F453753

General Info

Members Datasets Scaffolds Average Seq Length
489 357 250 215

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10031118|Ga0075369_100311182
Length 224
Sequence MSDDPETARQIEELAADNRPLLVLDVDDVVLEFIRPFPHFLKSRGFALTLASFRLTGNIAETASGRLIEQAEVTALLGEFFDAQAEWQSVTDGAAQALATLGGRAEIVLLTAMPHKHRAVRRAHLDALGLTYPLLTTEMAKGPAVAKLRGNKGRPVAFVDDQPHNLVSVRSSVADAHLFHLMADNSLRAFLPPVPDGIVTVENWHDAAPKIVTTLGLEAIPGKP

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
12 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
13 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
14 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
15 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
16 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
17 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
18 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
19 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
20 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
21 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
22 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2738543024 Aminobacter sp. AP02 Isolate Unclassified
24 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
25 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
26 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
27 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
28 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
29 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
30 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
31 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
32 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
33 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
34 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
35 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
36 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
37 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
38 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
39 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
40 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
41 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
42 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
43 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
44 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
45 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
46 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
47 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
48 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
49 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
50 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
51 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
52 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
53 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
54 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
55 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
56 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
57 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
58 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
59 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
60 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
61 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
62 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
63 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
64 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
65 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
66 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
67 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
68 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
69 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
70 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
71 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
72 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
73 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
74 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
75 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
76 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
77 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
78 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
79 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
80 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
81 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
82 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
83 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
84 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
85 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
86 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
87 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
88 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
89 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
90 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
91 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
92 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
93 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
94 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
95 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
96 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
97 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
98 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
99 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
100 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
101 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
102 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
103 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
104 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
105 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
106 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
107 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
108 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
109 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
110 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
111 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
112 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
113 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
114 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
115 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
116 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
117 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
118 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
119 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
120 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
121 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
122 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
123 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
124 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
125 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
126 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
127 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
128 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
129 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
130 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
131 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
132 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
133 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
134 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
135 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
136 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
137 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
138 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
139 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
140 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
141 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
142 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
143 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
144 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
145 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
146 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
147 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
148 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
149 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
150 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
151 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
152 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
153 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
154 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
155 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
156 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
157 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
158 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
159 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
160 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
161 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
162 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
163 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
164 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
165 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
166 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
167 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
168 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
169 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
170 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
171 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
172 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
173 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
174 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
175 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
176 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
177 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
178 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
179 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
180 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
181 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
182 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
183 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
184 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
185 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
186 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
187 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
188 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
189 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
190 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
191 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
192 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
193 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
194 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
195 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
196 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
197 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
198 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
199 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
200 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
201 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
202 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
203 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
204 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
205 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
206 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
207 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
208 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
209 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
210 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
211 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
212 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
213 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
214 3004167301 Mesorhizobium loti 582 Isolate Unclassified
215 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
216 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
217 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
218 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
219 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
220 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
221 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
222 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
223 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
224 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
225 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
228 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
229 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
230 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
231 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
232 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
233 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
234 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
235 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
236 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
237 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
238 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
239 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
240 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
245 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
246 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
247 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
248 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
249 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
250 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
251 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
252 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
253 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
254 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
255 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
258 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
259 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
260 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
261 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
262 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
263 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
264 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
265 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
266 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
268 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
269 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
271 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
288 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
340 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
345 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
346 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
347 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
348 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
349 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
350 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
351 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
352 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
353 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
354 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
355 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
356 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
357 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.12
Metatranscriptomes 0
Isolates 48.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 41.72
Rhizoplane 0.82
Rhizosphere 41.31
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001861 3300002705 Bacteria 8253
2 JGI25157J39369_1000922 3300002741 Bacteria 13985
3 JGI25165J46597_1000200 3300003214 Bacteria 87751
4 rootH1_10073558 3300003316 Bacteria 3433
5 Ga0055542_1001532 3300003762 Bacteria 11108
6 Ga0070658_10118806 3300005327 Bacteria 2195
7 Ga0070676_10106318 3300005328 Bacteria 1741
8 Ga0070668_100205900 3300005347 Bacteria 1616
9 Ga0070671_100132917 3300005355 Bacteria 2096
10 Ga0070674_100495958 3300005356 Bacteria 1016
11 Ga0070663_100011596 3300005455 Bacteria 5540
12 Ga0070663_100098254 3300005455 Bacteria 2181
13 Ga0068853_100009930 3300005539 Bacteria 7685
14 Ga0068853_100350195 3300005539 Bacteria 1374
15 Ga0068853_100677458 3300005539 Bacteria 983
16 Ga0070665_100108420 3300005548 Bacteria 2779
17 Ga0070665_100185882 3300005548 Bacteria 2079
18 Ga0070665_100237100 3300005548 Bacteria 1825
19 Ga0070665_100290385 3300005548 Bacteria 1638
20 Ga0070665_101298880 3300005548 Bacteria 738
21 Ga0068855_100201574 3300005563 Bacteria 2240
22 Ga0068857_100149324 3300005577 Bacteria 2117
23 Ga0068854_100851936 3300005578 Bacteria 798
24 Ga0068852_100041026 3300005616 Bacteria 3908
25 Ga0068852_101331911 3300005616 Bacteria 740
26 Ga0075365_10001245 3300006038 Bacteria 11285
27 Ga0075365_10017425 3300006038 Bacteria 4394
28 Ga0075365_10027073 3300006038 Bacteria 3644
29 Ga0075368_10003017 3300006042 Bacteria 5565
30 Ga0075363_100019864 3300006048 Bacteria 3363
31 Ga0075362_10009720 3300006177 Bacteria 3729
32 Ga0075367_10062397 3300006178 Bacteria 2226
33 Ga0075367_10065148 3300006178 Bacteria 2181
34 Ga0075367_10082156 3300006178 Bacteria 1950
35 Ga0075369_10031118 3300006186 Bacteria 2250
36 Ga0075369_10154024 3300006186 Bacteria 1051
37 Ga0075370_10019640 3300006353 Bacteria 3683
38 Ga0075370_10215404 3300006353 Bacteria 1134
39 Ga0105240_10199733 3300009093 Bacteria 2344
40 Ga0105240_10302241 3300009093 Bacteria 1830
41 Ga0105243_10151405 3300009148 Bacteria 1990
42 Ga0105241_10045348 3300009174 Bacteria 3335
43 Ga0105242_10390891 3300009176 Bacteria 1295
44 Ga0105248_10226019 3300009177 Bacteria 2107
45 Ga0105237_10073454 3300009545 Bacteria 3412
46 Ga0105238_10033160 3300009551 Bacteria 5255
47 Ga0105238_10204910 3300009551 Bacteria 1948
48 Ga0105238_10434609 3300009551 Bacteria 1308
49 Ga0105238_10514947 3300009551 Bacteria 1198
50 Ga0105249_10608768 3300009553 Bacteria 1148
51 Ga0105239_10078115 3300010375 Bacteria 3643
52 Ga0105239_10110564 3300010375 Bacteria 3046
53 Ga0105239_10170046 3300010375 Bacteria 2437
54 Ga0105239_10561373 3300010375 Bacteria 1300
55 Ga0157369_10111816 3300013105 Bacteria 2903
56 Ga0157374_10215152 3300013296 Bacteria 1885
57 Ga0157374_10384177 3300013296 Bacteria 1399
58 Ga0157372_10241133 3300013307 Bacteria 2098
59 Ga0182008_10216725 3300014497 Bacteria 978
60 Ga0157379_10408221 3300014968 Bacteria 1249
61 Ga0157376_10331177 3300014969 Bacteria 1451
62 Ga0182006_1086888 3300015261 Bacteria 1131
63 Ga0163161_10441688 3300017792 Bacteria 1050
64 Ga0209026_1000024 3300025250 Bacteria 355839
65 Ga0209148_1000050 3300025254 Bacteria 413178
66 Ga0209759_1000302 3300025256 Bacteria 67678
67 Ga0209233_1000027 3300025261 Bacteria 652089
68 Ga0209233_1011519 3300025261 Bacteria 2603
69 Ga0209455_1000507 3300025272 Bacteria 27901
70 Ga0209758_1047261 3300025297 Bacteria 1542
71 Ga0207647_10386995 3300025904 Bacteria 789
72 Ga0207705_10084423 3300025909 Bacteria 2318
73 Ga0207654_10027942 3300025911 Bacteria 3071
74 Ga0207695_10238458 3300025913 Bacteria 1721
75 Ga0207695_10581802 3300025913 Bacteria 1001
76 Ga0207671_10130205 3300025914 Bacteria 1931
77 Ga0207657_10100140 3300025919 Bacteria 2406
78 Ga0207657_10108925 3300025919 Bacteria 2290
79 Ga0207694_10018412 3300025924 Bacteria 5279
80 Ga0207687_10220373 3300025927 Bacteria 1493
81 Ga0207667_10465096 3300025949 Bacteria 1284
82 Ga0207712_10884538 3300025961 Bacteria 789
83 Ga0207639_10410115 3300026041 Bacteria 1222
84 Ga0207639_10479025 3300026041 Bacteria 1134
85 Ga0207678_10022085 3300026067 Bacteria 5576
86 Ga0207678_10065457 3300026067 Bacteria 3121
87 Ga0207678_10065600 3300026067 Bacteria 3117
88 Ga0207648_10319806 3300026089 Bacteria 1394
89 Ga0207683_10304906 3300026121 Bacteria 1457
90 Ga0207698_10097652 3300026142 Bacteria 2425
91 Ga0268266_10064627 3300028379 Bacteria 3162
92 Ga0268266_10272703 3300028379 Bacteria 1571
93 Ga0268266_10417406 3300028379 Bacteria 1271
94 Ga0268266_10827412 3300028379 Bacteria 895
95 Ga0307515_10366266 3300028794 Bacteria 1080
96 Ga0307412_10230019 3300031911 Bacteria 1427
97 Ga0395899_0000213 3300037312 Bacteria 83403
98 Ga0395899_0556596 3300037312 Bacteria 736
99 Ga0395900_0000121 3300037418 Bacteria 135026
100 Ga0395900_0279656 3300037418 Bacteria 1661
101 Ga0395900_0291315 3300037418 Bacteria 1621
102 Ga0395900_0402607 3300037418 Bacteria 1332
103 Ga0395898_0000247 3300037466 Bacteria 135026
104 Ga0395898_0091534 3300037466 Bacteria 2926
105 Ga0395898_0198229 3300037466 Bacteria 1918
106 Ga0395905_0000112 3300037471 Bacteria 135010
107 Ga0395905_0177489 3300037471 Bacteria 1999
108 Ga0395905_0267307 3300037471 Bacteria 1596
109 Ga0395901_0000078 3300038443 Bacteria 135026
110 Ga0395901_0119893 3300038443 Bacteria 2764
111 Ga0395901_0139805 3300038443 Bacteria 2545
112 Ga0395901_0168403 3300038443 Bacteria 2299
113 Ga0395901_0365856 3300038443 Bacteria 1486
114 Ga0395901_0951639 3300038443 Bacteria 837
115 Ga0466972_0052681 3300044658 Bacteria 1960
116 Ga0495638_0063031 3300046460 Bacteria 2287
117 Ga0495638_0144602 3300046460 Bacteria 1384
118 Ga0495668_0087894 3300046616 Bacteria 1704
119 Ga0496102_0737644 3300048905 Bacteria 908
120 Ga0496112_0128498 3300048915 Bacteria 2505
121 Ga0496115_0093064 3300048918 Bacteria 2465
122 Ga0496118_0205075 3300048921 Bacteria 1163
123 Ga0496119_0052211 3300048922 Bacteria 2506
124 Ga0496119_0126717 3300048922 Bacteria 1396
125 Ga0496120_0000863 3300048923 Bacteria 42869
126 Ga0496120_0140191 3300048923 Bacteria 1228
127 Ga0496120_0256656 3300048923 Bacteria 818
128 Ga0496121_0072153 3300048924 Bacteria 2773
129 Ga0496125_0072308 3300048928 Bacteria 2688
130 Ga0496126_0032383 3300048929 Bacteria 4926
131 Ga0501031_0000019 3300049568 Bacteria 104793
132 Ga0501031_0022870 3300049568 Bacteria 4076
133 Ga0501031_0026496 3300049568 Bacteria 3779
134 Ga0501031_0272774 3300049568 Bacteria 1098
135 Ga0501032_0000009 3300049569 Bacteria 228107
136 Ga0501032_0002799 3300049569 Bacteria 13565
137 Ga0501032_0014482 3300049569 Bacteria 5584
138 Ga0501032_0033159 3300049569 Bacteria 3540
139 Ga0501032_0189522 3300049569 Bacteria 1344
140 Ga0501032_0285994 3300049569 Bacteria 1067
141 Ga0501033_0000019 3300049570 Bacteria 204699
142 Ga0501033_0001826 3300049570 Bacteria 18559
143 Ga0501033_0033623 3300049570 Bacteria 3850
144 Ga0501033_0041587 3300049570 Bacteria 3428
145 Ga0501033_0089761 3300049570 Bacteria 2248
146 Ga0501033_0108213 3300049570 Bacteria 2025
147 Ga0501033_0448384 3300049570 Bacteria 896
148 Ga0501034_0000044 3300049571 Bacteria 227982
149 Ga0501034_0001700 3300049571 Bacteria 28349
150 Ga0501034_0022422 3300049571 Bacteria 6435
151 Ga0501034_0042922 3300049571 Bacteria 4577
152 Ga0501034_0096699 3300049571 Bacteria 2949
153 Ga0501034_0139770 3300049571 Bacteria 2402
154 Ga0501034_0252802 3300049571 Bacteria 1706
155 Ga0501036_0000008 3300049572 Bacteria 228106
156 Ga0501036_0038867 3300049572 Bacteria 4028
157 Ga0501036_0263479 3300049572 Bacteria 1444
158 Ga0501036_0418953 3300049572 Bacteria 1117
159 Ga0501037_0000086 3300049573 Bacteria 85419
160 Ga0501037_0000216 3300049573 Bacteria 50948
161 Ga0501037_0050229 3300049573 Bacteria 3052
162 Ga0501038_0000006 3300049574 Bacteria 228107
163 Ga0501038_0068819 3300049574 Bacteria 3009
164 Ga0501038_0323982 3300049574 Bacteria 1205
165 Ga0501039_0000014 3300049575 Bacteria 228107
166 Ga0501039_0090199 3300049575 Bacteria 2389
167 Ga0501040_0012588 3300049576 Bacteria 5546
168 Ga0501040_0014403 3300049576 Bacteria 5210
169 Ga0501042_0438572 3300049578 Bacteria 947
170 Ga0501043_0000132 3300049579 Bacteria 69702
171 Ga0501043_0000399 3300049579 Bacteria 39006
172 Ga0501043_0106869 3300049579 Bacteria 2198
173 Ga0501043_0145264 3300049579 Bacteria 1857
174 Ga0501043_0331326 3300049579 Bacteria 1159
175 Ga0501046_0021894 3300049580 Bacteria 5269
176 Ga0501047_0003906 3300049581 Bacteria 14013
177 Ga0501047_0015048 3300049581 Bacteria 7362
178 Ga0501047_0030572 3300049581 Bacteria 5191
179 Ga0501047_0093812 3300049581 Bacteria 2881
180 Ga0501047_0143026 3300049581 Bacteria 2270
181 Ga0501047_0186038 3300049581 Bacteria 1942
182 Ga0501047_0294214 3300049581 Bacteria 1467
183 Ga0501047_0407115 3300049581 Bacteria 1193
184 Ga0501048_0035654 3300049582 Bacteria 3580
185 Ga0501067_0077890 3300049583 Bacteria 1837
186 Ga0501067_0087583 3300049583 Bacteria 1728
187 Ga0501068_0005109 3300049584 Bacteria 7150
188 Ga0501068_0020874 3300049584 Bacteria 3822
189 Ga0501069_0000051 3300049585 Bacteria 70783
190 Ga0501069_0004367 3300049585 Bacteria 7299
191 Ga0501069_0160528 3300049585 Bacteria 1294
192 Ga0501070_0000291 3300049586 Bacteria 46988
193 Ga0501070_0007121 3300049586 Bacteria 9497
194 Ga0501070_0015231 3300049586 Bacteria 6472
195 Ga0501070_0034751 3300049586 Bacteria 4213
196 Ga0501070_0118450 3300049586 Bacteria 2188
197 Ga0501070_0179483 3300049586 Bacteria 1743
198 Ga0501070_0230029 3300049586 Bacteria 1519
199 Ga0501070_0263122 3300049586 Bacteria 1409
200 Ga0501070_0299795 3300049586 Bacteria 1309
201 Ga0501071_0015403 3300049587 Bacteria 5249
202 Ga0501071_0802678 3300049587 Bacteria 726
203 Ga0501072_0218045 3300049588 Bacteria 1521
204 Ga0501073_0032551 3300049589 Bacteria 3717
205 Ga0501073_0050354 3300049589 Bacteria 2919
206 Ga0501073_0087656 3300049589 Bacteria 2164
207 Ga0501073_0477383 3300049589 Bacteria 862
208 Ga0501074_0000043 3300049590 Bacteria 59245
209 Ga0501074_0009315 3300049590 Bacteria 7133
210 Ga0501079_0061425 3300049741 Bacteria 2899
211 Ga0501080_0000551 3300049742 Bacteria 29597
212 Ga0501080_0020408 3300049742 Bacteria 6132
213 Ga0501080_0050737 3300049742 Bacteria 3861
214 Ga0501080_0060263 3300049742 Bacteria 3532
215 Ga0501080_0101326 3300049742 Bacteria 2672
216 Ga0501080_0582088 3300049742 Bacteria 995
217 Ga0501083_0008038 3300049744 Bacteria 7462
218 Ga0501083_0038990 3300049744 Bacteria 3228
219 Ga0501035_0000151 3300049822 Bacteria 85429
220 Ga0501035_0000280 3300049822 Bacteria 60510
221 Ga0501035_0001157 3300049822 Bacteria 27532
222 Ga0501035_0002892 3300049822 Bacteria 16543
223 Ga0501035_0018864 3300049822 Bacteria 6355
224 Ga0501035_0024938 3300049822 Bacteria 5483
225 Ga0501035_0040203 3300049822 Bacteria 4228
226 Ga0501035_0209746 3300049822 Bacteria 1667
227 Ga0501035_0491065 3300049822 Bacteria 1011
228 Ga0501035_0556968 3300049822 Bacteria 938
229 Ga0501044_0000017 3300049823 Bacteria 228107
230 Ga0501044_0000037 3300049823 Bacteria 161924
231 Ga0501044_0004973 3300049823 Bacteria 14865
232 Ga0501044_0035619 3300049823 Bacteria 5211
233 Ga0501044_0155401 3300049823 Bacteria 2267
234 Ga0501044_0286633 3300049823 Bacteria 1579
235 Ga0501044_0310599 3300049823 Bacteria 1503
236 Ga0501045_0009380 3300049824 Bacteria 6842
237 nmdc:mga03n38_89724_c1 3300050490 Bacteria 1461
238 nmdc:mga0yw44_19582_c1 3300050492 Bacteria 3735
239 nmdc:mga0yw44_3641_c1 3300050492 Bacteria 6886
240 nmdc:mga06z11_29762_c1 3300050494 Bacteria 2634
241 nmdc:mga04h51_20364_c1 3300050495 Bacteria 1979
242 nmdc:mga07m45_36780_c1 3300050496 Bacteria 2728
243 Ga0500610_0148173 3300053079 Bacteria 1178
244 Ga0500658_0240760 3300053134 Bacteria 831
245 Ga0500568_0000062 3300053139 Bacteria 106840
246 Ga0500568_0057481 3300053139 Bacteria 1514
247 Ga0500604_0054123 3300053151 Bacteria 1245
248 Ga0500616_0012215 3300053153 Bacteria 5032
249 Ga0500616_0090819 3300053153 Bacteria 1513
250 Ga0500620_000229 3300053155 Bacteria 11160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10065148 Ga0075367_100651484 180
2 iso_pu_bacteria 2924741084 2924742109 187
3 iso_pu_bacteria 2979793036 2979799848 189
4 iso_pu_bacteria 2938014810 2938022428 196
5 iso_pu_bacteria 2871459585 2871461248 198
6 iso_pu_bacteria 2965062239 2965068157 200
7 iso_pu_bacteria 2503198000 2503202135 213
8 iso_pu_bacteria 2508501123 2509117080 213
9 iso_pu_bacteria 2509276018 2509370800 213
10 iso_pu_bacteria 2509276022 2509396779 213
11 iso_pu_bacteria 2510065059 2510317585 213
12 iso_pu_bacteria 2512875016 2512930968 213
13 iso_pu_bacteria 2512875024 2512958699 213
14 iso_pu_bacteria 2513237090 2513610143 213
15 iso_pu_bacteria 2513237164 2514034886 213
16 iso_pu_bacteria 2513237305 2514418665 213
17 iso_pu_bacteria 2588253730 2588516653 213
18 iso_pu_bacteria 2599185301 2599940428 213
19 iso_pu_bacteria 2643221550 2643773567 213
20 iso_pu_bacteria 2643221551 2643775430 213
21 iso_pu_bacteria 2643221555 2643793876 213
22 iso_pu_bacteria 2643221564 2643837233 213
23 iso_pu_bacteria 2643221595 2643989309 213
24 iso_pu_bacteria 2643221627 2644152881 213
25 iso_pu_bacteria 2687453392 2688599515 213
26 iso_pu_bacteria 2693429783 2694629713 213
27 iso_pu_bacteria 2693429784 2694636414 213
28 iso_pu_bacteria 2721755686 2723575889 213
29 iso_pu_bacteria 2738543024 2739308026 213
30 iso_pu_bacteria 2756170246 2756677228 213
31 iso_pu_bacteria 2791355123 2792749885 213
32 iso_pu_bacteria 2844002411 2844006353 213
33 iso_pu_bacteria 2844009547 2844014789 213
34 iso_pu_bacteria 2847670302 2847676094 213
35 iso_pu_bacteria 2847686936 2847692740 213
36 iso_pu_bacteria 2856314179 2856315880 213
37 iso_pu_bacteria 2856320880 2856325765 213
38 iso_pu_bacteria 2856328259 2856329067 213
39 iso_pu_bacteria 2856364286 2856370644 213
40 iso_pu_bacteria 2857367948 2857370533 213
41 iso_pu_bacteria 2869162929 2869167443 213
42 iso_pu_bacteria 2869234852 2869235579 213
43 iso_pu_bacteria 2869242130 2869247267 213
44 iso_pu_bacteria 2869249662 2869255240 213
45 iso_pu_bacteria 2869256925 2869260560 213
46 iso_pu_bacteria 2869264136 2869264220 213
47 iso_pu_bacteria 2869271264 2869271342 213
48 iso_pu_bacteria 2869278585 2869279383 213
49 iso_pu_bacteria 2869285874 2869291628 213
50 iso_pu_bacteria 2871429161 2871434838 213
51 iso_pu_bacteria 2871435913 2871443016 213
52 iso_pu_bacteria 2871451962 2871453006 213
53 iso_pu_bacteria 2871466892 2871471738 213
54 iso_pu_bacteria 2871488783 2871495462 213
55 iso_pu_bacteria 2871495908 2871501802 213
56 iso_pu_bacteria 2874102143 2874103075 213
57 iso_pu_bacteria 2874109183 2874109334 213
58 iso_pu_bacteria 2874116593 2874118302 213
59 iso_pu_bacteria 2874123672 2874130995 213
60 iso_pu_bacteria 2874131515 2874138488 213
61 iso_pu_bacteria 2874139085 2874145132 213
62 iso_pu_bacteria 2874146452 2874149228 213
63 iso_pu_bacteria 2874155637 2874157492 213
64 iso_pu_bacteria 2874162495 2874166739 213
65 iso_pu_bacteria 2874168670 2874176119 213
66 iso_pu_bacteria 2876363079 2876365882 213
67 iso_pu_bacteria 2876369609 2876370891 213
68 iso_pu_bacteria 2876386047 2876391647 213
69 iso_pu_bacteria 2876392853 2876394737 213
70 iso_pu_bacteria 2876399893 2876402601 213
71 iso_pu_bacteria 2876406927 2876407415 213
72 iso_pu_bacteria 2876413966 2876415694 213
73 iso_pu_bacteria 2876420981 2876425462 213
74 iso_pu_bacteria 2878035449 2878040148 213
75 iso_pu_bacteria 2878730984 2878734996 213
76 iso_pu_bacteria 2878738818 2878743329 213
77 iso_pu_bacteria 2878745973 2878751972 213
78 iso_pu_bacteria 2878753008 2878757914 213
79 iso_pu_bacteria 2878760144 2878765694 213
80 iso_pu_bacteria 2878767105 2878772885 213
81 iso_pu_bacteria 2878774303 2878779531 213
82 iso_pu_bacteria 2878781027 2878785663 213
83 iso_pu_bacteria 2881147464 2881152092 213
84 iso_pu_bacteria 2881155292 2881155805 213
85 iso_pu_bacteria 2881161766 2881168067 213
86 iso_pu_bacteria 2881845957 2881850207 213
87 iso_pu_bacteria 2881853255 2881856432 213
88 iso_pu_bacteria 2881861095 2881865034 213
89 iso_pu_bacteria 2882632389 2882635872 213
90 iso_pu_bacteria 2882912400 2882914056 213
91 iso_pu_bacteria 2885305155 2885309947 213
92 iso_pu_bacteria 2885312484 2885317032 213
93 iso_pu_bacteria 2885318864 2885323908 213
94 iso_pu_bacteria 2885326080 2885331906 213
95 iso_pu_bacteria 2885342637 2885346434 213
96 iso_pu_bacteria 2888337043 2888340060 213
97 iso_pu_bacteria 2888350351 2888356318 213
98 iso_pu_bacteria 2889010040 2889011233 213
99 iso_pu_bacteria 2889016732 2889017041 213
100 iso_pu_bacteria 2903448605 2903451953 213
101 iso_pu_bacteria 2903492973 2903493469 213
102 iso_pu_bacteria 2903492973 2903506660 213
103 iso_pu_bacteria 2903521522 2903523794 213
104 iso_pu_bacteria 2903528002 2903534345 213
105 iso_pu_bacteria 2903540706 2903546640 213
106 iso_pu_bacteria 2904659560 2904661369 213
107 iso_pu_bacteria 2906308376 2906314366 213
108 iso_pu_bacteria 2906321335 2906327535 213
109 iso_pu_bacteria 2906328253 2906329017 213
110 iso_pu_bacteria 2906363423 2906365394 213
111 iso_pu_bacteria 2906370794 2906377266 213
112 iso_pu_bacteria 2906378014 2906385765 213
113 iso_pu_bacteria 2906401398 2906402376 213
114 iso_pu_bacteria 2906408224 2906414079 213
115 iso_pu_bacteria 2906414383 2906416017 213
116 iso_pu_bacteria 2922130491 2922137724 213
117 iso_pu_bacteria 2922151315 2922153812 213
118 iso_pu_bacteria 2922158528 2922159788 213
119 iso_pu_bacteria 2922172374 2922178024 213
120 iso_pu_bacteria 2922185730 2922193454 213
121 iso_pu_bacteria 2924718760 2924725092 213
122 iso_pu_bacteria 2924726620 2924730418 213
123 iso_pu_bacteria 2924733363 2924737022 213
124 iso_pu_bacteria 2924748358 2924751351 213
125 iso_pu_bacteria 2924762789 2924766946 213
126 iso_pu_bacteria 2924776078 2924781140 213
127 iso_pu_bacteria 2924784321 2924784628 213
128 iso_pu_bacteria 2937813078 2937816328 213
129 iso_pu_bacteria 2937843397 2937847233 213
130 iso_pu_bacteria 2937848649 2937854951 213
131 iso_pu_bacteria 2937861824 2937863632 213
132 iso_pu_bacteria 2937877337 2937877564 213
133 iso_pu_bacteria 2937891427 2937891924 213
134 iso_pu_bacteria 2937972304 2937975353 213
135 iso_pu_bacteria 2937980651 2937988194 213
136 iso_pu_bacteria 2937994558 2938000474 213
137 iso_pu_bacteria 2958034702 2958035523 213
138 iso_pu_bacteria 2958041894 2958043710 213
139 iso_pu_bacteria 2958041894 2958054847 213
140 iso_pu_bacteria 2958064165 2958066907 213
141 iso_pu_bacteria 2958084443 2958084672 213
142 iso_pu_bacteria 2958100919 2958103064 213
143 iso_pu_bacteria 2958115193 2958118934 213
144 iso_pu_bacteria 2958130278 2958136029 213
145 iso_pu_bacteria 2958144490 2958146347 213
146 iso_pu_bacteria 2958165035 2958170869 213
147 iso_pu_bacteria 2958172287 2958173901 213
148 iso_pu_bacteria 2958179912 2958185496 213
149 iso_pu_bacteria 2961077736 2961083874 213
150 iso_pu_bacteria 2961114664 2961116523 213
151 iso_pu_bacteria 2961127735 2961133057 213
152 iso_pu_bacteria 2961136820 2961142123 213
153 iso_pu_bacteria 2961163497 2961169299 213
154 iso_pu_bacteria 2961170736 2961174458 213
155 iso_pu_bacteria 2961183825 2961185613 213
156 iso_pu_bacteria 2963644680 2963648257 213
157 iso_pu_bacteria 2965018300 2965024058 213
158 iso_pu_bacteria 2965025482 2965029616 213
159 iso_pu_bacteria 2965047637 2965050504 213
160 iso_pu_bacteria 2965102966 2965104941 213
161 iso_pu_bacteria 2965110997 2965116966 213
162 iso_pu_bacteria 2965119406 2965127019 213
163 iso_pu_bacteria 2967996073 2968000449 213
164 iso_pu_bacteria 2968003550 2968003640 213
165 iso_pu_bacteria 2968016561 2968017929 213
166 iso_pu_bacteria 2968083720 2968087653 213
167 iso_pu_bacteria 2968091066 2968095858 213
168 iso_pu_bacteria 2968097103 2968101016 213
169 iso_pu_bacteria 2968110612 2968112429 213
170 iso_pu_bacteria 2968117919 2968121218 213
171 iso_pu_bacteria 2968128360 2968132806 213
172 iso_pu_bacteria 2968138860 2968146616 213
173 iso_pu_bacteria 2968171901 2968177703 213
174 iso_pu_bacteria 2970469710 2970471896 213
175 iso_pu_bacteria 2970489779 2970492685 213
176 iso_pu_bacteria 2970503327 2970507045 213
177 iso_pu_bacteria 2970510686 2970513055 213
178 iso_pu_bacteria 2970532167 2970539154 213
179 iso_pu_bacteria 2970547951 2970549403 213
180 iso_pu_bacteria 2970554993 2970560549 213
181 iso_pu_bacteria 2970593180 2970593979 213
182 iso_pu_bacteria 2970619444 2970620337 213
183 iso_pu_bacteria 2970627176 2970633771 213
184 iso_pu_bacteria 2977821940 2977822447 213
185 iso_pu_bacteria 2977828996 2977831986 213
186 iso_pu_bacteria 2977843712 2977846563 213
187 iso_pu_bacteria 2977851361 2977851822 213
188 iso_pu_bacteria 2977858184 2977860122 213
189 iso_pu_bacteria 2977864932 2977868727 213
190 iso_pu_bacteria 2977872689 2977874781 213
191 iso_pu_bacteria 2977898635 2977902373 213
192 iso_pu_bacteria 2977907340 2977911765 213
193 iso_pu_bacteria 2977922695 2977929378 213
194 iso_pu_bacteria 2977935797 2977940165 213
195 iso_pu_bacteria 2977942078 2977947763 213
196 iso_pu_bacteria 2977957713 2977963058 213
197 iso_pu_bacteria 2977971508 2977977524 213
198 iso_pu_bacteria 2977986579 2977991720 213
199 iso_pu_bacteria 2979710463 2979714021 213
200 iso_pu_bacteria 2979764755 2979770486 213
201 iso_pu_bacteria 2979772303 2979772726 213
202 iso_pu_bacteria 2979779861 2979783061 213
203 iso_pu_bacteria 2979808191 2979812240 213
204 iso_pu_bacteria 2987645492 2987646279 213
205 iso_pu_bacteria 2987652177 2987653225 213
206 iso_pu_bacteria 2987659509 2987665418 213
207 iso_pu_bacteria 2987666974 2987668713 213
208 iso_pu_bacteria 2996310559 2996311208 213
209 iso_pu_bacteria 2996341866 2996344722 213
210 iso_pu_bacteria 2996348954 2996350825 213
211 iso_pu_bacteria 3000135777 3000138573 213
212 iso_pu_bacteria 3004167301 3004169493 213
213 iso_pu_bacteria 3004188549 3004194502 213
214 iso_pu_bacteria 3004195979 3004201302 213
215 iso_pu_bacteria 3004211236 3004211764 213
216 iso_pu_bacteria 3004218560 3004219011 213
217 iso_pu_bacteria 3004232784 3004236750 213
218 iso_pu_bacteria 3004268573 3004274648 213
219 iso_pu_bacteria 3004275668 3004277523 213
220 iso_pu_bacteria 3004334049 3004341107 213
221 iso_pu_bacteria 637000159 637074011 213
222 iso_pu_bacteria 649633066 649874018 213
223 iso_pu_bacteria 8002285264 8002286237 213
224 iso_pu_bacteria 8004300914 8004307459 213
225 iso_pu_bacteria 8004312739 8004320795 213
226 iso_pu_bacteria 8004361976 8004364580 213
227 iso_pu_bacteria 8004374579 8004379426 213
228 iso_pu_bacteria 8004387939 8004394644 213
229 iso_pu_bacteria 8004640170 8004640187 213
230 iso_pu_bacteria 8004695233 8004699427 213
231 iso_pu_bacteria 8004703790 8004709836 213
232 iso_pu_bacteria 8004714634 8004720630 213
233 iso_pu_bacteria 8004727605 8004734282 213
234 iso_pu_bacteria 2937868953 2937870996 214
235 iso_pu_bacteria 2856334872 2856338520 215
236 iso_pu_bacteria 2871481445 2871484235 215
237 iso_pu_bacteria 2965040258 2965046067 215
238 iso_pu_bacteria 2977915119 2977922074 215
239 iso_pu_bacteria 3004239961 3004241495 215
240 3300002705 JGI25156J39149_1001861 JGI25156J39149_10018614 217
241 3300002741 JGI25157J39369_1000922 JGI25157J39369_100092212 217
242 3300003214 JGI25165J46597_1000200 JGI25165J46597_100020017 217
243 3300003316 rootH1_10073558 rootH1_100735583 217
244 3300003762 Ga0055542_1001532 Ga0055542_10015324 217
245 3300005327 Ga0070658_10118806 Ga0070658_101188063 217
246 3300005328 Ga0070676_10106318 Ga0070676_101063182 217
247 3300005347 Ga0070668_100205900 Ga0070668_1002059003 217
248 3300005355 Ga0070671_100132917 Ga0070671_1001329171 217
249 3300005356 Ga0070674_100495958 Ga0070674_1004959582 217
250 3300005455 Ga0070663_100011596 Ga0070663_1000115962 217
251 3300005455 Ga0070663_100098254 Ga0070663_1000982541 217
252 3300005539 Ga0068853_100009930 Ga0068853_1000099304 217
253 3300005539 Ga0068853_100350195 Ga0068853_1003501952 217
254 3300005539 Ga0068853_100677458 Ga0068853_1006774582 217
255 3300005548 Ga0070665_100108420 Ga0070665_1001084204 217
256 3300005548 Ga0070665_100185882 Ga0070665_1001858822 217
257 3300005548 Ga0070665_100237100 Ga0070665_1002371002 217
258 3300005548 Ga0070665_100290385 Ga0070665_1002903854 217
259 3300005548 Ga0070665_101298880 Ga0070665_1012988801 217
260 3300005563 Ga0068855_100201574 Ga0068855_1002015742 217
261 3300005577 Ga0068857_100149324 Ga0068857_1001493242 217
262 3300005578 Ga0068854_100851936 Ga0068854_1008519362 217
263 3300005616 Ga0068852_100041026 Ga0068852_1000410263 217
264 3300005616 Ga0068852_101331911 Ga0068852_1013319111 217
265 3300006038 Ga0075365_10001245 Ga0075365_100012455 217
266 3300006038 Ga0075365_10017425 Ga0075365_100174254 217
267 3300006038 Ga0075365_10027073 Ga0075365_100270734 217
268 3300006042 Ga0075368_10003017 Ga0075368_100030175 217
269 3300006048 Ga0075363_100019864 Ga0075363_1000198642 217
270 3300006177 Ga0075362_10009720 Ga0075362_100097203 217
271 3300006178 Ga0075367_10062397 Ga0075367_100623972 217
272 3300006178 Ga0075367_10082156 Ga0075367_100821562 217
273 3300006186 Ga0075369_10031118 Ga0075369_100311182 217
274 3300006186 Ga0075369_10154024 Ga0075369_101540242 217
275 3300006353 Ga0075370_10019640 Ga0075370_100196402 217
276 3300006353 Ga0075370_10215404 Ga0075370_102154042 217
277 3300009093 Ga0105240_10199733 Ga0105240_101997332 217
278 3300009093 Ga0105240_10302241 Ga0105240_103022412 217
279 3300009148 Ga0105243_10151405 Ga0105243_101514051 217
280 3300009174 Ga0105241_10045348 Ga0105241_100453483 217
281 3300009176 Ga0105242_10390891 Ga0105242_103908912 217
282 3300009177 Ga0105248_10226019 Ga0105248_102260191 217
283 3300009545 Ga0105237_10073454 Ga0105237_100734544 217
284 3300009551 Ga0105238_10033160 Ga0105238_100331604 217
285 3300009551 Ga0105238_10204910 Ga0105238_102049103 217
286 3300009551 Ga0105238_10434609 Ga0105238_104346092 217
287 3300009551 Ga0105238_10514947 Ga0105238_105149472 217
288 3300009553 Ga0105249_10608768 Ga0105249_106087682 217
289 3300010375 Ga0105239_10078115 Ga0105239_100781154 217
290 3300010375 Ga0105239_10110564 Ga0105239_101105644 217
291 3300010375 Ga0105239_10170046 Ga0105239_101700461 217
292 3300010375 Ga0105239_10561373 Ga0105239_105613733 217
293 3300013105 Ga0157369_10111816 Ga0157369_101118162 217
294 3300013296 Ga0157374_10215152 Ga0157374_102151522 217
295 3300013296 Ga0157374_10384177 Ga0157374_103841772 217
296 3300013307 Ga0157372_10241133 Ga0157372_102411332 217
297 3300014497 Ga0182008_10216725 Ga0182008_102167252 217
298 3300014968 Ga0157379_10408221 Ga0157379_104082211 217
299 3300014969 Ga0157376_10331177 Ga0157376_103311772 217
300 3300015261 Ga0182006_1086888 Ga0182006_10868881 217
301 3300017792 Ga0163161_10441688 Ga0163161_104416882 217
302 3300025250 Ga0209026_1000024 Ga0209026_1000024337 217
303 3300025254 Ga0209148_1000050 Ga0209148_100005026 217
304 3300025256 Ga0209759_1000302 Ga0209759_100030259 217
305 3300025261 Ga0209233_1000027 Ga0209233_100002774 217
306 3300025261 Ga0209233_1011519 Ga0209233_10115193 217
307 3300025272 Ga0209455_1000507 Ga0209455_100050726 217
308 3300025297 Ga0209758_1047261 Ga0209758_10472612 217
309 3300025904 Ga0207647_10386995 Ga0207647_103869951 217
310 3300025909 Ga0207705_10084423 Ga0207705_100844232 217
311 3300025911 Ga0207654_10027942 Ga0207654_100279423 217
312 3300025913 Ga0207695_10238458 Ga0207695_102384583 217
313 3300025913 Ga0207695_10581802 Ga0207695_105818022 217
314 3300025914 Ga0207671_10130205 Ga0207671_101302051 217
315 3300025919 Ga0207657_10100140 Ga0207657_101001403 217
316 3300025919 Ga0207657_10108925 Ga0207657_101089251 217
317 3300025924 Ga0207694_10018412 Ga0207694_100184123 217
318 3300025927 Ga0207687_10220373 Ga0207687_102203732 217
319 3300025949 Ga0207667_10465096 Ga0207667_104650962 217
320 3300025961 Ga0207712_10884538 Ga0207712_108845381 217
321 3300026041 Ga0207639_10410115 Ga0207639_104101152 217
322 3300026041 Ga0207639_10479025 Ga0207639_104790252 217
323 3300026067 Ga0207678_10022085 Ga0207678_100220857 217
324 3300026067 Ga0207678_10065457 Ga0207678_100654574 217
325 3300026067 Ga0207678_10065600 Ga0207678_100656004 217
326 3300026089 Ga0207648_10319806 Ga0207648_103198063 217
327 3300026121 Ga0207683_10304906 Ga0207683_103049062 217
328 3300026142 Ga0207698_10097652 Ga0207698_100976522 217
329 3300028379 Ga0268266_10064627 Ga0268266_100646272 217
330 3300028379 Ga0268266_10272703 Ga0268266_102727033 217
331 3300028379 Ga0268266_10417406 Ga0268266_104174062 217
332 3300028379 Ga0268266_10827412 Ga0268266_108274121 217
333 3300028794 Ga0307515_10366266 Ga0307515_103662662 217
334 3300031911 Ga0307412_10230019 Ga0307412_102300193 217
335 3300037312 Ga0395899_0000213 Ga0395899_0000213_65263_65916 217
336 3300037312 Ga0395899_0556596 Ga0395899_0556596_13_666 217
337 3300037418 Ga0395900_0000121 Ga0395900_0000121_116886_117539 217
338 3300037418 Ga0395900_0279656 Ga0395900_0279656_666_1319 217
339 3300037418 Ga0395900_0291315 Ga0395900_0291315_752_1405 217
340 3300037418 Ga0395900_0402607 Ga0395900_0402607_656_1309 217
341 3300037466 Ga0395898_0000247 Ga0395898_0000247_17488_18141 217
342 3300037466 Ga0395898_0091534 Ga0395898_0091534_305_958 217
343 3300037466 Ga0395898_0198229 Ga0395898_0198229_926_1579 217
344 3300037471 Ga0395905_0000112 Ga0395905_0000112_17472_18125 217
345 3300037471 Ga0395905_0177489 Ga0395905_0177489_207_860 217
346 3300037471 Ga0395905_0267307 Ga0395905_0267307_188_841 217
347 3300038443 Ga0395901_0000078 Ga0395901_0000078_116886_117539 217
348 3300038443 Ga0395901_0119893 Ga0395901_0119893_255_908 217
349 3300038443 Ga0395901_0139805 Ga0395901_0139805_1636_2289 217
350 3300038443 Ga0395901_0168403 Ga0395901_0168403_591_1244 217
351 3300038443 Ga0395901_0365856 Ga0395901_0365856_595_1248 217
352 3300038443 Ga0395901_0951639 Ga0395901_0951639_13_666 217
353 3300044658 Ga0466972_0052681 Ga0466972_0052681_166_819 217
354 3300046460 Ga0495638_0063031 Ga0495638_0063031_1181_1834 217
355 3300046460 Ga0495638_0144602 Ga0495638_0144602_594_1247 217
356 3300046616 Ga0495668_0087894 Ga0495668_0087894_164_817 217
357 3300048905 Ga0496102_0737644 Ga0496102_0737644_233_886 217
358 3300048915 Ga0496112_0128498 Ga0496112_0128498_1009_1662 217
359 3300048918 Ga0496115_0093064 Ga0496115_0093064_1411_2064 217
360 3300048921 Ga0496118_0205075 Ga0496118_0205075_479_1132 217
361 3300048922 Ga0496119_0052211 Ga0496119_0052211_1683_2336 217
362 3300048922 Ga0496119_0126717 Ga0496119_0126717_707_1360 217
363 3300048923 Ga0496120_0000863 Ga0496120_0000863_38689_39342 217
364 3300048923 Ga0496120_0140191 Ga0496120_0140191_173_826 217
365 3300048923 Ga0496120_0256656 Ga0496120_0256656_64_717 217
366 3300048924 Ga0496121_0072153 Ga0496121_0072153_474_1127 217
367 3300048928 Ga0496125_0072308 Ga0496125_0072308_52_705 217
368 3300048929 Ga0496126_0032383 Ga0496126_0032383_837_1490 217
369 3300049568 Ga0501031_0000019 Ga0501031_0000019_96320_96973 217
370 3300049568 Ga0501031_0022870 Ga0501031_0022870_1064_1720 217
371 3300049568 Ga0501031_0026496 Ga0501031_0026496_2615_3268 217
372 3300049568 Ga0501031_0272774 Ga0501031_0272774_198_851 217
373 3300049569 Ga0501032_0000009 Ga0501032_0000009_31015_31668 217
374 3300049569 Ga0501032_0002799 Ga0501032_0002799_1429_2085 217
375 3300049569 Ga0501032_0014482 Ga0501032_0014482_1616_2269 217
376 3300049569 Ga0501032_0033159 Ga0501032_0033159_1288_1944 217
377 3300049569 Ga0501032_0189522 Ga0501032_0189522_77_733 217
378 3300049569 Ga0501032_0285994 Ga0501032_0285994_231_887 217
379 3300049570 Ga0501033_0000019 Ga0501033_0000019_196440_197093 217
380 3300049570 Ga0501033_0001826 Ga0501033_0001826_11185_11841 217
381 3300049570 Ga0501033_0033623 Ga0501033_0033623_1648_2304 217
382 3300049570 Ga0501033_0041587 Ga0501033_0041587_1540_2193 217
383 3300049570 Ga0501033_0089761 Ga0501033_0089761_731_1387 217
384 3300049570 Ga0501033_0108213 Ga0501033_0108213_721_1374 217
385 3300049570 Ga0501033_0448384 Ga0501033_0448384_136_789 217
386 3300049571 Ga0501034_0000044 Ga0501034_0000044_31015_31668 217
387 3300049571 Ga0501034_0001700 Ga0501034_0001700_22929_23582 217
388 3300049571 Ga0501034_0022422 Ga0501034_0022422_2571_3230 217
389 3300049571 Ga0501034_0042922 Ga0501034_0042922_922_1575 217
390 3300049571 Ga0501034_0096699 Ga0501034_0096699_1480_2133 217
391 3300049571 Ga0501034_0139770 Ga0501034_0139770_1427_2080 217
392 3300049571 Ga0501034_0252802 Ga0501034_0252802_332_985 217
393 3300049572 Ga0501036_0000008 Ga0501036_0000008_31015_31668 217
394 3300049572 Ga0501036_0038867 Ga0501036_0038867_197_850 217
395 3300049572 Ga0501036_0263479 Ga0501036_0263479_343_999 217
396 3300049572 Ga0501036_0418953 Ga0501036_0418953_43_696 217
397 3300049573 Ga0501037_0000086 Ga0501037_0000086_53752_54405 217
398 3300049573 Ga0501037_0000216 Ga0501037_0000216_5325_5981 217
399 3300049573 Ga0501037_0050229 Ga0501037_0050229_332_985 217
400 3300049574 Ga0501038_0000006 Ga0501038_0000006_31015_31668 217
401 3300049574 Ga0501038_0068819 Ga0501038_0068819_1142_1798 217
402 3300049574 Ga0501038_0323982 Ga0501038_0323982_247_903 217
403 3300049575 Ga0501039_0000014 Ga0501039_0000014_196440_197093 217
404 3300049575 Ga0501039_0090199 Ga0501039_0090199_727_1380 217
405 3300049576 Ga0501040_0012588 Ga0501040_0012588_4806_5459 217
406 3300049576 Ga0501040_0014403 Ga0501040_0014403_3680_4333 217
407 3300049578 Ga0501042_0438572 Ga0501042_0438572_138_791 217
408 3300049579 Ga0501043_0000132 Ga0501043_0000132_36970_37626 217
409 3300049579 Ga0501043_0000399 Ga0501043_0000399_25689_26342 217
410 3300049579 Ga0501043_0106869 Ga0501043_0106869_1508_2164 217
411 3300049579 Ga0501043_0145264 Ga0501043_0145264_99_752 217
412 3300049579 Ga0501043_0331326 Ga0501043_0331326_241_897 217
413 3300049580 Ga0501046_0021894 Ga0501046_0021894_4105_4758 217
414 3300049581 Ga0501047_0003906 Ga0501047_0003906_5806_6459 217
415 3300049581 Ga0501047_0015048 Ga0501047_0015048_4105_4758 217
416 3300049581 Ga0501047_0030572 Ga0501047_0030572_2459_3115 217
417 3300049581 Ga0501047_0093812 Ga0501047_0093812_1773_2429 217
418 3300049581 Ga0501047_0143026 Ga0501047_0143026_979_1635 217
419 3300049581 Ga0501047_0186038 Ga0501047_0186038_822_1478 217
420 3300049581 Ga0501047_0294214 Ga0501047_0294214_596_1252 217
421 3300049581 Ga0501047_0407115 Ga0501047_0407115_527_1180 217
422 3300049582 Ga0501048_0035654 Ga0501048_0035654_2123_2776 217
423 3300049583 Ga0501067_0077890 Ga0501067_0077890_58_711 217
424 3300049583 Ga0501067_0087583 Ga0501067_0087583_281_934 217
425 3300049584 Ga0501068_0005109 Ga0501068_0005109_2627_3283 217
426 3300049584 Ga0501068_0020874 Ga0501068_0020874_2344_2997 217
427 3300049585 Ga0501069_0000051 Ga0501069_0000051_44968_45624 217
428 3300049585 Ga0501069_0004367 Ga0501069_0004367_2988_3644 217
429 3300049585 Ga0501069_0160528 Ga0501069_0160528_513_1169 217
430 3300049586 Ga0501070_0000291 Ga0501070_0000291_14770_15426 217
431 3300049586 Ga0501070_0007121 Ga0501070_0007121_6444_7100 217
432 3300049586 Ga0501070_0015231 Ga0501070_0015231_1233_1889 217
433 3300049586 Ga0501070_0034751 Ga0501070_0034751_1735_2391 217
434 3300049586 Ga0501070_0118450 Ga0501070_0118450_1373_2026 217
435 3300049586 Ga0501070_0179483 Ga0501070_0179483_927_1583 217
436 3300049586 Ga0501070_0230029 Ga0501070_0230029_98_751 217
437 3300049586 Ga0501070_0263122 Ga0501070_0263122_643_1296 217
438 3300049586 Ga0501070_0299795 Ga0501070_0299795_554_1210 217
439 3300049587 Ga0501071_0015403 Ga0501071_0015403_2906_3562 217
440 3300049587 Ga0501071_0802678 Ga0501071_0802678_30_686 217
441 3300049588 Ga0501072_0218045 Ga0501072_0218045_770_1423 217
442 3300049589 Ga0501073_0032551 Ga0501073_0032551_2080_2733 217
443 3300049589 Ga0501073_0050354 Ga0501073_0050354_1640_2296 217
444 3300049589 Ga0501073_0087656 Ga0501073_0087656_168_824 217
445 3300049589 Ga0501073_0477383 Ga0501073_0477383_14_670 217
446 3300049590 Ga0501074_0000043 Ga0501074_0000043_32052_32708 217
447 3300049590 Ga0501074_0009315 Ga0501074_0009315_4715_5371 217
448 3300049741 Ga0501079_0061425 Ga0501079_0061425_1346_2002 217
449 3300049742 Ga0501080_0000551 Ga0501080_0000551_11974_12630 217
450 3300049742 Ga0501080_0020408 Ga0501080_0020408_811_1467 217
451 3300049742 Ga0501080_0050737 Ga0501080_0050737_2878_3531 217
452 3300049742 Ga0501080_0060263 Ga0501080_0060263_422_1078 217
453 3300049742 Ga0501080_0101326 Ga0501080_0101326_11_667 217
454 3300049742 Ga0501080_0582088 Ga0501080_0582088_296_952 217
455 3300049744 Ga0501083_0008038 Ga0501083_0008038_4241_4897 217
456 3300049744 Ga0501083_0038990 Ga0501083_0038990_496_1149 217
457 3300049822 Ga0501035_0000151 Ga0501035_0000151_31015_31668 217
458 3300049822 Ga0501035_0000280 Ga0501035_0000280_32530_33186 217
459 3300049822 Ga0501035_0001157 Ga0501035_0001157_18857_19513 217
460 3300049822 Ga0501035_0002892 Ga0501035_0002892_6348_7004 217
461 3300049822 Ga0501035_0018864 Ga0501035_0018864_1185_1841 217
462 3300049822 Ga0501035_0024938 Ga0501035_0024938_3511_4164 217
463 3300049822 Ga0501035_0040203 Ga0501035_0040203_80_736 217
464 3300049822 Ga0501035_0209746 Ga0501035_0209746_614_1285 217
465 3300049822 Ga0501035_0491065 Ga0501035_0491065_345_1001 217
466 3300049822 Ga0501035_0556968 Ga0501035_0556968_65_718 217
467 3300049823 Ga0501044_0000017 Ga0501044_0000017_196440_197093 217
468 3300049823 Ga0501044_0000037 Ga0501044_0000037_152223_152879 217
469 3300049823 Ga0501044_0004973 Ga0501044_0004973_6791_7447 217
470 3300049823 Ga0501044_0035619 Ga0501044_0035619_1063_1719 217
471 3300049823 Ga0501044_0155401 Ga0501044_0155401_1004_1660 217
472 3300049823 Ga0501044_0286633 Ga0501044_0286633_428_1084 217
473 3300049823 Ga0501044_0310599 Ga0501044_0310599_776_1429 217
474 3300049824 Ga0501045_0009380 Ga0501045_0009380_1113_1766 217
475 3300050490 nmdc:mga03n38_89724_c1 nmdc:mga03n38_89724_c1_788_1441 217
476 3300050492 nmdc:mga0yw44_19582_c1 nmdc:mga0yw44_19582_c1_585_1238 217
477 3300050492 nmdc:mga0yw44_3641_c1 nmdc:mga0yw44_3641_c1_3966_4619 217
478 3300050494 nmdc:mga06z11_29762_c1 nmdc:mga06z11_29762_c1_301_954 217
479 3300050495 nmdc:mga04h51_20364_c1 nmdc:mga04h51_20364_c1_600_1253 217
480 3300050496 nmdc:mga07m45_36780_c1 nmdc:mga07m45_36780_c1_165_818 217
481 3300053079 Ga0500610_0148173 Ga0500610_0148173_280_933 217
482 3300053134 Ga0500658_0240760 Ga0500658_0240760_132_785 217
483 3300053139 Ga0500568_0000062 Ga0500568_0000062_29444_30097 217
484 3300053139 Ga0500568_0057481 Ga0500568_0057481_451_1104 217
485 3300053151 Ga0500604_0054123 Ga0500604_0054123_283_936 217
486 3300053153 Ga0500616_0012215 Ga0500616_0012215_619_1272 217
487 3300053153 Ga0500616_0090819 Ga0500616_0090819_369_1022 217
488 3300053155 Ga0500620_000229 Ga0500620_000229_8859_9512 217
489 iso_pu_bacteria 2977986579 2977992940 217

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.7378 19 213
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.7219 19 213
2iof-assembly1.cif.gz_K crystal structure of phosphonoacetaldehyde hydrolase with sodium borohydride-reduced substrate intermediate 0.687 17 213
2gfh-assembly1.cif.gz_A crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution 0.6756 18 217
4knv-assembly2.cif.gz_B the crystal structure of apo human hdhd4 from se-mad 0.6743 20 213
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7284 90 209 3.40.50.1000
af_A0A0R0FMC0_55_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7178 95 139 3.40.30.10
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.704 17 211 3.40.50.1000
af_O80568_1_252_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6964 21 213 3.40.50.1000
af_Q8IHP2_65_208_3.40.50.11730 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peroxisome assembly protein 22 0.6955 16 211 3.40.50.11730
ID Description Score Start End GO Terms
AF-A0A527I7T1-F1-model_v4 HAD family hydrolase 0.9984 153 217
AF-A0A436FFP3-F1-model_v4 HAD family hydrolase 0.9954 47 217
AF-A0A531K478-F1-model_v4 HAD family hydrolase 0.9936 91 215
AF-A0A3S1Q7A2-F1-model_v4 HAD family hydrolase 0.9866 76 217
AF-A0A436FFP3-F1-model_v4 HAD family hydrolase 0.984 47 217

Feature Viewer

pLDDT pTM Quality
92.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map