F453845

General Info

Members Datasets Scaffolds Average Seq Length
489 225 978 52

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0047837|Ga0495654_0047837_568_759
Length 63
Sequence MADLYLKALESERKALWATCRLKGLARDTPERQRIAALDEHLRAHKAKSGADGKSGSKGAGKA

Samples

Sample ID Description Type Environment
1 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
204 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
219 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
220 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
223 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
224 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
225 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.2
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.54
Nodule 0.2
Rhizoplane 5.32
Rhizosphere 75.66
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495654_0047837 3300046530 Bacteria 2101
2 Ga0070658_10078351 3300005327 Bacteria 2712
3 Ga0070658_10138619 3300005327 Bacteria 2031
4 Ga0070658_10429747 3300005327 Bacteria 1136
5 Ga0070658_10448767 3300005327 Bacteria 1111
6 Ga0070658_11449410 3300005327 Bacteria 596
7 Ga0070683_100037094 3300005329 Bacteria 4461
8 Ga0070683_101404183 3300005329 Bacteria 671
9 Ga0070670_100097407 3300005331 Bacteria 2530
10 Ga0070670_100534028 3300005331 Bacteria 1045
11 Ga0070670_102236454 3300005331 Unclassified 504
12 Ga0070677_10066758 3300005333 Bacteria 1501
13 Ga0070666_10182542 3300005335 Bacteria 1472
14 Ga0070666_11046719 3300005335 Bacteria 606
15 Ga0070682_100097314 3300005337 Bacteria 1937
16 Ga0070682_100454139 3300005337 Bacteria 982
17 Ga0070660_100227863 3300005339 Bacteria 1516
18 Ga0070660_100377707 3300005339 Bacteria 1170
19 Ga0070660_100556880 3300005339 Bacteria 957
20 Ga0070660_101655659 3300005339 Bacteria 545
21 Ga0070691_10375670 3300005341 Bacteria 795
22 Ga0070661_100044557 3300005344 Bacteria 3241
23 Ga0070661_100277813 3300005344 Bacteria 1298
24 Ga0070661_100784793 3300005344 Bacteria 781
25 Ga0070692_10219850 3300005345 Bacteria 1122
26 Ga0070669_100056232 3300005353 Bacteria 2885
27 Ga0070669_100194073 3300005353 Bacteria 1594
28 Ga0070669_100316387 3300005353 Bacteria 1259
29 Ga0070669_101325419 3300005353 Bacteria 624
30 Ga0070675_101886562 3300005354 Bacteria 551
31 Ga0070671_100096831 3300005355 Bacteria 2474
32 Ga0070671_100098133 3300005355 Bacteria 2457
33 Ga0070674_100208073 3300005356 Bacteria 1515
34 Ga0070674_100706654 3300005356 Bacteria 862
35 Ga0070673_100140536 3300005364 Bacteria 2036
36 Ga0070673_102023763 3300005364 Bacteria 547
37 Ga0070659_100035783 3300005366 Bacteria 3868
38 Ga0070659_100069031 3300005366 Bacteria 2805
39 Ga0070659_100187430 3300005366 Bacteria 1699
40 Ga0070659_100270798 3300005366 Bacteria 1411
41 Ga0070659_100281976 3300005366 Bacteria 1382
42 Ga0070659_100421115 3300005366 Bacteria 1129
43 Ga0070659_100782120 3300005366 Bacteria 829
44 Ga0070659_101988641 3300005366 Bacteria 522
45 Ga0070667_100009566 3300005367 Bacteria 8036
46 Ga0070667_100031327 3300005367 Bacteria 4435
47 Ga0070667_100054139 3300005367 Unclassified 3388
48 Ga0070667_100507968 3300005367 Unclassified 1105
49 Ga0070667_100544747 3300005367 Bacteria 1066
50 Ga0070667_100917557 3300005367 Bacteria 816
51 Ga0070667_100932924 3300005367 Bacteria 809
52 Ga0070667_101101383 3300005367 Unclassified 742
53 Ga0070713_101047219 3300005436 Bacteria 788
54 Ga0070663_100244006 3300005455 Bacteria 1419
55 Ga0070663_100811056 3300005455 Bacteria 803
56 Ga0070678_100573453 3300005456 Bacteria 1004
57 Ga0070678_101680314 3300005456 Bacteria 597
58 Ga0070662_100012988 3300005457 Bacteria 5534
59 Ga0070662_100091825 3300005457 Bacteria 2281
60 Ga0070662_101039826 3300005457 Bacteria 702
61 Ga0070707_102112485 3300005468 Bacteria 531
62 Ga0070684_100055026 3300005535 Bacteria 3467
63 Ga0070684_100199300 3300005535 Bacteria 1823
64 Ga0068853_100000275 3300005539 Bacteria 36242
65 Ga0068853_100835637 3300005539 Bacteria 883
66 Ga0068853_101096281 3300005539 Bacteria 768
67 Ga0068853_101222249 3300005539 Bacteria 726
68 Ga0068853_101587438 3300005539 Bacteria 634
69 Ga0070672_100086080 3300005543 Bacteria 2527
70 Ga0070672_100963429 3300005543 Bacteria 755
71 Ga0070665_100004276 3300005548 Bacteria 15016
72 Ga0070665_100005193 3300005548 Bacteria 13468
73 Ga0070665_100361289 3300005548 Bacteria 1458
74 Ga0070665_100415010 3300005548 Bacteria 1355
75 Ga0068855_100191134 3300005563 Bacteria 2309
76 Ga0068855_101137748 3300005563 Unclassified 814
77 Ga0070664_100030506 3300005564 Bacteria 4498
78 Ga0070664_100039677 3300005564 Bacteria 3968
79 Ga0070664_100086974 3300005564 Bacteria 2701
80 Ga0070664_100139833 3300005564 Bacteria 2131
81 Ga0070664_101147938 3300005564 Unclassified 732
82 Ga0070664_101338673 3300005564 Bacteria 676
83 Ga0068857_100038346 3300005577 Bacteria 4244
84 Ga0068857_100078146 3300005577 Bacteria 2953
85 Ga0068857_100425532 3300005577 Unclassified 1238
86 Ga0068854_101739447 3300005578 Bacteria 571
87 Ga0068856_100175501 3300005614 Bacteria 2155
88 Ga0068856_100422181 3300005614 Bacteria 1353
89 Ga0068852_100365827 3300005616 Bacteria 1412
90 Ga0068852_101305760 3300005616 Unclassified 747
91 Ga0068852_101409213 3300005616 Unclassified 719
92 Ga0068852_102668492 3300005616 Bacteria 519
93 Ga0068864_100015652 3300005618 Bacteria 6309
94 Ga0068864_100023170 3300005618 Bacteria 5212
95 Ga0068866_11071370 3300005718 Bacteria 576
96 Ga0068851_10314254 3300005834 Unclassified 903
97 Ga0068863_100000358 3300005841 Bacteria 46342
98 Ga0068863_100096122 3300005841 Bacteria 2812
99 Ga0068863_100199634 3300005841 Bacteria 1924
100 Ga0068863_100871721 3300005841 Bacteria 900
101 Ga0068863_101332660 3300005841 Bacteria 725
102 Ga0068858_100023130 3300005842 Bacteria 5797
103 Ga0068858_100054463 3300005842 Bacteria 3699
104 Ga0068860_100000076 3300005843 Bacteria 171786
105 Ga0068860_100000119 3300005843 Bacteria 127040
106 Ga0068860_100003246 3300005843 Bacteria 16764
107 Ga0068860_100389593 3300005843 Bacteria 1377
108 Ga0068860_100902668 3300005843 Bacteria 900
109 Ga0068862_100003115 3300005844 Bacteria 14451
110 Ga0068862_100020154 3300005844 Bacteria 5570
111 Ga0068862_100023594 3300005844 Bacteria 5156
112 Ga0068862_100078949 3300005844 Bacteria 2852
113 Ga0068862_100103549 3300005844 Unclassified 2493
114 Ga0068862_100258600 3300005844 Bacteria 1589
115 Ga0068862_100366700 3300005844 Bacteria 1340
116 Ga0068862_101128153 3300005844 Bacteria 780
117 Ga0068862_102606112 3300005844 Bacteria 517
118 Ga0075363_100003710 3300006048 Bacteria 6567
119 Ga0075367_10000153 3300006178 Bacteria 21490
120 Ga0075366_10182449 3300006195 Bacteria 1275
121 Ga0075366_10713408 3300006195 Unclassified 623
122 Ga0075366_10970604 3300006195 Bacteria 530
123 Ga0097621_100029923 3300006237 Bacteria 4305
124 Ga0097621_100212200 3300006237 Bacteria 1684
125 Ga0075370_10002730 3300006353 Bacteria 8266
126 Ga0075370_10038298 3300006353 Bacteria 2698
127 Ga0075370_10147208 3300006353 Bacteria 1379
128 Ga0075370_10177438 3300006353 Bacteria 1253
129 Ga0075370_10429273 3300006353 Bacteria 794
130 Ga0068871_100023315 3300006358 Bacteria 4784
131 Ga0068871_100418264 3300006358 Bacteria 1196
132 Ga0068871_101037775 3300006358 Bacteria 765
133 Ga0068871_102374622 3300006358 Bacteria 506
134 Ga0068865_100147228 3300006881 Bacteria 1783
135 Ga0068865_101954646 3300006881 Unclassified 532
136 Ga0075436_100265245 3300006914 Bacteria 1225
137 Ga0079104_1013964 3300006946 Bacteria 2447
138 Ga0105251_10101385 3300009011 Unclassified 1315
139 Ga0105240_10342473 3300009093 Bacteria 1698
140 Ga0111539_11410026 3300009094 Bacteria 808
141 Ga0105247_10044485 3300009101 Bacteria 2723
142 Ga0105243_12455396 3300009148 Bacteria 560
143 Ga0105241_10889653 3300009174 Bacteria 826
144 Ga0105248_10010229 3300009177 Bacteria 10329
145 Ga0105248_10225128 3300009177 Bacteria 2111
146 Ga0105248_10364296 3300009177 Bacteria 1627
147 Ga0105248_10432310 3300009177 Bacteria 1483
148 Ga0105248_10448497 3300009177 Bacteria 1454
149 Ga0105248_10587346 3300009177 Bacteria 1257
150 Ga0105248_10589111 3300009177 Bacteria 1255
151 Ga0105248_10870465 3300009177 Bacteria 1017
152 Ga0105248_12526223 3300009177 Bacteria 585
153 Ga0105237_10702041 3300009545 Unclassified 1018
154 Ga0105238_10531949 3300009551 Bacteria 1179
155 Ga0105238_11039989 3300009551 Bacteria 840
156 Ga0105238_11506292 3300009551 Bacteria 701
157 Ga0105238_11858190 3300009551 Bacteria 635
158 Ga0105249_10363457 3300009553 Bacteria 1469
159 Ga0105249_11839855 3300009553 Bacteria 678
160 Ga0105249_11870319 3300009553 Bacteria 673
161 Ga0105249_12392935 3300009553 Bacteria 601
162 Ga0105249_12548505 3300009553 Unclassified 584
163 Ga0105239_11001092 3300010375 Bacteria 961
164 Ga0105246_10066545 3300011119 Bacteria 2523
165 Ga0157373_10582810 3300013100 Bacteria 813
166 Ga0157371_10490062 3300013102 Bacteria 907
167 Ga0157371_10618836 3300013102 Bacteria 806
168 Ga0157370_12138987 3300013104 Bacteria 501
169 Ga0157369_11009185 3300013105 Bacteria 852
170 Ga0157374_10092939 3300013296 Bacteria 2879
171 Ga0157374_10395493 3300013296 Bacteria 1378
172 Ga0163162_10058235 3300013306 Bacteria 3892
173 Ga0163162_10337568 3300013306 Bacteria 1639
174 Ga0157372_10956895 3300013307 Bacteria 992
175 Ga0157372_12666556 3300013307 Bacteria 573
176 Ga0157372_13386103 3300013307 Bacteria 507
177 Ga0157375_10003555 3300013308 Bacteria 13527
178 Ga0157375_11413545 3300013308 Bacteria 820
179 Ga0163163_10090796 3300014325 Bacteria 3068
180 Ga0157380_10728986 3300014326 Bacteria 1000
181 Ga0157377_10108305 3300014745 Unclassified 1667
182 Ga0157376_11808673 3300014969 Bacteria 647
183 Ga0157376_12028673 3300014969 Bacteria 613
184 Ga0157376_12183040 3300014969 Bacteria 592
185 Ga0157376_12755212 3300014969 Bacteria 531
186 Ga0224712_10058874 3300022467 Bacteria 1523
187 Ga0207697_10173961 3300025315 Bacteria 942
188 Ga0207682_10063312 3300025893 Bacteria 1552
189 Ga0207710_10027008 3300025900 Bacteria 2483
190 Ga0207688_10149876 3300025901 Bacteria 1377
191 Ga0207680_10462104 3300025903 Bacteria 901
192 Ga0207680_10630774 3300025903 Bacteria 767
193 Ga0207647_10034492 3300025904 Bacteria 3229
194 Ga0207645_10644854 3300025907 Bacteria 719
195 Ga0207705_10120003 3300025909 Bacteria 1950
196 Ga0207705_10257023 3300025909 Bacteria 1333
197 Ga0207705_11080536 3300025909 Bacteria 618
198 Ga0207695_10024204 3300025913 Bacteria 6838
199 Ga0207695_11628973 3300025913 Bacteria 526
200 Ga0207657_10096190 3300025919 Bacteria 2463
201 Ga0207657_10144892 3300025919 Bacteria 1938
202 Ga0207657_10150685 3300025919 Bacteria 1895
203 Ga0207657_10336233 3300025919 Bacteria 1192
204 Ga0207657_10431185 3300025919 Bacteria 1035
205 Ga0207649_10031419 3300025920 Bacteria 3156
206 Ga0207649_10235668 3300025920 Bacteria 1311
207 Ga0207649_10241257 3300025920 Bacteria 1297
208 Ga0207649_11025997 3300025920 Bacteria 649
209 Ga0207649_11611599 3300025920 Bacteria 514
210 Ga0207681_10063161 3300025923 Bacteria 2553
211 Ga0207681_10459228 3300025923 Bacteria 1037
212 Ga0207681_10466481 3300025923 Bacteria 1029
213 Ga0207681_10528174 3300025923 Unclassified 969
214 Ga0207694_10603048 3300025924 Bacteria 923
215 Ga0207650_10434325 3300025925 Bacteria 1091
216 Ga0207650_10451191 3300025925 Bacteria 1070
217 Ga0207650_10654870 3300025925 Bacteria 886
218 Ga0207650_11508536 3300025925 Unclassified 571
219 Ga0207644_10049140 3300025931 Bacteria 3018
220 Ga0207644_10135143 3300025931 Bacteria 1892
221 Ga0207644_10329419 3300025931 Bacteria 1236
222 Ga0207644_10572984 3300025931 Bacteria 936
223 Ga0207644_10629516 3300025931 Bacteria 892
224 Ga0207690_10030603 3300025932 Bacteria 3435
225 Ga0207690_10082856 3300025932 Bacteria 2244
226 Ga0207690_10131602 3300025932 Bacteria 1832
227 Ga0207690_10287035 3300025932 Bacteria 1283
228 Ga0207690_10546411 3300025932 Bacteria 941
229 Ga0207706_10005073 3300025933 Bacteria 12299
230 Ga0207706_10023468 3300025933 Bacteria 5539
231 Ga0207706_10442824 3300025933 Bacteria 1124
232 Ga0207706_10851650 3300025933 Bacteria 772
233 Ga0207709_11424117 3300025935 Bacteria 574
234 Ga0207669_10470983 3300025937 Bacteria 999
235 Ga0207704_10054181 3300025938 Bacteria 2443
236 Ga0207704_10846924 3300025938 Bacteria 766
237 Ga0207691_10238911 3300025940 Bacteria 1571
238 Ga0207691_10380098 3300025940 Bacteria 1206
239 Ga0207691_10527584 3300025940 Bacteria 1002
240 Ga0207691_10729757 3300025940 Bacteria 835
241 Ga0207691_10881417 3300025940 Bacteria 750
242 Ga0207711_10021134 3300025941 Bacteria 5436
243 Ga0207711_10095201 3300025941 Bacteria 2626
244 Ga0207711_10176503 3300025941 Bacteria 1941
245 Ga0207711_10336413 3300025941 Bacteria 1397
246 Ga0207711_10964281 3300025941 Unclassified 792
247 Ga0207711_11159881 3300025941 Bacteria 714
248 Ga0207689_10877631 3300025942 Bacteria 757
249 Ga0207661_11042084 3300025944 Bacteria 753
250 Ga0207661_11611613 3300025944 Bacteria 594
251 Ga0207679_10180362 3300025945 Bacteria 1746
252 Ga0207679_10444744 3300025945 Bacteria 1148
253 Ga0207679_10448136 3300025945 Bacteria 1144
254 Ga0207679_10627561 3300025945 Bacteria 970
255 Ga0207679_10963739 3300025945 Bacteria 781
256 Ga0207679_11567481 3300025945 Unclassified 604
257 Ga0207667_10160943 3300025949 Bacteria 2309
258 Ga0207651_10743633 3300025960 Bacteria 866
259 Ga0207712_10144406 3300025961 Bacteria 1830
260 Ga0207712_10573668 3300025961 Bacteria 973
261 Ga0207712_11416821 3300025961 Bacteria 622
262 Ga0207668_11073296 3300025972 Bacteria 721
263 Ga0207640_10298577 3300025981 Bacteria 1273
264 Ga0207658_10001442 3300025986 Bacteria 18538
265 Ga0207658_10004350 3300025986 Bacteria 9850
266 Ga0207658_10029594 3300025986 Bacteria 3869
267 Ga0207658_10345004 3300025986 Bacteria 1295
268 Ga0207658_10898906 3300025986 Unclassified 806
269 Ga0207658_11252073 3300025986 Bacteria 678
270 Ga0207677_11077918 3300026023 Bacteria 731
271 Ga0207703_10039015 3300026035 Bacteria 3794
272 Ga0207703_10109765 3300026035 Unclassified 2352
273 Ga0207703_10287615 3300026035 Bacteria 1495
274 Ga0207639_10003236 3300026041 Bacteria 10956
275 Ga0207639_10365010 3300026041 Bacteria 1293
276 Ga0207639_10674454 3300026041 Bacteria 958
277 Ga0207639_11013113 3300026041 Bacteria 778
278 Ga0207678_10006281 3300026067 Bacteria 10552
279 Ga0207678_10312437 3300026067 Bacteria 1351
280 Ga0207702_10228048 3300026078 Bacteria 1739
281 Ga0207702_10285545 3300026078 Bacteria 1562
282 Ga0207641_10000125 3300026088 Bacteria 112803
283 Ga0207641_10164681 3300026088 Bacteria 2018
284 Ga0207641_10495378 3300026088 Bacteria 1186
285 Ga0207676_10005367 3300026095 Bacteria 9077
286 Ga0207676_10107684 3300026095 Bacteria 2325
287 Ga0207674_10002207 3300026116 Bacteria 24665
288 Ga0207674_10522214 3300026116 Bacteria 1147
289 Ga0207675_100827894 3300026118 Bacteria 940
290 Ga0207698_10287956 3300026142 Bacteria 1523
291 Ga0207698_10527422 3300026142 Bacteria 1153
292 Ga0207698_10906556 3300026142 Bacteria 889
293 Ga0207698_11576332 3300026142 Bacteria 672
294 Ga0209813_10000208 3300027866 Bacteria 18088
295 Ga0207428_10302788 3300027907 Bacteria 1183
296 Ga0268266_10016181 3300028379 Bacteria 6378
297 Ga0268266_10496711 3300028379 Unclassified 1164
298 Ga0268266_11098730 3300028379 Bacteria 769
299 Ga0268266_11248738 3300028379 Unclassified 718
300 Ga0268266_11522826 3300028379 Unclassified 644
301 Ga0268265_10002247 3300028380 Bacteria 14813
302 Ga0268265_10013341 3300028380 Bacteria 5582
303 Ga0268265_10013926 3300028380 Bacteria 5475
304 Ga0268265_10083432 3300028380 Unclassified 2530
305 Ga0268265_10268613 3300028380 Bacteria 1520
306 Ga0268265_10803183 3300028380 Bacteria 917
307 Ga0268265_11060238 3300028380 Unclassified 803
308 Ga0268265_11196026 3300028380 Bacteria 757
309 Ga0268265_11863030 3300028380 Bacteria 608
310 Ga0268265_12686235 3300028380 Unclassified 503
311 Ga0268264_10000128 3300028381 Bacteria 183164
312 Ga0268264_10000139 3300028381 Bacteria 171848
313 Ga0268264_10005610 3300028381 Bacteria 10631
314 Ga0265327_10032128 3300031251 Bacteria 2941
315 Ga0307408_101291059 3300031548 Unclassified 684
316 Ga0307508_10041832 3300031616 Bacteria 4112
317 Ga0307405_10007611 3300031731 Bacteria 5433
318 Ga0307405_11517322 3300031731 Unclassified 589
319 Ga0307413_10056130 3300031824 Bacteria 2401
320 Ga0307413_10173383 3300031824 Bacteria 1529
321 Ga0307413_10519044 3300031824 Bacteria 960
322 Ga0307413_10989056 3300031824 Bacteria 720
323 Ga0307410_10011111 3300031852 Bacteria 5136
324 Ga0307410_10264241 3300031852 Bacteria 1343
325 Ga0307410_10736332 3300031852 Unclassified 834
326 Ga0307412_10061296 3300031911 Bacteria 2528
327 Ga0307412_10067432 3300031911 Bacteria 2429
328 Ga0307412_10081659 3300031911 Bacteria 2236
329 Ga0307412_10568130 3300031911 Bacteria 955
330 Ga0307412_11192091 3300031911 Unclassified 681
331 Ga0307412_11897692 3300031911 Bacteria 550
332 Ga0307409_100202218 3300031995 Bacteria 1778
333 Ga0307409_100725969 3300031995 Bacteria 995
334 Ga0307409_100889794 3300031995 Bacteria 903
335 Ga0307416_100464926 3300032002 Bacteria 1321
336 Ga0307416_101298341 3300032002 Unclassified 834
337 Ga0307414_10335879 3300032004 Bacteria 1291
338 Ga0307414_10610564 3300032004 Bacteria 979
339 Ga0307411_10331983 3300032005 Bacteria 1232
340 Ga0307411_10408742 3300032005 Bacteria 1124
341 Ga0307411_10855321 3300032005 Bacteria 805
342 Ga0307415_100040867 3300032126 Bacteria 3076
343 Ga0307415_100929510 3300032126 Bacteria 804
344 Ga0307510_10643231 3300033180 Bacteria 517
345 Ga0373935_0738219 3300035692 Bacteria 725
346 Ga0395900_0709861 3300037418 Bacteria 938
347 Ga0395905_0017644 3300037471 Bacteria 6774
348 Ga0395905_0460634 3300037471 Bacteria 1170
349 Ga0439465_0162060 3300041413 Bacteria 802
350 Ga0451787_249096 3300041441 Bacteria 579
351 Ga0451853_3052179 3300041512 Bacteria 1210
352 Ga0451853_3338197 3300041512 Bacteria 1067
353 Ga0439448_0014992 3300042005 Bacteria 2344
354 Ga0439455_0045633 3300042012 Bacteria 1133
355 Ga0439462_0210842 3300042015 Bacteria 554
356 Ga0450912_014903 3300042116 Bacteria 708
357 Ga0439458_0000532 3300042157 Bacteria 9821
358 Ga0450893_0083677 3300042532 Bacteria 633
359 Ga0466960_0208337 3300044901 Bacteria 1071
360 Ga0495638_0068286 3300046460 Bacteria 2180
361 Ga0495638_0104248 3300046460 Bacteria 1691
362 Ga0495639_0254528 3300046475 Bacteria 869
363 Ga0495583_0000251 3300046506 Bacteria 88803
364 Ga0495616_0000176 3300046513 Bacteria 54755
365 Ga0495632_0000938 3300046519 Bacteria 25529
366 Ga0495648_0000036 3300046524 Bacteria 195997
367 Ga0495654_0057321 3300046530 Bacteria 1882
368 Ga0495621_0025580 3300046539 Bacteria 1984
369 Ga0495656_0774813 3300046615 Bacteria 518
370 Ga0495668_0010696 3300046616 Bacteria 5542
371 Ga0495668_0013682 3300046616 Bacteria 4776
372 Ga0495668_0689373 3300046616 Bacteria 565
373 Ga0495625_0008768 3300046660 Bacteria 8570
374 Ga0495625_0489279 3300046660 Bacteria 754
375 Ga0495625_0638038 3300046660 Unclassified 635
376 Ga0495588_0527230 3300046674 Bacteria 619
377 Ga0495669_0022331 3300046684 Bacteria 2748
378 Ga0495669_0491991 3300046684 Bacteria 596
379 Ga0495671_0000054 3300046692 Bacteria 115885
380 Ga0495673_0000158 3300047469 Bacteria 116122
381 Ga0495615_0032812 3300048090 Bacteria 1254
382 Ga0496100_1281987 3300048903 Bacteria 578
383 Ga0496101_0475373 3300048904 Bacteria 987
384 Ga0496101_0588687 3300048904 Bacteria 880
385 Ga0496102_0185092 3300048905 Bacteria 1963
386 Ga0496103_0107138 3300048906 Bacteria 1773
387 Ga0496103_0301367 3300048906 Bacteria 1031
388 Ga0496103_0713835 3300048906 Bacteria 635
389 Ga0496105_0588371 3300048908 Bacteria 865
390 Ga0496105_0754773 3300048908 Bacteria 743
391 Ga0496105_1096741 3300048908 Bacteria 591
392 Ga0496106_0037644 3300048909 Bacteria 3620
393 Ga0496107_0263633 3300048910 Bacteria 1282
394 Ga0496108_0227267 3300048911 Bacteria 1622
395 Ga0496108_0969040 3300048911 Bacteria 727
396 Ga0496109_0170431 3300048912 Bacteria 2042
397 Ga0496109_0667364 3300048912 Bacteria 977
398 Ga0496110_0037428 3300048913 Bacteria 4217
399 Ga0496110_0458536 3300048913 Bacteria 1161
400 Ga0496111_0484847 3300048914 Bacteria 911
401 Ga0496111_1019656 3300048914 Bacteria 592
402 Ga0496112_0132846 3300048915 Bacteria 2460
403 Ga0496112_0324609 3300048915 Bacteria 1483
404 Ga0496112_0424468 3300048915 Bacteria 1268
405 Ga0496113_0608248 3300048916 Bacteria 875
406 Ga0496113_0619579 3300048916 Bacteria 866
407 Ga0496117_0093157 3300048920 Bacteria 1933
408 Ga0496118_0032692 3300048921 Bacteria 4279
409 Ga0496118_0105609 3300048921 Bacteria 1887
410 Ga0496119_0414705 3300048922 Bacteria 640
411 Ga0496121_0000187 3300048924 Bacteria 138361
412 Ga0496121_0000740 3300048924 Bacteria 60212
413 Ga0496125_0007992 3300048928 Bacteria 11173
414 Ga0496125_0313845 3300048928 Bacteria 954
415 Ga0496126_0100578 3300048929 Bacteria 2530
416 Ga0496126_1076487 3300048929 Bacteria 598
417 Ga0501037_0809682 3300049573 Unclassified 618
418 Ga0501043_0024713 3300049579 Bacteria 4710
419 Ga0501250_052360 3300049680 Unclassified 630
420 nmdc:mga03n38_7590_c1 3300050490 Bacteria 3845
421 nmdc:mga0k408_243876_c1 3300050493 Bacteria 728
422 nmdc:mga0k408_436675_c1 3300050493 Bacteria 778
423 nmdc:mga06z11_79_c1 3300050494 Bacteria 40611
424 nmdc:mga04h51_433_c1 3300050495 Bacteria 10092
425 nmdc:mga07m45_125502_c2 3300050496 Bacteria 1181
426 nmdc:mga07m45_20260_c1 3300050496 Bacteria 3612
427 nmdc:mga07m45_2804_c1 3300050496 Bacteria 8240
428 nmdc:mga07m45_34803_c2 3300050496 Bacteria 1463
429 nmdc:mga07m45_53856_c1 3300050496 Bacteria 2274
430 nmdc:mga07m45_728557_c1 3300050496 Bacteria 570
431 nmdc:mga08y16_1472501_c1 3300050511 Bacteria 642
432 nmdc:mga08x19_148789_c1 3300050514 Bacteria 1584
433 Ga0500643_001889 3300053087 Bacteria 11385
434 Ga0500643_021481 3300053087 Bacteria 2091
435 Ga0500643_034740 3300053087 Bacteria 1516
436 Ga0500643_067440 3300053087 Unclassified 996
437 Ga0500643_109254 3300053087 Bacteria 747
438 Ga0500647_0435860 3300053091 Bacteria 522
439 Ga0500566_0265209 3300053094 Bacteria 827
440 Ga0500641_0309866 3300053096 Bacteria 646
441 Ga0500641_0407962 3300053096 Bacteria 533
442 Ga0500650_0169890 3300053098 Bacteria 1003
443 Ga0500556_0000053 3300053104 Bacteria 117389
444 Ga0500556_0232798 3300053104 Bacteria 726
445 Ga0500556_0262297 3300053104 Unclassified 679
446 Ga0500592_012358 3300053116 Unclassified 1367
447 Ga0500593_021792 3300053117 Bacteria 2825
448 Ga0500594_0132051 3300053118 Bacteria 791
449 Ga0500595_020051 3300053119 Bacteria 2414
450 Ga0500595_064201 3300053119 Bacteria 1102
451 Ga0500607_000026 3300053121 Bacteria 95013
452 Ga0500607_001643 3300053121 Bacteria 19653
453 Ga0500608_055050 3300053122 Bacteria 1907
454 Ga0500614_052102 3300053123 Bacteria 1078
455 Ga0500618_039415 3300053125 Bacteria 1088
456 Ga0500642_0000001 3300053130 Bacteria 1468402
457 Ga0500559_0000259 3300053136 Bacteria 41639
458 Ga0500559_0001561 3300053136 Bacteria 12818
459 Ga0500559_0017943 3300053136 Bacteria 2991
460 Ga0500559_0031006 3300053136 Bacteria 2294
461 Ga0500559_0171119 3300053136 Bacteria 1022
462 Ga0500564_000703 3300053138 Bacteria 10436
463 Ga0500564_265862 3300053138 Bacteria 673
464 Ga0500568_0034501 3300053139 Bacteria 2070
465 Ga0500590_033478 3300053148 Bacteria 2663
466 Ga0500590_058066 3300053148 Bacteria 1951
467 Ga0500604_0003180 3300053151 Bacteria 4415
468 Ga0500616_0008001 3300053153 Bacteria 6627
469 Ga0500619_151037 3300053154 Bacteria 790
470 Ga0500622_0000824 3300053156 Bacteria 26544
471 Ga0500622_0145794 3300053156 Bacteria 1124
472 Ga0500622_0183706 3300053156 Bacteria 964
473 Ga0500624_000091 3300053157 Bacteria 44769
474 Ga0500627_0055900 3300053158 Bacteria 1729
475 Ga0500630_193163 3300053159 Bacteria 803
476 Ga0500636_0002093 3300053177 Bacteria 11026
477 Ga0500637_0000944 3300053178 Bacteria 11792
478 Ga0500567_001479 3300053723 Bacteria 9512
479 Ga0500625_000029 3300053729 Bacteria 54479
480 Ga0500625_220157 3300053729 Bacteria 607
481 Ga0500645_000630 3300053730 Bacteria 22464
482 Ga0500645_006976 3300053730 Bacteria 3977
483 Ga0500645_057166 3300053730 Bacteria 1131
484 Ga0500645_093062 3300053730 Bacteria 854
485 Ga0500661_001653 3300055283 Bacteria 4194
486 Ga0500661_009384 3300055283 Bacteria 1792
487 2739650352 2739367664 Bacteria 4114334
488 2740028825 2739367865 Bacteria 4114482
489 2882806813 2882806704 Bacteria 3007728
490 Ga0495654_0047837
491 Ga0070658_10078351
492 Ga0070658_10138619
493 Ga0070658_10429747
494 Ga0070658_10448767
495 Ga0070658_11449410
496 Ga0070683_100037094
497 Ga0070683_101404183
498 Ga0070670_100097407
499 Ga0070670_100534028
500 Ga0070670_102236454
501 Ga0070677_10066758
502 Ga0070666_10182542
503 Ga0070666_11046719
504 Ga0070682_100097314
505 Ga0070682_100454139
506 Ga0070660_100227863
507 Ga0070660_100377707
508 Ga0070660_100556880
509 Ga0070660_101655659
510 Ga0070691_10375670
511 Ga0070661_100044557
512 Ga0070661_100277813
513 Ga0070661_100784793
514 Ga0070692_10219850
515 Ga0070669_100056232
516 Ga0070669_100194073
517 Ga0070669_100316387
518 Ga0070669_101325419
519 Ga0070675_101886562
520 Ga0070671_100096831
521 Ga0070671_100098133
522 Ga0070674_100208073
523 Ga0070674_100706654
524 Ga0070673_100140536
525 Ga0070673_102023763
526 Ga0070659_100035783
527 Ga0070659_100069031
528 Ga0070659_100187430
529 Ga0070659_100270798
530 Ga0070659_100281976
531 Ga0070659_100421115
532 Ga0070659_100782120
533 Ga0070659_101988641
534 Ga0070667_100009566
535 Ga0070667_100031327
536 Ga0070667_100054139
537 Ga0070667_100507968
538 Ga0070667_100544747
539 Ga0070667_100917557
540 Ga0070667_100932924
541 Ga0070667_101101383
542 Ga0070713_101047219
543 Ga0070663_100244006
544 Ga0070663_100811056
545 Ga0070678_100573453
546 Ga0070678_101680314
547 Ga0070662_100012988
548 Ga0070662_100091825
549 Ga0070662_101039826
550 Ga0070707_102112485
551 Ga0070684_100055026
552 Ga0070684_100199300
553 Ga0068853_100000275
554 Ga0068853_100835637
555 Ga0068853_101096281
556 Ga0068853_101222249
557 Ga0068853_101587438
558 Ga0070672_100086080
559 Ga0070672_100963429
560 Ga0070665_100004276
561 Ga0070665_100005193
562 Ga0070665_100361289
563 Ga0070665_100415010
564 Ga0068855_100191134
565 Ga0068855_101137748
566 Ga0070664_100030506
567 Ga0070664_100039677
568 Ga0070664_100086974
569 Ga0070664_100139833
570 Ga0070664_101147938
571 Ga0070664_101338673
572 Ga0068857_100038346
573 Ga0068857_100078146
574 Ga0068857_100425532
575 Ga0068854_101739447
576 Ga0068856_100175501
577 Ga0068856_100422181
578 Ga0068852_100365827
579 Ga0068852_101305760
580 Ga0068852_101409213
581 Ga0068852_102668492
582 Ga0068864_100015652
583 Ga0068864_100023170
584 Ga0068866_11071370
585 Ga0068851_10314254
586 Ga0068863_100000358
587 Ga0068863_100096122
588 Ga0068863_100199634
589 Ga0068863_100871721
590 Ga0068863_101332660
591 Ga0068858_100023130
592 Ga0068858_100054463
593 Ga0068860_100000076
594 Ga0068860_100000119
595 Ga0068860_100003246
596 Ga0068860_100389593
597 Ga0068860_100902668
598 Ga0068862_100003115
599 Ga0068862_100020154
600 Ga0068862_100023594
601 Ga0068862_100078949
602 Ga0068862_100103549
603 Ga0068862_100258600
604 Ga0068862_100366700
605 Ga0068862_101128153
606 Ga0068862_102606112
607 Ga0075363_100003710
608 Ga0075367_10000153
609 Ga0075366_10182449
610 Ga0075366_10713408
611 Ga0075366_10970604
612 Ga0097621_100029923
613 Ga0097621_100212200
614 Ga0075370_10002730
615 Ga0075370_10038298
616 Ga0075370_10147208
617 Ga0075370_10177438
618 Ga0075370_10429273
619 Ga0068871_100023315
620 Ga0068871_100418264
621 Ga0068871_101037775
622 Ga0068871_102374622
623 Ga0068865_100147228
624 Ga0068865_101954646
625 Ga0075436_100265245
626 Ga0079104_1013964
627 Ga0105251_10101385
628 Ga0105240_10342473
629 Ga0111539_11410026
630 Ga0105247_10044485
631 Ga0105243_12455396
632 Ga0105241_10889653
633 Ga0105248_10010229
634 Ga0105248_10225128
635 Ga0105248_10364296
636 Ga0105248_10432310
637 Ga0105248_10448497
638 Ga0105248_10587346
639 Ga0105248_10589111
640 Ga0105248_10870465
641 Ga0105248_12526223
642 Ga0105237_10702041
643 Ga0105238_10531949
644 Ga0105238_11039989
645 Ga0105238_11506292
646 Ga0105238_11858190
647 Ga0105249_10363457
648 Ga0105249_11839855
649 Ga0105249_11870319
650 Ga0105249_12392935
651 Ga0105249_12548505
652 Ga0105239_11001092
653 Ga0105246_10066545
654 Ga0157373_10582810
655 Ga0157371_10490062
656 Ga0157371_10618836
657 Ga0157370_12138987
658 Ga0157369_11009185
659 Ga0157374_10092939
660 Ga0157374_10395493
661 Ga0163162_10058235
662 Ga0163162_10337568
663 Ga0157372_10956895
664 Ga0157372_12666556
665 Ga0157372_13386103
666 Ga0157375_10003555
667 Ga0157375_11413545
668 Ga0163163_10090796
669 Ga0157380_10728986
670 Ga0157377_10108305
671 Ga0157376_11808673
672 Ga0157376_12028673
673 Ga0157376_12183040
674 Ga0157376_12755212
675 Ga0224712_10058874
676 Ga0207697_10173961
677 Ga0207682_10063312
678 Ga0207710_10027008
679 Ga0207688_10149876
680 Ga0207680_10462104
681 Ga0207680_10630774
682 Ga0207647_10034492
683 Ga0207645_10644854
684 Ga0207705_10120003
685 Ga0207705_10257023
686 Ga0207705_11080536
687 Ga0207695_10024204
688 Ga0207695_11628973
689 Ga0207657_10096190
690 Ga0207657_10144892
691 Ga0207657_10150685
692 Ga0207657_10336233
693 Ga0207657_10431185
694 Ga0207649_10031419
695 Ga0207649_10235668
696 Ga0207649_10241257
697 Ga0207649_11025997
698 Ga0207649_11611599
699 Ga0207681_10063161
700 Ga0207681_10459228
701 Ga0207681_10466481
702 Ga0207681_10528174
703 Ga0207694_10603048
704 Ga0207650_10434325
705 Ga0207650_10451191
706 Ga0207650_10654870
707 Ga0207650_11508536
708 Ga0207644_10049140
709 Ga0207644_10135143
710 Ga0207644_10329419
711 Ga0207644_10572984
712 Ga0207644_10629516
713 Ga0207690_10030603
714 Ga0207690_10082856
715 Ga0207690_10131602
716 Ga0207690_10287035
717 Ga0207690_10546411
718 Ga0207706_10005073
719 Ga0207706_10023468
720 Ga0207706_10442824
721 Ga0207706_10851650
722 Ga0207709_11424117
723 Ga0207669_10470983
724 Ga0207704_10054181
725 Ga0207704_10846924
726 Ga0207691_10238911
727 Ga0207691_10380098
728 Ga0207691_10527584
729 Ga0207691_10729757
730 Ga0207691_10881417
731 Ga0207711_10021134
732 Ga0207711_10095201
733 Ga0207711_10176503
734 Ga0207711_10336413
735 Ga0207711_10964281
736 Ga0207711_11159881
737 Ga0207689_10877631
738 Ga0207661_11042084
739 Ga0207661_11611613
740 Ga0207679_10180362
741 Ga0207679_10444744
742 Ga0207679_10448136
743 Ga0207679_10627561
744 Ga0207679_10963739
745 Ga0207679_11567481
746 Ga0207667_10160943
747 Ga0207651_10743633
748 Ga0207712_10144406
749 Ga0207712_10573668
750 Ga0207712_11416821
751 Ga0207668_11073296
752 Ga0207640_10298577
753 Ga0207658_10001442
754 Ga0207658_10004350
755 Ga0207658_10029594
756 Ga0207658_10345004
757 Ga0207658_10898906
758 Ga0207658_11252073
759 Ga0207677_11077918
760 Ga0207703_10039015
761 Ga0207703_10109765
762 Ga0207703_10287615
763 Ga0207639_10003236
764 Ga0207639_10365010
765 Ga0207639_10674454
766 Ga0207639_11013113
767 Ga0207678_10006281
768 Ga0207678_10312437
769 Ga0207702_10228048
770 Ga0207702_10285545
771 Ga0207641_10000125
772 Ga0207641_10164681
773 Ga0207641_10495378
774 Ga0207676_10005367
775 Ga0207676_10107684
776 Ga0207674_10002207
777 Ga0207674_10522214
778 Ga0207675_100827894
779 Ga0207698_10287956
780 Ga0207698_10527422
781 Ga0207698_10906556
782 Ga0207698_11576332
783 Ga0209813_10000208
784 Ga0207428_10302788
785 Ga0268266_10016181
786 Ga0268266_10496711
787 Ga0268266_11098730
788 Ga0268266_11248738
789 Ga0268266_11522826
790 Ga0268265_10002247
791 Ga0268265_10013341
792 Ga0268265_10013926
793 Ga0268265_10083432
794 Ga0268265_10268613
795 Ga0268265_10803183
796 Ga0268265_11060238
797 Ga0268265_11196026
798 Ga0268265_11863030
799 Ga0268265_12686235
800 Ga0268264_10000128
801 Ga0268264_10000139
802 Ga0268264_10005610
803 Ga0265327_10032128
804 Ga0307408_101291059
805 Ga0307508_10041832
806 Ga0307405_10007611
807 Ga0307405_11517322
808 Ga0307413_10056130
809 Ga0307413_10173383
810 Ga0307413_10519044
811 Ga0307413_10989056
812 Ga0307410_10011111
813 Ga0307410_10264241
814 Ga0307410_10736332
815 Ga0307412_10061296
816 Ga0307412_10067432
817 Ga0307412_10081659
818 Ga0307412_10568130
819 Ga0307412_11192091
820 Ga0307412_11897692
821 Ga0307409_100202218
822 Ga0307409_100725969
823 Ga0307409_100889794
824 Ga0307416_100464926
825 Ga0307416_101298341
826 Ga0307414_10335879
827 Ga0307414_10610564
828 Ga0307411_10331983
829 Ga0307411_10408742
830 Ga0307411_10855321
831 Ga0307415_100040867
832 Ga0307415_100929510
833 Ga0307510_10643231
834 Ga0373935_0738219
835 Ga0395900_0709861
836 Ga0395905_0017644
837 Ga0395905_0460634
838 Ga0439465_0162060
839 Ga0451787_249096
840 Ga0451853_3052179
841 Ga0451853_3338197
842 Ga0439448_0014992
843 Ga0439455_0045633
844 Ga0439462_0210842
845 Ga0450912_014903
846 Ga0439458_0000532
847 Ga0450893_0083677
848 Ga0466960_0208337
849 Ga0495638_0068286
850 Ga0495638_0104248
851 Ga0495639_0254528
852 Ga0495583_0000251
853 Ga0495616_0000176
854 Ga0495632_0000938
855 Ga0495648_0000036
856 Ga0495654_0057321
857 Ga0495621_0025580
858 Ga0495656_0774813
859 Ga0495668_0010696
860 Ga0495668_0013682
861 Ga0495668_0689373
862 Ga0495625_0008768
863 Ga0495625_0489279
864 Ga0495625_0638038
865 Ga0495588_0527230
866 Ga0495669_0022331
867 Ga0495669_0491991
868 Ga0495671_0000054
869 Ga0495673_0000158
870 Ga0495615_0032812
871 Ga0496100_1281987
872 Ga0496101_0475373
873 Ga0496101_0588687
874 Ga0496102_0185092
875 Ga0496103_0107138
876 Ga0496103_0301367
877 Ga0496103_0713835
878 Ga0496105_0588371
879 Ga0496105_0754773
880 Ga0496105_1096741
881 Ga0496106_0037644
882 Ga0496107_0263633
883 Ga0496108_0227267
884 Ga0496108_0969040
885 Ga0496109_0170431
886 Ga0496109_0667364
887 Ga0496110_0037428
888 Ga0496110_0458536
889 Ga0496111_0484847
890 Ga0496111_1019656
891 Ga0496112_0132846
892 Ga0496112_0324609
893 Ga0496112_0424468
894 Ga0496113_0608248
895 Ga0496113_0619579
896 Ga0496117_0093157
897 Ga0496118_0032692
898 Ga0496118_0105609
899 Ga0496119_0414705
900 Ga0496121_0000187
901 Ga0496121_0000740
902 Ga0496125_0007992
903 Ga0496125_0313845
904 Ga0496126_0100578
905 Ga0496126_1076487
906 Ga0501037_0809682
907 Ga0501043_0024713
908 Ga0501250_052360
909 nmdc:mga03n38_7590_c1
910 nmdc:mga0k408_243876_c1
911 nmdc:mga0k408_436675_c1
912 nmdc:mga06z11_79_c1
913 nmdc:mga04h51_433_c1
914 nmdc:mga07m45_125502_c2
915 nmdc:mga07m45_20260_c1
916 nmdc:mga07m45_2804_c1
917 nmdc:mga07m45_34803_c2
918 nmdc:mga07m45_53856_c1
919 nmdc:mga07m45_728557_c1
920 nmdc:mga08y16_1472501_c1
921 nmdc:mga08x19_148789_c1
922 Ga0500643_001889
923 Ga0500643_021481
924 Ga0500643_034740
925 Ga0500643_067440
926 Ga0500643_109254
927 Ga0500647_0435860
928 Ga0500566_0265209
929 Ga0500641_0309866
930 Ga0500641_0407962
931 Ga0500650_0169890
932 Ga0500556_0000053
933 Ga0500556_0232798
934 Ga0500556_0262297
935 Ga0500592_012358
936 Ga0500593_021792
937 Ga0500594_0132051
938 Ga0500595_020051
939 Ga0500595_064201
940 Ga0500607_000026
941 Ga0500607_001643
942 Ga0500608_055050
943 Ga0500614_052102
944 Ga0500618_039415
945 Ga0500642_0000001
946 Ga0500559_0000259
947 Ga0500559_0001561
948 Ga0500559_0017943
949 Ga0500559_0031006
950 Ga0500559_0171119
951 Ga0500564_000703
952 Ga0500564_265862
953 Ga0500568_0034501
954 Ga0500590_033478
955 Ga0500590_058066
956 Ga0500604_0003180
957 Ga0500616_0008001
958 Ga0500619_151037
959 Ga0500622_0000824
960 Ga0500622_0145794
961 Ga0500622_0183706
962 Ga0500624_000091
963 Ga0500627_0055900
964 Ga0500630_193163
965 Ga0500636_0002093
966 Ga0500637_0000944
967 Ga0500567_001479
968 Ga0500625_000029
969 Ga0500625_220157
970 Ga0500645_000630
971 Ga0500645_006976
972 Ga0500645_057166
973 Ga0500645_093062
974 Ga0500661_001653
975 Ga0500661_009384
976 2739650352
977 2740028825
978 2882806813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h6r-assembly1.cif.gz_A lw domain of arabidopsis thaliana tfiis 0.9246 8 38
6rxv-assembly1.cif.gz_Ch cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state b2 0.8881 6 50
2dq3-assembly1.cif.gz_B crystal structure of aq_298 0.8219 5 48
5uae-assembly1.cif.gz_B crystal structure of the coiled-coil domain from listeria innocua phage integrase (trigonal form) 0.7487 3 50
6rxv-assembly1.cif.gz_Ch cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state b2 0.7479 6 50
ID Description Score Start End Superfamily
af_F4JTI1_459_631_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8836 6 44 1.25.40.10
af_A0A1D6IUT0_71_343_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8405 3 48 3.40.50.300
af_F4IRM4_414_609_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8335 6 44 1.25.40.10
2dq3B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8219 5 48 1.10.287.40
af_A0A1D6HTM3_159_428_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8117 2 48 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4R1D6U1-F1-model_v4 deleted 1.01 1 51
AF-A0A437GZB4-F1-model_v4 Uncharacterized protein 1.007 1 46
AF-A0A6G7YPE1-F1-model_v4 Uncharacterized protein 1.001 1 48
AF-A0A2G1YHB2-F1-model_v4 Uncharacterized protein 0.9958 1 51
AF-A0A1L0CPV2-F1-model_v4 RING-type domain-containing protein 0.9913 4 50 GO:0006511
GO:0016020
GO:0016567
GO:0061630

Map