F453671

General Info

Members Datasets Scaffolds Average Seq Length
488 225 976 172

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0074358|Ga0495686_0074358_1284_1892
Length 202
Sequence LHALPKPRRIRYPGHPALFSPTFYRLFTTDMSNDIPAAANAAPEEKLSHFDATGQAHMVDVGAKNETHRVAVAAGSIRMKPETLAIILAGTAKKGDVLGIARIAAIMASKRTSDLIPLCHPLALTRVTVDFETDPAHSKVHCKAQVETFGKTGVEMEALTAVQVGLLTIYDMCKAVDRGMVMSDVRVLEKHGGKSGDWTAAV

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
49 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
97 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
98 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
192 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
193 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
208 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
209 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
210 2643221664 Massilia sp. Root418 Isolate Unclassified
211 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
212 2842711865 Duganella sp. R-73148 Isolate Unclassified
213 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
214 2857553236 Duganella sp. R-74557 Isolate Unclassified
215 2857558681 Duganella sp. R-74565 Isolate Unclassified
216 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
217 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
218 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
219 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
220 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
221 2904424332 Duganella sp. 1411 Isolate Rhizosphere
222 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
223 2919476304 Duganella sp. 3397 Isolate Unclassified
224 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
225 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 1.43
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 1.23
Rhizoplane 3.07
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0074358 3300047472 Bacteria 2085
2 JGI25155J39150_1000142 3300002704 Bacteria 33693
3 JGI25155J39150_1000395 3300002704 Bacteria 12272
4 JGI25156J39149_1001097 3300002705 Bacteria 12362
5 JGI25156J39149_1003611 3300002705 Bacteria 4988
6 JGI25162J39368_1004783 3300002737 Bacteria 2962
7 JGI25154J39366_1000269 3300002738 Bacteria 32398
8 JGI25154J39366_1000916 3300002738 Bacteria 12399
9 JGI25154J39366_1000927 3300002738 Bacteria 12255
10 JGI25157J39369_1000203 3300002741 Bacteria 49480
11 JGI25159J45721_1005685 3300002987 Bacteria 3867
12 rootL2_10015446 3300003322 Bacteria 3528
13 Ga0055532_1000005 3300003758 Bacteria 458107
14 Ga0055542_1005705 3300003762 Bacteria 2761
15 Ga0055526_1000856 3300003771 Bacteria 22650
16 Ga0055526_1001774 3300003771 Bacteria 14988
17 Ga0055537_1000496 3300003773 Bacteria 23957
18 Ga0055524_1000027 3300003775 Bacteria 213655
19 Ga0055524_1001883 3300003775 Bacteria 11402
20 Ga0055534_1000583 3300003784 Bacteria 19177
21 Ga0055528_1000686 3300003790 Bacteria 24151
22 Ga0055543_1002543 3300004625 Bacteria 5951
23 Ga0065165_1000298 3300005262 Bacteria 83243
24 Ga0065165_1042202 3300005262 Bacteria 1348
25 Ga0065714_10270173 3300005288 Bacteria 733
26 Ga0070658_10720144 3300005327 Bacteria 866
27 Ga0070683_101031234 3300005329 Bacteria 790
28 Ga0070670_101410085 3300005331 Bacteria 639
29 Ga0070660_100035030 3300005339 Bacteria 3797
30 Ga0070660_100733062 3300005339 Bacteria 829
31 Ga0070660_100812846 3300005339 Bacteria 786
32 Ga0070661_100011877 3300005344 Bacteria 6077
33 Ga0070659_100021256 3300005366 Bacteria 4938
34 Ga0070662_100172477 3300005457 Bacteria 1699
35 Ga0070662_100797626 3300005457 Bacteria 803
36 Ga0070664_100019392 3300005564 Bacteria 5596
37 Ga0070664_100031999 3300005564 Bacteria 4399
38 Ga0068854_100832314 3300005578 Bacteria 807
39 Ga0068856_100051505 3300005614 Bacteria 4059
40 Ga0068856_100594160 3300005614 Bacteria 1128
41 Ga0068852_100029429 3300005616 Bacteria 4512
42 Ga0068852_100152219 3300005616 Bacteria 2152
43 Ga0068852_100403907 3300005616 Bacteria 1344
44 Ga0079104_1012368 3300006946 Bacteria 2688
45 Ga0099826_10000003 3300006948 Bacteria 1067817
46 Ga0105251_10136420 3300009011 Bacteria 1111
47 Ga0105244_10003849 3300009036 Bacteria 10573
48 Ga0105244_10030050 3300009036 Bacteria 2895
49 Ga0105240_10014863 3300009093 Bacteria 10610
50 Ga0105240_10026065 3300009093 Bacteria 7675
51 Ga0105245_11307606 3300009098 Bacteria 774
52 Ga0105241_10018382 3300009174 Bacteria 5142
53 Ga0105241_10559476 3300009174 Bacteria 1028
54 Ga0105242_10057488 3300009176 Bacteria 3186
55 Ga0105238_10084913 3300009551 Bacteria 3155
56 Ga0157373_10091024 3300013100 Bacteria 2148
57 Ga0157371_10000399 3300013102 Bacteria 54380
58 Ga0157372_11524936 3300013307 Bacteria 770
59 Ga0182008_10002256 3300014497 Bacteria 12170
60 Ga0182008_10064164 3300014497 Bacteria 1808
61 Ga0182006_1000010 3300015261 Bacteria 413414
62 Ga0182006_1000055 3300015261 Bacteria 173139
63 Ga0182006_1002330 3300015261 Bacteria 10445
64 Ga0182007_10000030 3300015262 Bacteria 156866
65 Ga0182007_10045067 3300015262 Bacteria 1462
66 Ga0182005_1000003 3300015265 Bacteria 683269
67 Ga0182005_1000009 3300015265 Bacteria 455334
68 Ga0163161_10013299 3300017792 Bacteria 5723
69 Ga0163161_10081316 3300017792 Bacteria 2385
70 Ga0163161_10110000 3300017792 Bacteria 2059
71 Ga0213872_10014596 3300021361 Bacteria 3662
72 Ga0209435_100004 3300025206 Bacteria 633417
73 Ga0209435_101309 3300025206 Bacteria 3249
74 Ga0209147_100011 3300025229 Bacteria 702140
75 Ga0209437_100084 3300025233 Bacteria 255423
76 Ga0209258_100677 3300025242 Bacteria 23853
77 Ga0209646_1000032 3300025246 Bacteria 375315
78 Ga0209646_1000104 3300025246 Bacteria 163824
79 Ga0209646_1000372 3300025246 Bacteria 29735
80 Ga0209026_1000062 3300025250 Bacteria 213298
81 Ga0209026_1001169 3300025250 Bacteria 12187
82 Ga0209026_1010266 3300025250 Bacteria 1759
83 Ga0209148_1000272 3300025254 Bacteria 81330
84 Ga0209759_1000126 3300025256 Bacteria 134208
85 Ga0209759_1001426 3300025256 Bacteria 13562
86 Ga0209565_1000006 3300025263 Bacteria 897294
87 Ga0209455_1001769 3300025272 Bacteria 9154
88 Ga0209673_1000004 3300025273 Bacteria 896155
89 Ga0209130_1000067 3300025284 Bacteria 184277
90 Ga0209675_1000006 3300025291 Bacteria 732267
91 Ga0209564_1000006 3300025295 Bacteria 1100927
92 Ga0209564_1000102 3300025295 Bacteria 222597
93 Ga0209564_1037282 3300025295 Bacteria 1373
94 Ga0209256_1000013 3300025299 Bacteria 689442
95 Ga0209256_1000037 3300025299 Bacteria 377661
96 Ga0207655_1003237 3300025728 Bacteria 12229
97 Ga0207705_10004801 3300025909 Bacteria 10175
98 Ga0207654_10028705 3300025911 Bacteria 3035
99 Ga0207654_10552261 3300025911 Bacteria 818
100 Ga0207695_10010353 3300025913 Bacteria 11414
101 Ga0207695_10045891 3300025913 Bacteria 4634
102 Ga0207657_10014498 3300025919 Bacteria 7690
103 Ga0207657_10325443 3300025919 Bacteria 1215
104 Ga0207649_10056149 3300025920 Bacteria 2457
105 Ga0207649_10759243 3300025920 Bacteria 755
106 Ga0207694_10105313 3300025924 Bacteria 2239
107 Ga0207694_10107858 3300025924 Bacteria 2213
108 Ga0207650_10033202 3300025925 Bacteria 3736
109 Ga0207687_10163670 3300025927 Bacteria 1710
110 Ga0207690_10645057 3300025932 Bacteria 867
111 Ga0207706_10460766 3300025933 Bacteria 1099
112 Ga0207686_10001803 3300025934 Bacteria 11906
113 Ga0207679_10023661 3300025945 Bacteria 4203
114 Ga0207667_10012547 3300025949 Bacteria 9752
115 Ga0207667_10634968 3300025949 Bacteria 1075
116 Ga0207702_10105331 3300026078 Bacteria 2498
117 Ga0207698_10255429 3300026142 Bacteria 1606
118 Ga0209281_1002340 3300027111 Bacteria 7848
119 Ga0209282_1000002 3300027666 Bacteria 1067825
120 Ga0307408_100000180 3300031548 Bacteria 70740
121 Ga0265314_10022091 3300031711 Bacteria 4878
122 Ga0307516_10268595 3300031730 Bacteria 1393
123 Ga0316577_10240330 3300031733 Bacteria 1024
124 Ga0307411_10409993 3300032005 Bacteria 1123
125 Ga0395899_0001205 3300037312 Bacteria 22711
126 Ga0395899_0009464 3300037312 Bacteria 7478
127 Ga0395899_0023657 3300037312 Bacteria 4650
128 Ga0395899_0231230 3300037312 Bacteria 1276
129 Ga0395900_0001494 3300037418 Bacteria 27808
130 Ga0395900_0003169 3300037418 Bacteria 17834
131 Ga0395900_0013160 3300037418 Bacteria 8456
132 Ga0395900_0051861 3300037418 Bacteria 4224
133 Ga0395900_0133567 3300037418 Bacteria 2542
134 Ga0395898_0060198 3300037466 Bacteria 3691
135 Ga0395898_0503857 3300037466 Bacteria 1151
136 Ga0395898_0979958 3300037466 Bacteria 782
137 Ga0395905_0000137 3300037471 Bacteria 120800
138 Ga0395905_0030165 3300037471 Bacteria 5111
139 Ga0395905_0030268 3300037471 Bacteria 5102
140 Ga0395905_0064404 3300037471 Bacteria 3430
141 Ga0395905_0269218 3300037471 Bacteria 1589
142 Ga0395901_0000307 3300038443 Bacteria 60012
143 Ga0395901_0003234 3300038443 Bacteria 16383
144 Ga0395901_0113572 3300038443 Bacteria 2844
145 Ga0395901_0341930 3300038443 Bacteria 1546
146 Ga0395901_0573862 3300038443 Bacteria 1140
147 Ga0436361_0458337 3300039447 Bacteria 9586
148 Ga0436361_0473376 3300039447 Bacteria 896
149 Ga0436361_0557562 3300039447 Bacteria 2186
150 Ga0436361_0679339 3300039447 Bacteria 13827
151 Ga0439465_0125793 3300041413 Bacteria 902
152 Ga0451807_1924016 3300041486 Bacteria 561
153 Ga0451853_1582642 3300041512 Bacteria 1218
154 Ga0439448_0003795 3300042005 Bacteria 4217
155 Ga0439449_0014769 3300042007 Bacteria 2934
156 Ga0439450_001845 3300042008 Bacteria 3202
157 Ga0439455_0005011 3300042012 Bacteria 2665
158 Ga0439462_0192366 3300042015 Bacteria 580
159 Ga0450911_039905 3300042115 Bacteria 610
160 Ga0466972_0000029 3300044658 Bacteria 165236
161 Ga0466972_0191332 3300044658 Bacteria 959
162 Ga0466972_0391260 3300044658 Bacteria 651
163 Ga0466975_0325147 3300044661 Bacteria 977
164 Ga0466965_0015972 3300044683 Bacteria 3567
165 Ga0466965_0036714 3300044683 Bacteria 2404
166 Ga0466965_0039372 3300044683 Bacteria 2323
167 Ga0466965_0039643 3300044683 Bacteria 2316
168 Ga0466966_0005719 3300044684 Bacteria 8185
169 Ga0466961_0046133 3300044693 Bacteria 2787
170 Ga0466963_0180235 3300044694 Bacteria 1475
171 Ga0466964_0007359 3300044706 Bacteria 4115
172 Ga0466964_0012044 3300044706 Bacteria 3271
173 Ga0466971_0000925 3300044719 Bacteria 12051
174 Ga0466968_0012235 3300044735 Bacteria 3353
175 Ga0466968_0050065 3300044735 Bacteria 1781
176 Ga0466968_0055268 3300044735 Bacteria 1703
177 Ga0466968_0105893 3300044735 Bacteria 1260
178 Ga0466957_0004693 3300044842 Bacteria 7645
179 Ga0466957_0016698 3300044842 Bacteria 4294
180 Ga0466957_0540786 3300044842 Bacteria 811
181 Ga0466959_0057149 3300045049 Bacteria 2845
182 Ga0466958_0026209 3300045836 Bacteria 3444
183 Ga0466958_0033934 3300045836 Bacteria 3042
184 Ga0466958_0173371 3300045836 Bacteria 1366
185 Ga0466967_0025444 3300045976 Bacteria 4882
186 Ga0466967_0344147 3300045976 Bacteria 1442
187 Ga0466967_1024508 3300045976 Bacteria 822
188 Ga0495617_000189 3300046452 Bacteria 38970
189 Ga0495617_001998 3300046452 Bacteria 8498
190 Ga0495617_005256 3300046452 Bacteria 4607
191 Ga0495617_016745 3300046452 Bacteria 2479
192 Ga0495627_000065 3300046453 Bacteria 132414
193 Ga0495590_0000023 3300046457 Bacteria 196939
194 Ga0495590_0010408 3300046457 Bacteria 3499
195 Ga0495590_0024388 3300046457 Bacteria 2131
196 Ga0495638_0000067 3300046460 Bacteria 167869
197 Ga0495638_0016796 3300046460 Bacteria 4895
198 Ga0495638_0097989 3300046460 Bacteria 1757
199 Ga0495638_0128569 3300046460 Bacteria 1491
200 Ga0495653_0025786 3300046463 Bacteria 4717
201 Ga0495650_0000056 3300046471 Bacteria 307565
202 Ga0495650_0000263 3300046471 Bacteria 101749
203 Ga0495650_0002963 3300046471 Bacteria 12848
204 Ga0495650_0003947 3300046471 Bacteria 10451
205 Ga0495605_0000276 3300046474 Bacteria 57745
206 Ga0495605_0009182 3300046474 Bacteria 5560
207 Ga0495605_0249701 3300046474 Bacteria 759
208 Ga0495639_0002664 3300046475 Bacteria 7753
209 Ga0495639_0372808 3300046475 Bacteria 719
210 Ga0495584_0001049 3300046491 Bacteria 17218
211 Ga0495584_0005815 3300046491 Bacteria 6499
212 Ga0495584_0021950 3300046491 Bacteria 3241
213 Ga0495584_0054351 3300046491 Bacteria 2015
214 Ga0495584_0176953 3300046491 Bacteria 1084
215 Ga0495584_0278336 3300046491 Bacteria 850
216 Ga0495585_0000231 3300046492 Bacteria 57572
217 Ga0495585_0031084 3300046492 Bacteria 3034
218 Ga0495585_0071330 3300046492 Bacteria 1893
219 Ga0495596_0000167 3300046500 Bacteria 46189
220 Ga0495596_0052524 3300046500 Bacteria 1595
221 Ga0495607_0011135 3300046501 Bacteria 6005
222 Ga0495607_0016529 3300046501 Bacteria 4759
223 Ga0495607_0026695 3300046501 Bacteria 3581
224 Ga0495607_0028071 3300046501 Bacteria 3475
225 Ga0495607_0036845 3300046501 Bacteria 2943
226 Ga0495607_0045340 3300046501 Bacteria 2587
227 Ga0495607_0056481 3300046501 Bacteria 2254
228 Ga0495607_0088920 3300046501 Bacteria 1677
229 Ga0495583_0000004 3300046506 Bacteria 655287
230 Ga0495583_0001039 3300046506 Bacteria 31364
231 Ga0495583_0001894 3300046506 Bacteria 19369
232 Ga0495583_0033981 3300046506 Bacteria 2447
233 Ga0495583_0069729 3300046506 Bacteria 1547
234 Ga0495583_0187153 3300046506 Bacteria 845
235 Ga0495583_0350472 3300046506 Bacteria 582
236 Ga0495606_0003815 3300046507 Bacteria 15649
237 Ga0495606_0004147 3300046507 Bacteria 14690
238 Ga0495606_0005471 3300046507 Bacteria 12158
239 Ga0495606_0006376 3300046507 Bacteria 10904
240 Ga0495606_0006946 3300046507 Bacteria 10294
241 Ga0495606_0225127 3300046507 Bacteria 1054
242 Ga0495610_0003777 3300046512 Bacteria 11568
243 Ga0495610_0005340 3300046512 Bacteria 9169
244 Ga0495610_0015389 3300046512 Bacteria 4447
245 Ga0495610_0023355 3300046512 Bacteria 3365
246 Ga0495616_0001343 3300046513 Bacteria 17155
247 Ga0495616_0008057 3300046513 Bacteria 6275
248 Ga0495616_0013054 3300046513 Bacteria 4697
249 Ga0495616_0022213 3300046513 Bacteria 3427
250 Ga0495616_0067730 3300046513 Bacteria 1734
251 Ga0495616_0067879 3300046513 Bacteria 1732
252 Ga0495631_0011928 3300046518 Bacteria 4260
253 Ga0495631_0107258 3300046518 Bacteria 1201
254 Ga0495632_0017005 3300046519 Bacteria 4028
255 Ga0495632_0056040 3300046519 Bacteria 1928
256 Ga0495637_0003972 3300046520 Bacteria 7734
257 Ga0495637_0073982 3300046520 Bacteria 1369
258 Ga0495643_0001210 3300046522 Bacteria 24993
259 Ga0495643_0004013 3300046522 Bacteria 10513
260 Ga0495643_0004026 3300046522 Bacteria 10484
261 Ga0495643_0021580 3300046522 Bacteria 3692
262 Ga0495643_0025864 3300046522 Bacteria 3318
263 Ga0495643_0132841 3300046522 Bacteria 1248
264 Ga0495643_0352618 3300046522 Bacteria 659
265 Ga0495644_0007529 3300046523 Bacteria 4198
266 Ga0495644_0031876 3300046523 Bacteria 1992
267 Ga0495644_0126036 3300046523 Bacteria 975
268 Ga0495648_0000008 3300046524 Bacteria 336584
269 Ga0495648_0000305 3300046524 Bacteria 54610
270 Ga0495648_0001823 3300046524 Bacteria 20505
271 Ga0495648_0019633 3300046524 Bacteria 4742
272 Ga0495648_0026089 3300046524 Bacteria 3940
273 Ga0495663_0061663 3300046525 Bacteria 1180
274 Ga0495663_0109386 3300046525 Bacteria 917
275 Ga0495642_0001255 3300046528 Bacteria 11589
276 Ga0495642_0001811 3300046528 Bacteria 9165
277 Ga0495642_0031718 3300046528 Bacteria 2119
278 Ga0495642_0114741 3300046528 Bacteria 1153
279 Ga0495654_0010890 3300046530 Bacteria 4941
280 Ga0495654_0027988 3300046530 Bacteria 2885
281 Ga0495598_0042367 3300046537 Bacteria 1336
282 Ga0495609_0005634 3300046538 Bacteria 6531
283 Ga0495609_0006552 3300046538 Bacteria 5931
284 Ga0495609_0006566 3300046538 Bacteria 5924
285 Ga0495609_0026312 3300046538 Bacteria 2665
286 Ga0495609_0032208 3300046538 Bacteria 2382
287 Ga0495597_0002274 3300046542 Bacteria 12481
288 Ga0495597_0002612 3300046542 Bacteria 11210
289 Ga0495597_0015815 3300046542 Bacteria 3570
290 Ga0495597_0043792 3300046542 Bacteria 1992
291 Ga0495597_0048174 3300046542 Bacteria 1885
292 Ga0495597_0070428 3300046542 Bacteria 1507
293 Ga0495645_0636655 3300046543 Bacteria 653
294 Ga0495622_0000959 3300046557 Bacteria 15474
295 Ga0495622_0134743 3300046557 Bacteria 1123
296 Ga0495622_0183198 3300046557 Bacteria 938
297 Ga0495633_0000226 3300046558 Bacteria 69863
298 Ga0495633_0002413 3300046558 Bacteria 13209
299 Ga0495633_0004432 3300046558 Bacteria 8935
300 Ga0495633_0005974 3300046558 Bacteria 7313
301 Ga0495633_0006349 3300046558 Bacteria 7030
302 Ga0495656_0228623 3300046615 Bacteria 933
303 Ga0495656_0443836 3300046615 Bacteria 683
304 Ga0495668_0000008 3300046616 Bacteria 498364
305 Ga0495668_0000347 3300046616 Bacteria 61748
306 Ga0495668_0007806 3300046616 Bacteria 6780
307 Ga0495668_0125038 3300046616 Bacteria 1407
308 Ga0495611_0005101 3300046648 Bacteria 5630
309 Ga0495611_0012290 3300046648 Bacteria 3640
310 Ga0495611_0020794 3300046648 Bacteria 2828
311 Ga0495611_0028585 3300046648 Bacteria 2442
312 Ga0495611_0034284 3300046648 Bacteria 2243
313 Ga0495625_0001253 3300046660 Bacteria 32028
314 Ga0495625_0003583 3300046660 Bacteria 15308
315 Ga0495625_0007426 3300046660 Bacteria 9539
316 Ga0495625_0011500 3300046660 Bacteria 7212
317 Ga0495625_0017353 3300046660 Bacteria 5637
318 Ga0495625_0034572 3300046660 Bacteria 3729
319 Ga0495625_0036805 3300046660 Bacteria 3594
320 Ga0495659_0000738 3300046664 Bacteria 11742
321 Ga0495659_0001117 3300046664 Bacteria 9336
322 Ga0495659_0008182 3300046664 Bacteria 3325
323 Ga0495659_0061991 3300046664 Bacteria 1383
324 Ga0495659_0294514 3300046664 Bacteria 684
325 Ga0495661_0007102 3300046665 Bacteria 7819
326 Ga0495661_0007181 3300046665 Bacteria 7773
327 Ga0495661_0014887 3300046665 Bacteria 5201
328 Ga0495661_0082168 3300046665 Bacteria 1855
329 Ga0495661_0091451 3300046665 Bacteria 1730
330 Ga0495661_0098191 3300046665 Bacteria 1653
331 Ga0495661_0161448 3300046665 Bacteria 1202
332 Ga0495661_0161673 3300046665 Bacteria 1201
333 Ga0495661_0504637 3300046665 Bacteria 576
334 Ga0495588_0000070 3300046674 Bacteria 227611
335 Ga0495588_0080422 3300046674 Bacteria 1701
336 Ga0495623_0016901 3300046679 Bacteria 4712
337 Ga0495669_0002033 3300046684 Bacteria 8292
338 Ga0495669_0022247 3300046684 Bacteria 2753
339 Ga0495670_0002896 3300046691 Bacteria 8452
340 Ga0495670_0007367 3300046691 Bacteria 5408
341 Ga0495670_0032355 3300046691 Bacteria 2601
342 Ga0495670_0036305 3300046691 Bacteria 2455
343 Ga0495670_0082481 3300046691 Bacteria 1639
344 Ga0495670_0316620 3300046691 Bacteria 837
345 Ga0495671_0001726 3300046692 Bacteria 14180
346 Ga0495671_0011653 3300046692 Bacteria 4825
347 Ga0495671_0025444 3300046692 Bacteria 3076
348 Ga0495649_0003538 3300046694 Bacteria 10497
349 Ga0495649_0006786 3300046694 Bacteria 7088
350 Ga0495649_0007681 3300046694 Bacteria 6550
351 Ga0495649_0015847 3300046694 Bacteria 4284
352 Ga0495589_0000175 3300046794 Bacteria 57368
353 Ga0495589_0066121 3300046794 Bacteria 1771
354 Ga0495589_0217962 3300046794 Bacteria 897
355 Ga0495589_0221778 3300046794 Bacteria 888
356 Ga0495660_0000113 3300046810 Bacteria 86593
357 Ga0495660_0001117 3300046810 Bacteria 19163
358 Ga0495660_0002300 3300046810 Bacteria 12251
359 Ga0495660_0003758 3300046810 Bacteria 9312
360 Ga0495660_0021310 3300046810 Bacteria 3712
361 Ga0495660_0096965 3300046810 Bacteria 1523
362 Ga0495636_0000408 3300047318 Bacteria 15998
363 Ga0495636_0048686 3300047318 Bacteria 1771
364 Ga0495636_0111740 3300047318 Bacteria 1203
365 Ga0495636_0316663 3300047318 Bacteria 732
366 Ga0495672_0000035 3300047320 Bacteria 290329
367 Ga0495672_0000708 3300047320 Bacteria 36671
368 Ga0495672_0001524 3300047320 Bacteria 22682
369 Ga0495672_0023241 3300047320 Bacteria 4016
370 Ga0495672_0034391 3300047320 Bacteria 3132
371 Ga0495672_0055040 3300047320 Bacteria 2322
372 Ga0495672_0290457 3300047320 Bacteria 778
373 Ga0495683_0008229 3300047323 Bacteria 5591
374 Ga0495683_0012354 3300047323 Bacteria 4485
375 Ga0495683_0016554 3300047323 Bacteria 3828
376 Ga0495687_000186 3300047443 Bacteria 90747
377 Ga0495687_001662 3300047443 Bacteria 19944
378 Ga0495687_002621 3300047443 Bacteria 14113
379 Ga0495687_003801 3300047443 Bacteria 10651
380 Ga0495687_008618 3300047443 Bacteria 5814
381 Ga0495687_199890 3300047443 Bacteria 635
382 Ga0495675_0114712 3300047444 Bacteria 1680
383 Ga0495677_0002517 3300047445 Bacteria 7174
384 Ga0495677_0030673 3300047445 Bacteria 1956
385 Ga0495679_026461 3300047446 Bacteria 1926
386 Ga0495685_000004 3300047447 Bacteria 115775
387 Ga0495685_071477 3300047447 Bacteria 1161
388 Ga0495673_0000034 3300047469 Bacteria 326920
389 Ga0495681_0002957 3300047470 Bacteria 11975
390 Ga0495681_0003979 3300047470 Bacteria 10171
391 Ga0495681_0029086 3300047470 Bacteria 2833
392 Ga0495681_0119099 3300047470 Bacteria 1135
393 Ga0495686_0000722 3300047472 Bacteria 44277
394 Ga0495686_0001474 3300047472 Bacteria 25598
395 Ga0495686_0007392 3300047472 Bacteria 8242
396 Ga0495686_0042992 3300047472 Bacteria 2868
397 Ga0495686_0124399 3300047472 Bacteria 1534
398 Ga0495626_0001112 3300048091 Bacteria 22702
399 Ga0495626_0387571 3300048091 Bacteria 541
400 Ga0496102_0002399 3300048905 Bacteria 15993
401 Ga0496102_0098615 3300048905 Bacteria 2711
402 Ga0496103_0002408 3300048906 Bacteria 11768
403 Ga0496104_0187061 3300048907 Bacteria 1982
404 Ga0496104_0306061 3300048907 Bacteria 1502
405 Ga0496106_0007599 3300048909 Bacteria 8018
406 Ga0496107_0161297 3300048910 Bacteria 1662
407 Ga0496108_0421892 3300048911 Bacteria 1165
408 Ga0496110_0440482 3300048913 Bacteria 1187
409 Ga0496114_0030524 3300048917 Bacteria 4435
410 Ga0496114_0039752 3300048917 Bacteria 3893
411 Ga0496114_0089957 3300048917 Bacteria 2606
412 Ga0496115_0528917 3300048918 Bacteria 945
413 Ga0496116_0009678 3300048919 Bacteria 8195
414 Ga0496117_0000010 3300048920 Bacteria 611954
415 Ga0496117_0318494 3300048920 Bacteria 816
416 Ga0496118_0000009 3300048921 Bacteria 611954
417 Ga0496118_0130365 3300048921 Bacteria 1616
418 Ga0496121_0006620 3300048924 Bacteria 14278
419 Ga0496121_0010080 3300048924 Bacteria 10722
420 Ga0496121_0021716 3300048924 Bacteria 6273
421 Ga0496121_0022000 3300048924 Bacteria 6211
422 Ga0496121_0066027 3300048924 Bacteria 2940
423 Ga0496122_0001689 3300048925 Bacteria 34233
424 Ga0496122_0003978 3300048925 Bacteria 18853
425 Ga0496122_0014909 3300048925 Bacteria 7481
426 Ga0496123_0000145 3300048926 Bacteria 144475
427 Ga0496123_0004651 3300048926 Bacteria 14248
428 Ga0496123_0103539 3300048926 Bacteria 1648
429 Ga0496124_0076620 3300048927 Bacteria 2760
430 Ga0496125_0028116 3300048928 Bacteria 5084
431 Ga0496125_0034011 3300048928 Bacteria 4499
432 Ga0496125_0044618 3300048928 Bacteria 3745
433 Ga0496125_0108812 3300048928 Bacteria 2014
434 Ga0496125_0156074 3300048928 Bacteria 1559
435 Ga0496125_0186775 3300048928 Bacteria 1373
436 Ga0496126_1003012 3300048929 Bacteria 626
437 Ga0501305_081685 3300049161 Bacteria 582
438 Ga0501305_086496 3300049161 Bacteria 569
439 Ga0495678_000001 3300049459 Bacteria 1060340
440 Ga0495678_002234 3300049459 Bacteria 13498
441 Ga0495678_002857 3300049459 Bacteria 11183
442 Ga0495678_003464 3300049459 Bacteria 9776
443 Ga0495678_007755 3300049459 Bacteria 5528
444 Ga0495678_021044 3300049459 Bacteria 2878
445 Ga0495678_142237 3300049459 Bacteria 784
446 Ga0495678_181419 3300049459 Bacteria 660
447 Ga0495682_0002105 3300049460 Bacteria 9698
448 Ga0495682_0002400 3300049460 Bacteria 8874
449 Ga0495682_0005412 3300049460 Bacteria 5308
450 Ga0495682_0036855 3300049460 Bacteria 1799
451 Ga0495682_0041707 3300049460 Bacteria 1682
452 Ga0495682_0043275 3300049460 Bacteria 1649
453 Ga0495682_0319692 3300049460 Bacteria 547
454 Ga0501249_000460 3300049679 Bacteria 10157
455 Ga0501269_000228 3300049766 Bacteria 16443
456 Ga0501279_015103 3300049775 Bacteria 1067
457 Ga0501035_0024716 3300049822 Bacteria 5507
458 Ga0501044_0302112 3300049823 Bacteria 1529
459 nmdc:mga03683_5244_c1 3300050489 Bacteria 4365
460 nmdc:mga0rr50_507326_c1 3300050513 Bacteria 1026
461 Ga0500594_0001548 3300053118 Bacteria 5010
462 Ga0500586_000320 3300053145 Bacteria 9536
463 Ga0500622_0070718 3300053156 Bacteria 1764
464 Ga0587080_003513 3300059503 Unclassified 1959
465 Ga0587083_0009959 3300059505 Unclassified 1527
466 Ga0587067_000709 3300059640 Bacteria 3166
467 Ga0587075_033488 3300059644 Bacteria 830
468 Ga0587107_034816 3300059652 Bacteria 786
469 Ga0466962_0041068 3300061719 Bacteria 2213
470 2511249138 2511231003 Bacteria 5606035
471 2550692440 2548876994 Bacteria 4904866
472 2601670333 2600255292 Bacteria 6300551
473 2644359534 2643221664 Bacteria 7272945
474 2819592583 2818991445 Bacteria 4955017
475 2842713766 2842711865 Bacteria 7155354
476 2857548331 2857547612 Bacteria 6179999
477 2857554900 2857553236 Bacteria 6166726
478 2857562266 2857558681 Bacteria 6617694
479 2884811967 2884811622 Bacteria 5552861
480 2884838928 2884836552 Bacteria 5219991
481 2884855220 2884852848 Bacteria 5221161
482 2885083551 2885080285 Bacteria 6355622
483 2896156111 2896154374 Bacteria 5221518
484 2904429811 2904424332 Bacteria 7633521
485 2904601832 2904601388 Bacteria 5884906
486 2919479011 2919476304 Bacteria 5888696
487 2932412931 2932410948 Bacteria 6312192
488 2932420446 2932416698 Bacteria 6315112
489 Ga0495686_0074358
490 JGI25155J39150_1000142
491 JGI25155J39150_1000395
492 JGI25156J39149_1001097
493 JGI25156J39149_1003611
494 JGI25162J39368_1004783
495 JGI25154J39366_1000269
496 JGI25154J39366_1000916
497 JGI25154J39366_1000927
498 JGI25157J39369_1000203
499 JGI25159J45721_1005685
500 rootL2_10015446
501 Ga0055532_1000005
502 Ga0055542_1005705
503 Ga0055526_1000856
504 Ga0055526_1001774
505 Ga0055537_1000496
506 Ga0055524_1000027
507 Ga0055524_1001883
508 Ga0055534_1000583
509 Ga0055528_1000686
510 Ga0055543_1002543
511 Ga0065165_1000298
512 Ga0065165_1042202
513 Ga0065714_10270173
514 Ga0070658_10720144
515 Ga0070683_101031234
516 Ga0070670_101410085
517 Ga0070660_100035030
518 Ga0070660_100733062
519 Ga0070660_100812846
520 Ga0070661_100011877
521 Ga0070659_100021256
522 Ga0070662_100172477
523 Ga0070662_100797626
524 Ga0070664_100019392
525 Ga0070664_100031999
526 Ga0068854_100832314
527 Ga0068856_100051505
528 Ga0068856_100594160
529 Ga0068852_100029429
530 Ga0068852_100152219
531 Ga0068852_100403907
532 Ga0079104_1012368
533 Ga0099826_10000003
534 Ga0105251_10136420
535 Ga0105244_10003849
536 Ga0105244_10030050
537 Ga0105240_10014863
538 Ga0105240_10026065
539 Ga0105245_11307606
540 Ga0105241_10018382
541 Ga0105241_10559476
542 Ga0105242_10057488
543 Ga0105238_10084913
544 Ga0157373_10091024
545 Ga0157371_10000399
546 Ga0157372_11524936
547 Ga0182008_10002256
548 Ga0182008_10064164
549 Ga0182006_1000010
550 Ga0182006_1000055
551 Ga0182006_1002330
552 Ga0182007_10000030
553 Ga0182007_10045067
554 Ga0182005_1000003
555 Ga0182005_1000009
556 Ga0163161_10013299
557 Ga0163161_10081316
558 Ga0163161_10110000
559 Ga0213872_10014596
560 Ga0209435_100004
561 Ga0209435_101309
562 Ga0209147_100011
563 Ga0209437_100084
564 Ga0209258_100677
565 Ga0209646_1000032
566 Ga0209646_1000104
567 Ga0209646_1000372
568 Ga0209026_1000062
569 Ga0209026_1001169
570 Ga0209026_1010266
571 Ga0209148_1000272
572 Ga0209759_1000126
573 Ga0209759_1001426
574 Ga0209565_1000006
575 Ga0209455_1001769
576 Ga0209673_1000004
577 Ga0209130_1000067
578 Ga0209675_1000006
579 Ga0209564_1000006
580 Ga0209564_1000102
581 Ga0209564_1037282
582 Ga0209256_1000013
583 Ga0209256_1000037
584 Ga0207655_1003237
585 Ga0207705_10004801
586 Ga0207654_10028705
587 Ga0207654_10552261
588 Ga0207695_10010353
589 Ga0207695_10045891
590 Ga0207657_10014498
591 Ga0207657_10325443
592 Ga0207649_10056149
593 Ga0207649_10759243
594 Ga0207694_10105313
595 Ga0207694_10107858
596 Ga0207650_10033202
597 Ga0207687_10163670
598 Ga0207690_10645057
599 Ga0207706_10460766
600 Ga0207686_10001803
601 Ga0207679_10023661
602 Ga0207667_10012547
603 Ga0207667_10634968
604 Ga0207702_10105331
605 Ga0207698_10255429
606 Ga0209281_1002340
607 Ga0209282_1000002
608 Ga0307408_100000180
609 Ga0265314_10022091
610 Ga0307516_10268595
611 Ga0316577_10240330
612 Ga0307411_10409993
613 Ga0395899_0001205
614 Ga0395899_0009464
615 Ga0395899_0023657
616 Ga0395899_0231230
617 Ga0395900_0001494
618 Ga0395900_0003169
619 Ga0395900_0013160
620 Ga0395900_0051861
621 Ga0395900_0133567
622 Ga0395898_0060198
623 Ga0395898_0503857
624 Ga0395898_0979958
625 Ga0395905_0000137
626 Ga0395905_0030165
627 Ga0395905_0030268
628 Ga0395905_0064404
629 Ga0395905_0269218
630 Ga0395901_0000307
631 Ga0395901_0003234
632 Ga0395901_0113572
633 Ga0395901_0341930
634 Ga0395901_0573862
635 Ga0436361_0458337
636 Ga0436361_0473376
637 Ga0436361_0557562
638 Ga0436361_0679339
639 Ga0439465_0125793
640 Ga0451807_1924016
641 Ga0451853_1582642
642 Ga0439448_0003795
643 Ga0439449_0014769
644 Ga0439450_001845
645 Ga0439455_0005011
646 Ga0439462_0192366
647 Ga0450911_039905
648 Ga0466972_0000029
649 Ga0466972_0191332
650 Ga0466972_0391260
651 Ga0466975_0325147
652 Ga0466965_0015972
653 Ga0466965_0036714
654 Ga0466965_0039372
655 Ga0466965_0039643
656 Ga0466966_0005719
657 Ga0466961_0046133
658 Ga0466963_0180235
659 Ga0466964_0007359
660 Ga0466964_0012044
661 Ga0466971_0000925
662 Ga0466968_0012235
663 Ga0466968_0050065
664 Ga0466968_0055268
665 Ga0466968_0105893
666 Ga0466957_0004693
667 Ga0466957_0016698
668 Ga0466957_0540786
669 Ga0466959_0057149
670 Ga0466958_0026209
671 Ga0466958_0033934
672 Ga0466958_0173371
673 Ga0466967_0025444
674 Ga0466967_0344147
675 Ga0466967_1024508
676 Ga0495617_000189
677 Ga0495617_001998
678 Ga0495617_005256
679 Ga0495617_016745
680 Ga0495627_000065
681 Ga0495590_0000023
682 Ga0495590_0010408
683 Ga0495590_0024388
684 Ga0495638_0000067
685 Ga0495638_0016796
686 Ga0495638_0097989
687 Ga0495638_0128569
688 Ga0495653_0025786
689 Ga0495650_0000056
690 Ga0495650_0000263
691 Ga0495650_0002963
692 Ga0495650_0003947
693 Ga0495605_0000276
694 Ga0495605_0009182
695 Ga0495605_0249701
696 Ga0495639_0002664
697 Ga0495639_0372808
698 Ga0495584_0001049
699 Ga0495584_0005815
700 Ga0495584_0021950
701 Ga0495584_0054351
702 Ga0495584_0176953
703 Ga0495584_0278336
704 Ga0495585_0000231
705 Ga0495585_0031084
706 Ga0495585_0071330
707 Ga0495596_0000167
708 Ga0495596_0052524
709 Ga0495607_0011135
710 Ga0495607_0016529
711 Ga0495607_0026695
712 Ga0495607_0028071
713 Ga0495607_0036845
714 Ga0495607_0045340
715 Ga0495607_0056481
716 Ga0495607_0088920
717 Ga0495583_0000004
718 Ga0495583_0001039
719 Ga0495583_0001894
720 Ga0495583_0033981
721 Ga0495583_0069729
722 Ga0495583_0187153
723 Ga0495583_0350472
724 Ga0495606_0003815
725 Ga0495606_0004147
726 Ga0495606_0005471
727 Ga0495606_0006376
728 Ga0495606_0006946
729 Ga0495606_0225127
730 Ga0495610_0003777
731 Ga0495610_0005340
732 Ga0495610_0015389
733 Ga0495610_0023355
734 Ga0495616_0001343
735 Ga0495616_0008057
736 Ga0495616_0013054
737 Ga0495616_0022213
738 Ga0495616_0067730
739 Ga0495616_0067879
740 Ga0495631_0011928
741 Ga0495631_0107258
742 Ga0495632_0017005
743 Ga0495632_0056040
744 Ga0495637_0003972
745 Ga0495637_0073982
746 Ga0495643_0001210
747 Ga0495643_0004013
748 Ga0495643_0004026
749 Ga0495643_0021580
750 Ga0495643_0025864
751 Ga0495643_0132841
752 Ga0495643_0352618
753 Ga0495644_0007529
754 Ga0495644_0031876
755 Ga0495644_0126036
756 Ga0495648_0000008
757 Ga0495648_0000305
758 Ga0495648_0001823
759 Ga0495648_0019633
760 Ga0495648_0026089
761 Ga0495663_0061663
762 Ga0495663_0109386
763 Ga0495642_0001255
764 Ga0495642_0001811
765 Ga0495642_0031718
766 Ga0495642_0114741
767 Ga0495654_0010890
768 Ga0495654_0027988
769 Ga0495598_0042367
770 Ga0495609_0005634
771 Ga0495609_0006552
772 Ga0495609_0006566
773 Ga0495609_0026312
774 Ga0495609_0032208
775 Ga0495597_0002274
776 Ga0495597_0002612
777 Ga0495597_0015815
778 Ga0495597_0043792
779 Ga0495597_0048174
780 Ga0495597_0070428
781 Ga0495645_0636655
782 Ga0495622_0000959
783 Ga0495622_0134743
784 Ga0495622_0183198
785 Ga0495633_0000226
786 Ga0495633_0002413
787 Ga0495633_0004432
788 Ga0495633_0005974
789 Ga0495633_0006349
790 Ga0495656_0228623
791 Ga0495656_0443836
792 Ga0495668_0000008
793 Ga0495668_0000347
794 Ga0495668_0007806
795 Ga0495668_0125038
796 Ga0495611_0005101
797 Ga0495611_0012290
798 Ga0495611_0020794
799 Ga0495611_0028585
800 Ga0495611_0034284
801 Ga0495625_0001253
802 Ga0495625_0003583
803 Ga0495625_0007426
804 Ga0495625_0011500
805 Ga0495625_0017353
806 Ga0495625_0034572
807 Ga0495625_0036805
808 Ga0495659_0000738
809 Ga0495659_0001117
810 Ga0495659_0008182
811 Ga0495659_0061991
812 Ga0495659_0294514
813 Ga0495661_0007102
814 Ga0495661_0007181
815 Ga0495661_0014887
816 Ga0495661_0082168
817 Ga0495661_0091451
818 Ga0495661_0098191
819 Ga0495661_0161448
820 Ga0495661_0161673
821 Ga0495661_0504637
822 Ga0495588_0000070
823 Ga0495588_0080422
824 Ga0495623_0016901
825 Ga0495669_0002033
826 Ga0495669_0022247
827 Ga0495670_0002896
828 Ga0495670_0007367
829 Ga0495670_0032355
830 Ga0495670_0036305
831 Ga0495670_0082481
832 Ga0495670_0316620
833 Ga0495671_0001726
834 Ga0495671_0011653
835 Ga0495671_0025444
836 Ga0495649_0003538
837 Ga0495649_0006786
838 Ga0495649_0007681
839 Ga0495649_0015847
840 Ga0495589_0000175
841 Ga0495589_0066121
842 Ga0495589_0217962
843 Ga0495589_0221778
844 Ga0495660_0000113
845 Ga0495660_0001117
846 Ga0495660_0002300
847 Ga0495660_0003758
848 Ga0495660_0021310
849 Ga0495660_0096965
850 Ga0495636_0000408
851 Ga0495636_0048686
852 Ga0495636_0111740
853 Ga0495636_0316663
854 Ga0495672_0000035
855 Ga0495672_0000708
856 Ga0495672_0001524
857 Ga0495672_0023241
858 Ga0495672_0034391
859 Ga0495672_0055040
860 Ga0495672_0290457
861 Ga0495683_0008229
862 Ga0495683_0012354
863 Ga0495683_0016554
864 Ga0495687_000186
865 Ga0495687_001662
866 Ga0495687_002621
867 Ga0495687_003801
868 Ga0495687_008618
869 Ga0495687_199890
870 Ga0495675_0114712
871 Ga0495677_0002517
872 Ga0495677_0030673
873 Ga0495679_026461
874 Ga0495685_000004
875 Ga0495685_071477
876 Ga0495673_0000034
877 Ga0495681_0002957
878 Ga0495681_0003979
879 Ga0495681_0029086
880 Ga0495681_0119099
881 Ga0495686_0000722
882 Ga0495686_0001474
883 Ga0495686_0007392
884 Ga0495686_0042992
885 Ga0495686_0124399
886 Ga0495626_0001112
887 Ga0495626_0387571
888 Ga0496102_0002399
889 Ga0496102_0098615
890 Ga0496103_0002408
891 Ga0496104_0187061
892 Ga0496104_0306061
893 Ga0496106_0007599
894 Ga0496107_0161297
895 Ga0496108_0421892
896 Ga0496110_0440482
897 Ga0496114_0030524
898 Ga0496114_0039752
899 Ga0496114_0089957
900 Ga0496115_0528917
901 Ga0496116_0009678
902 Ga0496117_0000010
903 Ga0496117_0318494
904 Ga0496118_0000009
905 Ga0496118_0130365
906 Ga0496121_0006620
907 Ga0496121_0010080
908 Ga0496121_0021716
909 Ga0496121_0022000
910 Ga0496121_0066027
911 Ga0496122_0001689
912 Ga0496122_0003978
913 Ga0496122_0014909
914 Ga0496123_0000145
915 Ga0496123_0004651
916 Ga0496123_0103539
917 Ga0496124_0076620
918 Ga0496125_0028116
919 Ga0496125_0034011
920 Ga0496125_0044618
921 Ga0496125_0108812
922 Ga0496125_0156074
923 Ga0496125_0186775
924 Ga0496126_1003012
925 Ga0501305_081685
926 Ga0501305_086496
927 Ga0495678_000001
928 Ga0495678_002234
929 Ga0495678_002857
930 Ga0495678_003464
931 Ga0495678_007755
932 Ga0495678_021044
933 Ga0495678_142237
934 Ga0495678_181419
935 Ga0495682_0002105
936 Ga0495682_0002400
937 Ga0495682_0005412
938 Ga0495682_0036855
939 Ga0495682_0041707
940 Ga0495682_0043275
941 Ga0495682_0319692
942 Ga0501249_000460
943 Ga0501269_000228
944 Ga0501279_015103
945 Ga0501035_0024716
946 Ga0501044_0302112
947 nmdc:mga03683_5244_c1
948 nmdc:mga0rr50_507326_c1
949 Ga0500594_0001548
950 Ga0500586_000320
951 Ga0500622_0070718
952 Ga0587080_003513
953 Ga0587083_0009959
954 Ga0587067_000709
955 Ga0587075_033488
956 Ga0587107_034816
957 Ga0466962_0041068
958 2511249138
959 2550692440
960 2601670333
961 2644359534
962 2819592583
963 2842713766
964 2857548331
965 2857554900
966 2857562266
967 2884811967
968 2884838928
969 2884855220
970 2885083551
971 2896156111
972 2904429811
973 2904601832
974 2919479011
975 2932412931
976 2932420446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

58

193

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.977 24 160
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9715 25 170
4pyd-assembly1.cif.gz_E moac in complex with cpmp crystallized in space group p212121 0.971 24 161
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.969 24 170
3jqk-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) 0.9686 25 170
ID Description Score Start End Superfamily
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.977 24 160 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.969 24 170 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9624 24 170 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9614 17 171 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9607 16 171 3.30.70.640
ID Description Score Start End GO Terms
AF-X0TEN6-F1-model_v4 Molybdopterin cofactor biosynthesis C (MoaC) domain-containing protein 0.9928 28 125 GO:0006777
AF-A0A1F4F2M0-F1-model_v4 Molybdenum cofactor biosynthesis protein C 0.9926 28 146 GO:0006777
GO:0061799
AF-A0A838Q804-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9891 38 161 GO:0006777
GO:0016829
AF-A0A699GEP3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9888 28 171 GO:0006777
GO:0061799
AF-A0A1F7RTD9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.988 28 170 GO:0006777
GO:0061799

Map