964 2997454661
965 3006397063
966 3006500210
967 8008487080
968 8008565996
969 8008578241
970 8023630042
971 8025415665
972 8025485535
973 8025525159
974 8025538346
975 8033688540
976 8048410817
977 8054162998
978 8056672339
979 8056837798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10936

DUF2617

Protein of unknown function DUF2617

2

164

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dzl-assembly1.cif.gz_B a69c-m71l mutant of fabp protein 0.7879 31 68
7dzi-assembly1.cif.gz_B intermediate of fabp with a delay time of 300 ns 0.747 26 68
2xep-assembly2.cif.gz_B structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.7418 132 166
2xft-assembly2.cif.gz_B structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.7413 132 166
2xgn-assembly2.cif.gz_B structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.7406 132 166
ID Description Score Start End Superfamily
af_A5Z2U7_9_125_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7788 132 163 3.30.450.30
2xh9A02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7369 132 166 3.40.710.10
2v7sA00 Alpha Beta;2-Layer Sandwich;TBP-like; 0.7289 28 66 3.30.2030.20
af_O44863_1_193_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7141 28 70 3.80.10.10
4dx8A00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6958 134 163 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A401MFD6-F1-model_v4 DUF2617 domain-containing protein 0.983 1 169
AF-A0A4Q4DIE8-F1-model_v4 DUF2617 domain-containing protein 0.9786 1 170
AF-A0A1G7FM66-F1-model_v4 DUF2617 domain-containing protein 0.9735 1 168
AF-A0A7Z0Q007-F1-model_v4 DUF2617 family protein 0.9654 1 168
AF-A0A4Q4DIE8-F1-model_v4 DUF2617 domain-containing protein 0.9618 1 170

Map