F453584

General Info

Members Datasets Scaffolds Average Seq Length
488 330 405 257

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100011117|Ga0097621_1000111172
Length 297
Sequence MSTAGPPKSAQLHAASGGSAAVELANEAASLGAHQSRVGIEARHLRVTYDHFVAVADTSLAVAAGESFGIVGESGSGKSTVLRALCGLVPAGAGTIRLVANAEQGIEAARASQSLPAPGTKAFRRLVQMVFQDPYGSLHPRQTVDRILAEPLAIHGIADAESRIEQALDEVGLGTGFRFRYPHQLSGGQRQRIAVARALILEPQVLLLDEPTSSLDASVQAEVLNLLEDLRRRRGLTFIMVSHDLAVVTHLCDRLMVMQRGETVELVSSADLASSRVTHDYTRQLMDASIGFRRRAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
7 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
8 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
9 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
10 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
11 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
12 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
16 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
17 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
18 2643221618 Ensifer sp. Root231 Isolate Unclassified
19 2643221626 Ensifer sp. Root31 Isolate Unclassified
20 2643221655 Ensifer sp. Root1252 Isolate Unclassified
21 2643221659 Ensifer sp. Root127 Isolate Unclassified
22 2643221698 Ensifer sp. Root142 Isolate Unclassified
23 2643221712 Ensifer sp. Root258 Isolate Unclassified
24 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
25 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
26 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
27 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
28 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
29 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
30 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
31 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
32 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
33 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
34 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
35 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
36 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
37 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
38 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
39 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
40 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
41 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
42 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
43 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
44 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
45 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
46 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
47 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
48 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
49 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
50 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
51 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
52 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
53 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
54 2844163670 Ensifer sp. 1H6 Isolate Unclassified
55 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
56 2854911287 Brucella lupini LUP21 Isolate Unclassified
57 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
58 2876601092 Pantoea endophytica 596 Isolate Unclassified
59 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
60 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
61 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
62 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
63 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
64 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
65 2904504865 Serratia marcescens 1822 Isolate Unclassified
66 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
67 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
68 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
69 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
70 2919150387 Rahnella aceris 1817 Isolate Unclassified
71 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
72 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
73 2927143783 Rahnella sp. 2050 Isolate Unclassified
74 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
75 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
76 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
77 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
78 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
79 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
80 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
81 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
82 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
83 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
84 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
85 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
86 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
87 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
88 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
92 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
93 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
94 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
95 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
102 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
103 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
104 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
105 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
114 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
115 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
116 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
124 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
127 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
128 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
129 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
130 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
135 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
140 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
141 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
147 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
160 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
161 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
226 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
255 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
310 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
311 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
312 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
313 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
316 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
319 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
320 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
326 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
327 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
328 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
329 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
330 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.99
Metatranscriptomes 0
Isolates 17.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.08
Nodule 6.15
Rhizoplane 2.46
Rhizosphere 56.15
Stem 0
Stem Tuber 0.2
Unclassified 14.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_478082 2162886007 Bacteria 3137
2 JGI25162J39368_1000092 3300002737 Bacteria 100905
3 JGI25162J39368_1000675 3300002737 Bacteria 23944
4 JGI25163J39215_1000013 3300002771 Bacteria 86331
5 JGI25164J39214_1000071 3300002772 Bacteria 100905
6 JGI25159J45721_1000407 3300002987 Bacteria 19965
7 JGI25151J46595_10017735 3300003187 Bacteria 3077
8 JGI25165J46597_1000398 3300003214 Bacteria 45980
9 JGI25165J46597_1002788 3300003214 Bacteria 5066
10 rootH1_10194219 3300003323 Bacteria 2368
11 JGI25160J50197_1000172 3300003354 Bacteria 55781
12 JGI25161J50226_1000007 3300003374 Bacteria 256181
13 Ga0055538_1000064 3300003751 Bacteria 100905
14 Ga0055539_1000098 3300003752 Bacteria 100905
15 Ga0055533_1000108 3300003756 Bacteria 100905
16 Ga0055525_1000141 3300003759 Bacteria 100905
17 Ga0055526_1003566 3300003771 Bacteria 9799
18 Ga0055536_1005157 3300003781 Bacteria 6459
19 Ga0055536_1009577 3300003781 Bacteria 3980
20 Ga0055530_10000763 3300003791 Bacteria 26793
21 Ga0055530_10001299 3300003791 Bacteria 18844
22 Ga0055540_1000504 3300003792 Bacteria 29761
23 Ga0055540_1002428 3300003792 Bacteria 9845
24 Ga0055531_10003215 3300003794 Bacteria 10487
25 Ga0055531_10004306 3300003794 Bacteria 8724
26 Ga0055541_1000065 3300003841 Bacteria 100905
27 Ga0058692_1000171 3300003856 Bacteria 40209
28 Ga0058692_1000679 3300003856 Bacteria 14026
29 Ga0058692_1002252 3300003856 Bacteria 6551
30 Ga0055543_1011070 3300004625 Bacteria 1863
31 Ga0065165_1018011 3300005262 Bacteria 2577
32 Ga0065165_1027467 3300005262 Bacteria 1855
33 Ga0065165_1037185 3300005262 Bacteria 1477
34 Ga0065704_10000032 3300005289 Bacteria 15316
35 Ga0070670_100004009 3300005331 Bacteria 12288
36 Ga0070670_100004917 3300005331 Bacteria 11246
37 Ga0070670_100024623 3300005331 Bacteria 5176
38 Ga0070670_100071595 3300005331 Bacteria 2977
39 Ga0070677_10058845 3300005333 Bacteria 1579
40 Ga0068869_100000007 3300005334 Bacteria 78820
41 Ga0070680_100014122 3300005336 Bacteria 6237
42 Ga0068868_100497731 3300005338 Bacteria 1067
43 Ga0070689_100131032 3300005340 Bacteria 2011
44 Ga0070668_100005002 3300005347 Bacteria 9819
45 Ga0070668_100010303 3300005347 Bacteria 6941
46 Ga0070668_100070008 3300005347 Bacteria 2730
47 Ga0070669_100009394 3300005353 Bacteria 6964
48 Ga0070669_100031327 3300005353 Bacteria 3842
49 Ga0070669_100081349 3300005353 Bacteria 2412
50 Ga0070669_100202647 3300005353 Bacteria 1562
51 Ga0070675_100008830 3300005354 Bacteria 7832
52 Ga0070675_100008944 3300005354 Bacteria 7781
53 Ga0070674_100110942 3300005356 Bacteria 2014
54 Ga0070673_100005812 3300005364 Bacteria 7947
55 Ga0070673_100044158 3300005364 Bacteria 3449
56 Ga0070673_100115291 3300005364 Bacteria 2234
57 Ga0070673_100136030 3300005364 Bacteria 2068
58 Ga0070667_100001939 3300005367 Bacteria 18351
59 Ga0070667_100033931 3300005367 Bacteria 4269
60 Ga0070667_100086660 3300005367 Bacteria 2687
61 Ga0070709_10147855 3300005434 Bacteria 1621
62 Ga0070709_10242786 3300005434 Bacteria 1294
63 Ga0070705_100069014 3300005440 Bacteria 2130
64 Ga0070700_100291104 3300005441 Bacteria 1188
65 Ga0070678_100178204 3300005456 Bacteria 1737
66 Ga0070662_100032281 3300005457 Bacteria 3680
67 Ga0070662_100066591 3300005457 Bacteria 2643
68 Ga0070681_10051171 3300005458 Bacteria 4120
69 Ga0070681_10170879 3300005458 Bacteria 2096
70 Ga0068867_100035038 3300005459 Bacteria 3639
71 Ga0068867_100130131 3300005459 Bacteria 1955
72 Ga0070679_100090856 3300005530 Bacteria 3041
73 Ga0070672_100024379 3300005543 Bacteria 4470
74 Ga0070672_100055134 3300005543 Bacteria 3113
75 Ga0070672_100144065 3300005543 Bacteria 1968
76 Ga0070686_100109638 3300005544 Bacteria 1878
77 Ga0070696_100602262 3300005546 Bacteria 886
78 Ga0070665_100209853 3300005548 Bacteria 1948
79 Ga0070665_100307093 3300005548 Bacteria 1590
80 Ga0070704_100149449 3300005549 Bacteria 1835
81 Ga0068855_100007441 3300005563 Bacteria 13261
82 Ga0068855_100089487 3300005563 Bacteria 3554
83 Ga0068855_100446394 3300005563 Bacteria 1412
84 Ga0070664_100291025 3300005564 Bacteria 1475
85 Ga0068857_100000676 3300005577 Bacteria 25307
86 Ga0068854_100175485 3300005578 Bacteria 1670
87 Ga0068852_100332330 3300005616 Bacteria 1479
88 Ga0068852_100563961 3300005616 Bacteria 1140
89 Ga0068859_100003514 3300005617 Bacteria 15961
90 Ga0068864_100001466 3300005618 Bacteria 19448
91 Ga0068864_100018957 3300005618 Bacteria 5752
92 Ga0068864_100031537 3300005618 Bacteria 4497
93 Ga0068861_100001688 3300005719 Bacteria 14166
94 Ga0068861_100075375 3300005719 Bacteria 2626
95 Ga0068861_100354798 3300005719 Bacteria 1288
96 Ga0068870_10068447 3300005840 Bacteria 1929
97 Ga0068863_100001574 3300005841 Bacteria 22566
98 Ga0068863_100010047 3300005841 Bacteria 9211
99 Ga0068858_100013010 3300005842 Bacteria 7847
100 Ga0068858_100332144 3300005842 Bacteria 1454
101 Ga0068858_100370102 3300005842 Bacteria 1374
102 Ga0068860_100005878 3300005843 Bacteria 12351
103 Ga0068860_100073368 3300005843 Bacteria 3253
104 Ga0068860_100074894 3300005843 Bacteria 3220
105 Ga0068860_100113446 3300005843 Bacteria 2591
106 Ga0068860_100252183 3300005843 Bacteria 1719
107 Ga0068862_100002922 3300005844 Bacteria 14933
108 Ga0068862_100018133 3300005844 Bacteria 5861
109 Ga0075363_100109893 3300006048 Bacteria 1532
110 Ga0075364_10000309 3300006051 Bacteria 23917
111 Ga0075364_10007527 3300006051 Bacteria 6472
112 Ga0075364_10118036 3300006051 Bacteria 1774
113 Ga0075364_10139922 3300006051 Bacteria 1627
114 Ga0097621_100011117 3300006237 Bacteria 6621
115 Ga0097621_100341607 3300006237 Bacteria 1330
116 Ga0068871_100060006 3300006358 Bacteria 3101
117 Ga0068871_100237404 3300006358 Bacteria 1584
118 Ga0068865_100315353 3300006881 Bacteria 1256
119 Ga0097620_100003514 3300006931 Bacteria 15961
120 Ga0079104_1000230 3300006946 Bacteria 75473
121 Ga0099826_10003742 3300006948 Bacteria 10449
122 Ga0105251_10025854 3300009011 Bacteria 2996
123 Ga0105244_10000798 3300009036 Bacteria 26814
124 Ga0105244_10018475 3300009036 Bacteria 3912
125 Ga0105250_10000002 3300009092 Bacteria 566949
126 Ga0105250_10004268 3300009092 Bacteria 6607
127 Ga0105240_10000097 3300009093 Bacteria 179135
128 Ga0105245_10358753 3300009098 Bacteria 1446
129 Ga0105248_10001664 3300009177 Bacteria 24713
130 Ga0105248_10024292 3300009177 Bacteria 6739
131 Ga0105248_10049509 3300009177 Bacteria 4713
132 Ga0105248_10304263 3300009177 Bacteria 1795
133 Ga0105248_10861788 3300009177 Bacteria 1023
134 Ga0105237_10001364 3300009545 Bacteria 32311
135 Ga0105238_10045331 3300009551 Bacteria 4442
136 Ga0105249_10104647 3300009553 Bacteria 2667
137 Ga0105239_10000258 3300010375 Bacteria 78849
138 Ga0157373_10000189 3300013100 Bacteria 50406
139 Ga0157371_10000008 3300013102 Bacteria 393028
140 Ga0157371_10006536 3300013102 Bacteria 9590
141 Ga0157370_10178722 3300013104 Bacteria 1972
142 Ga0157369_10353027 3300013105 Bacteria 1527
143 Ga0163162_10045639 3300013306 Bacteria 4390
144 Ga0163162_10107547 3300013306 Bacteria 2885
145 Ga0163162_10211508 3300013306 Bacteria 2069
146 Ga0157375_10001469 3300013308 Bacteria 20277
147 Ga0157375_10165655 3300013308 Bacteria 2355
148 Ga0157375_10306556 3300013308 Bacteria 1752
149 Ga0163163_10001547 3300014325 Bacteria 19382
150 Ga0163163_10036645 3300014325 Bacteria 4766
151 Ga0163163_10267306 3300014325 Bacteria 1761
152 Ga0157380_10265672 3300014326 Bacteria 1561
153 Ga0157379_10000142 3300014968 Bacteria 51727
154 Ga0157379_10372149 3300014968 Bacteria 1310
155 Ga0157376_10029249 3300014969 Bacteria 4389
156 Ga0157376_10746754 3300014969 Bacteria 987
157 Ga0209760_100078 3300025207 Bacteria 77832
158 Ga0209436_107041 3300025208 Bacteria 2399
159 Ga0209784_100001 3300025224 Bacteria 3600592
160 Ga0209566_100001 3300025225 Bacteria 3600765
161 Ga0209674_100002 3300025226 Bacteria 3600592
162 Ga0209563_100002 3300025230 Bacteria 2045675
163 Ga0207427_100020 3300025231 Bacteria 507515
164 Ga0209437_100001 3300025233 Bacteria 2045675
165 Ga0209437_100042 3300025233 Bacteria 444095
166 Ga0209437_105280 3300025233 Bacteria 2208
167 Ga0207425_1001535 3300025245 Bacteria 9474
168 Ga0209677_100002 3300025253 Bacteria 2045675
169 Ga0209677_100172 3300025253 Bacteria 55396
170 Ga0209233_1000054 3300025261 Bacteria 439669
171 Ga0209233_1000218 3300025261 Bacteria 105353
172 Ga0209233_1000956 3300025261 Bacteria 12493
173 Ga0209565_1000333 3300025263 Bacteria 42094
174 Ga0209130_1000245 3300025284 Bacteria 68668
175 Ga0209130_1000708 3300025284 Bacteria 29740
176 Ga0209675_1003873 3300025291 Bacteria 6883
177 Ga0209676_1000013 3300025292 Bacteria 816080
178 Ga0209676_1003354 3300025292 Bacteria 9980
179 Ga0209676_1014480 3300025292 Bacteria 2961
180 Ga0209025_1004718 3300025294 Bacteria 11627
181 Ga0209025_1009265 3300025294 Bacteria 6894
182 Ga0209025_1010428 3300025294 Bacteria 6294
183 Ga0209564_1002543 3300025295 Bacteria 14056
184 Ga0209564_1051481 3300025295 Bacteria 999
185 Ga0209758_1000341 3300025297 Bacteria 86460
186 Ga0209050_1000008 3300025298 Bacteria 1144179
187 Ga0209050_1001244 3300025298 Bacteria 29472
188 Ga0209050_1015111 3300025298 Bacteria 3270
189 Ga0209050_1020339 3300025298 Bacteria 2473
190 Ga0207426_1000091 3300025302 Bacteria 280561
191 Ga0207426_1005778 3300025302 Bacteria 5555
192 Ga0209051_1000005 3300025303 Bacteria 1142353
193 Ga0209051_1002584 3300025303 Bacteria 12746
194 Ga0209257_1000048 3300025304 Bacteria 455536
195 Ga0209257_1003097 3300025304 Bacteria 14917
196 Ga0207696_1000239 3300025711 Bacteria 75936
197 Ga0207696_1000390 3300025711 Bacteria 41986
198 Ga0207696_1001181 3300025711 Bacteria 14876
199 Ga0207655_1007482 3300025728 Bacteria 7078
200 Ga0207655_1020750 3300025728 Bacteria 3363
201 Ga0207682_10033201 3300025893 Bacteria 2077
202 Ga0207699_10044524 3300025906 Bacteria 2584
203 Ga0207699_10092477 3300025906 Bacteria 1901
204 Ga0207645_10009537 3300025907 Bacteria 6709
205 Ga0207645_10085566 3300025907 Bacteria 2024
206 Ga0207643_10065858 3300025908 Bacteria 2076
207 Ga0207707_10316847 3300025912 Bacteria 1347
208 Ga0207695_10000187 3300025913 Bacteria 179183
209 Ga0207671_10001438 3300025914 Bacteria 27603
210 Ga0207681_10095331 3300025923 Bacteria 2134
211 Ga0207681_10115306 3300025923 Bacteria 1961
212 Ga0207681_10154774 3300025923 Bacteria 1722
213 Ga0207694_10146995 3300025924 Bacteria 1897
214 Ga0207650_10024013 3300025925 Bacteria 4329
215 Ga0207650_10054175 3300025925 Bacteria 2975
216 Ga0207650_10095453 3300025925 Bacteria 2279
217 Ga0207650_10135639 3300025925 Bacteria 1930
218 Ga0207650_10139975 3300025925 Bacteria 1901
219 Ga0207659_10016896 3300025926 Bacteria 4758
220 Ga0207706_10008309 3300025933 Bacteria 9570
221 Ga0207706_10047586 3300025933 Bacteria 3794
222 Ga0207686_10192554 3300025934 Bacteria 1455
223 Ga0207670_10260325 3300025936 Bacteria 1344
224 Ga0207669_10137330 3300025937 Bacteria 1691
225 Ga0207691_10000111 3300025940 Bacteria 72961
226 Ga0207711_10041717 3300025941 Bacteria 3909
227 Ga0207711_10122206 3300025941 Bacteria 2326
228 Ga0207689_10000142 3300025942 Bacteria 61457
229 Ga0207667_10018605 3300025949 Bacteria 7785
230 Ga0207651_10123230 3300025960 Bacteria 1970
231 Ga0207651_10518521 3300025960 Bacteria 1032
232 Ga0207668_10013845 3300025972 Bacteria 4980
233 Ga0207668_10015772 3300025972 Bacteria 4701
234 Ga0207658_10067054 3300025986 Bacteria 2702
235 Ga0207658_10094652 3300025986 Bacteria 2325
236 Ga0207677_10224328 3300026023 Bacteria 1509
237 Ga0207703_10000195 3300026035 Bacteria 70480
238 Ga0207639_10383123 3300026041 Bacteria 1263
239 Ga0207702_10349260 3300026078 Bacteria 1415
240 Ga0207641_10018427 3300026088 Bacteria 5724
241 Ga0207641_10207885 3300026088 Bacteria 1808
242 Ga0207648_10016833 3300026089 Bacteria 6666
243 Ga0207648_10581497 3300026089 Bacteria 1031
244 Ga0207676_10001696 3300026095 Bacteria 16247
245 Ga0207676_10002462 3300026095 Bacteria 13209
246 Ga0207676_10108092 3300026095 Bacteria 2321
247 Ga0207674_10002098 3300026116 Bacteria 25266
248 Ga0207675_100004037 3300026118 Bacteria 14223
249 Ga0207675_100050221 3300026118 Bacteria 3892
250 Ga0207675_100129573 3300026118 Bacteria 2392
251 Ga0207683_10026873 3300026121 Bacteria 4972
252 Ga0207683_10354885 3300026121 Bacteria 1346
253 Ga0207698_10380201 3300026142 Bacteria 1343
254 Ga0209281_1000179 3300027111 Bacteria 148102
255 Ga0209371_1000417 3300027312 Bacteria 43898
256 Ga0209371_1000830 3300027312 Bacteria 25445
257 Ga0209282_1012967 3300027666 Bacteria 5304
258 Ga0268265_10002425 3300028380 Bacteria 14080
259 Ga0268264_10000606 3300028381 Bacteria 43164
260 Ga0268264_10057162 3300028381 Bacteria 3262
261 Ga0268264_10196698 3300028381 Bacteria 1841
262 Ga0268264_10213045 3300028381 Bacteria 1774
263 Ga0307515_10057315 3300028794 Bacteria 5640
264 Ga0268256_1000202 3300030500 Bacteria 67837
265 Ga0268256_1003757 3300030500 Bacteria 6657
266 Ga0316181_1033551 3300030744 Bacteria 4006
267 Ga0265339_10050302 3300031249 Bacteria 2279
268 Ga0265331_10007054 3300031250 Bacteria 6551
269 Ga0265316_10373113 3300031344 Bacteria 1030
270 Ga0307513_10000206 3300031456 Bacteria 85338
271 Ga0265313_10000021 3300031595 Bacteria 144949
272 Ga0316576_10018776 3300031727 Bacteria 4729
273 Ga0307413_10141381 3300031824 Bacteria 1664
274 Ga0307410_10185745 3300031852 Bacteria 1577
275 Ga0307409_100500388 3300031995 Bacteria 1183
276 Ga0307416_100086679 3300032002 Bacteria 2670
277 Ga0307415_100267398 3300032126 Bacteria 1399
278 Ga0373927_0035055 3300035695 Bacteria 3263
279 Ga0373933_0287633 3300035724 Bacteria 1063
280 Ga0316584_0100544 3300036712 Bacteria 2165
281 Ga0316584_0302134 3300036712 Bacteria 1158
282 Ga0395899_0000589 3300037312 Bacteria 38294
283 Ga0395900_0000375 3300037418 Bacteria 64534
284 Ga0395898_0000629 3300037466 Bacteria 64534
285 Ga0395905_0000361 3300037471 Bacteria 64517
286 Ga0395901_0000273 3300038443 Bacteria 64425
287 Ga0436365_0009921 3300039437 Bacteria 1461
288 Ga0436360_0657748 3300039438 Bacteria 1698
289 Ga0495617_008308 3300046452 Bacteria 3581
290 Ga0495591_000111 3300046458 Bacteria 93733
291 Ga0495591_002389 3300046458 Bacteria 10507
292 Ga0495650_0000043 3300046471 Bacteria 357197
293 Ga0495580_0003875 3300046472 Bacteria 12664
294 Ga0495605_0193258 3300046474 Bacteria 889
295 Ga0495607_0146249 3300046501 Bacteria 1214
296 Ga0495606_0001398 3300046507 Bacteria 32519
297 Ga0495616_0042943 3300046513 Bacteria 2299
298 Ga0495631_0141056 3300046518 Bacteria 1035
299 Ga0495643_0029652 3300046522 Bacteria 3060
300 Ga0495648_0009512 3300046524 Bacteria 7512
301 Ga0495654_0000147 3300046530 Bacteria 72993
302 Ga0495654_0000250 3300046530 Bacteria 49614
303 Ga0495654_0003284 3300046530 Bacteria 9972
304 Ga0495668_0005994 3300046616 Bacteria 8071
305 Ga0495625_0119943 3300046660 Bacteria 1791
306 Ga0495588_0001469 3300046674 Bacteria 10112
307 Ga0495671_0002319 3300046692 Bacteria 12088
308 Ga0495649_0022825 3300046694 Bacteria 3499
309 Ga0495589_0017398 3300046794 Bacteria 3690
310 Ga0495660_0000012 3300046810 Bacteria 350701
311 Ga0495660_0000020 3300046810 Bacteria 304768
312 Ga0495672_0000011 3300047320 Bacteria 535362
313 Ga0495680_0267401 3300047322 Bacteria 1208
314 Ga0495683_0022959 3300047323 Bacteria 3207
315 Ga0495673_0000020 3300047469 Bacteria 548327
316 Ga0495681_0027166 3300047470 Bacteria 2966
317 Ga0495686_0009938 3300047472 Bacteria 6811
318 Ga0496100_0000286 3300048903 Bacteria 25474
319 Ga0496100_0087102 3300048903 Bacteria 2123
320 Ga0496101_0000164 3300048904 Bacteria 56560
321 Ga0496101_0116726 3300048904 Bacteria 2014
322 Ga0496102_0001007 3300048905 Bacteria 26439
323 Ga0496103_0009151 3300048906 Bacteria 5865
324 Ga0496104_0014452 3300048907 Bacteria 7131
325 Ga0496106_0069435 3300048909 Bacteria 2689
326 Ga0496108_0179310 3300048911 Bacteria 1834
327 Ga0496116_0000066 3300048919 Bacteria 264035
328 Ga0496116_0023132 3300048919 Bacteria 4636
329 Ga0496116_0094523 3300048919 Bacteria 1806
330 Ga0496117_0000997 3300048920 Bacteria 43330
331 Ga0496117_0002474 3300048920 Bacteria 23204
332 Ga0496117_0009777 3300048920 Bacteria 8847
333 Ga0496118_0001178 3300048921 Bacteria 40345
334 Ga0496118_0005581 3300048921 Bacteria 14241
335 Ga0496118_0008115 3300048921 Bacteria 10935
336 Ga0496118_0056669 3300048921 Bacteria 2944
337 Ga0496118_0193894 3300048921 Bacteria 1212
338 Ga0496119_0012240 3300048922 Bacteria 6992
339 Ga0496119_0018206 3300048922 Bacteria 5244
340 Ga0496119_0023643 3300048922 Bacteria 4349
341 Ga0496119_0031778 3300048922 Bacteria 3531
342 Ga0496120_0001859 3300048923 Bacteria 23494
343 Ga0496120_0010251 3300048923 Bacteria 6560
344 Ga0496120_0044838 3300048923 Bacteria 2566
345 Ga0496121_0000033 3300048924 Bacteria 377542
346 Ga0496121_0000084 3300048924 Bacteria 225942
347 Ga0496121_0000216 3300048924 Bacteria 127028
348 Ga0496121_0005558 3300048924 Bacteria 16101
349 Ga0496122_0000110 3300048925 Bacteria 190142
350 Ga0496122_0002781 3300048925 Bacteria 24065
351 Ga0496122_0011709 3300048925 Bacteria 8839
352 Ga0496123_0000081 3300048926 Bacteria 190142
353 Ga0496123_0002476 3300048926 Bacteria 22795
354 Ga0496123_0030641 3300048926 Bacteria 3933
355 Ga0496123_0052200 3300048926 Bacteria 2715
356 Ga0496124_0000066 3300048927 Bacteria 222815
357 Ga0496124_0008929 3300048927 Bacteria 10387
358 Ga0496124_0018729 3300048927 Bacteria 6472
359 Ga0496124_0020408 3300048927 Bacteria 6122
360 Ga0496124_0073191 3300048927 Bacteria 2836
361 Ga0496124_0161115 3300048927 Bacteria 1748
362 Ga0496125_0000033 3300048928 Bacteria 351850
363 Ga0496125_0000218 3300048928 Bacteria 117272
364 Ga0496125_0002983 3300048928 Bacteria 21244
365 Ga0496126_0000420 3300048929 Bacteria 85425
366 Ga0496126_0027736 3300048929 Bacteria 5404
367 Ga0496126_0065937 3300048929 Bacteria 3238
368 Ga0495678_000551 3300049459 Bacteria 36076
369 Ga0495678_041843 3300049459 Bacteria 1830
370 Ga0495682_0000005 3300049460 Bacteria 360387
371 Ga0501032_0105053 3300049569 Bacteria 1871
372 Ga0501033_0048133 3300049570 Bacteria 3167
373 Ga0501034_0425400 3300049571 Bacteria 1248
374 Ga0501038_0058174 3300049574 Bacteria 3315
375 Ga0501039_0054997 3300049575 Bacteria 3082
376 Ga0501083_0002976 3300049744 Bacteria 11757
377 Ga0501035_0240839 3300049822 Bacteria 1538
378 nmdc:mga00v17_104_c1 3300050491 Bacteria 50343
379 nmdc:mga00v17_109618_c1 3300050491 Bacteria 1750
380 nmdc:mga00v17_7500_c1 3300050491 Bacteria 5823
381 nmdc:mga00v17_95488_c1 3300050491 Bacteria 1872
382 nmdc:mga07m45_252781_c1 3300050496 Bacteria 1025
383 nmdc:mga0sz30_60112_c1 3300050516 Bacteria 1622
384 Ga0500650_0114579 3300053098 Bacteria 1258
385 Ga0500593_000456 3300053117 Bacteria 16197
386 Ga0500607_106720 3300053121 Bacteria 1381
387 Ga0500618_000008 3300053125 Bacteria 214678
388 Ga0500618_000122 3300053125 Bacteria 63970
389 Ga0500618_001174 3300053125 Bacteria 12644
390 Ga0500618_028116 3300053125 Bacteria 1333
391 Ga0500618_057580 3300053125 Bacteria 875
392 Ga0500621_000014 3300053126 Bacteria 126576
393 Ga0500568_0000116 3300053139 Bacteria 71883
394 Ga0500573_0001480 3300053140 Bacteria 11280
395 Ga0500573_0007401 3300053140 Bacteria 5986
396 Ga0500586_060140 3300053145 Bacteria 1321
397 Ga0500616_0000587 3300053153 Bacteria 44254
398 Ga0500624_000776 3300053157 Bacteria 7557
399 Ga0500627_0007993 3300053158 Bacteria 3728
400 Ga0500634_0002607 3300053161 Bacteria 7670
401 Ga0500636_0039826 3300053177 Bacteria 2780
402 Ga0500611_003527 3300053727 Bacteria 2015
403 Ga0500645_004768 3300053730 Bacteria 5132
404 Ga0501082_0145772 3300060353 Bacteria 2055
405 Ga0501082_0377170 3300060353 Bacteria 1237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046458 Ga0495591_002389 Ga0495591_002389_7345_8085 232
2 3300046513 Ga0495616_0042943 Ga0495616_0042943_1098_1838 232
3 3300046518 Ga0495631_0141056 Ga0495631_0141056_183_923 232
4 3300046692 Ga0495671_0002319 Ga0495671_0002319_2004_2744 232
5 3300047323 Ga0495683_0022959 Ga0495683_0022959_2304_3044 232
6 3300047469 Ga0495673_0000020 Ga0495673_0000020_228451_229191 232
7 3300049459 Ga0495678_000551 Ga0495678_000551_5820_6560 232
8 3300053126 Ga0500621_000014 Ga0500621_000014_54464_55204 232
9 3300005548 Ga0070665_100209853 Ga0070665_1002098533 236
10 3300006946 Ga0079104_1000230 Ga0079104_100023032 236
11 3300027111 Ga0209281_1000179 Ga0209281_100017933 236
12 3300039438 Ga0436360_0657748 Ga0436360_0657748_298_1104 236
13 3300046474 Ga0495605_0193258 Ga0495605_0193258_18_758 236
14 3300046507 Ga0495606_0001398 Ga0495606_0001398_6496_7236 236
15 3300046524 Ga0495648_0009512 Ga0495648_0009512_223_963 236
16 3300046530 Ga0495654_0003284 Ga0495654_0003284_8808_9548 236
17 3300046694 Ga0495649_0022825 Ga0495649_0022825_2690_3430 236
18 3300046794 Ga0495589_0017398 Ga0495589_0017398_2070_2810 236
19 3300046810 Ga0495660_0000020 Ga0495660_0000020_107924_108664 236
20 3300047320 Ga0495672_0000011 Ga0495672_0000011_241889_242629 236
21 3300048921 Ga0496118_0193894 Ga0496118_0193894_423_1166 236
22 3300048924 Ga0496121_0005558 Ga0496121_0005558_11169_11912 236
23 3300048927 Ga0496124_0073191 Ga0496124_0073191_633_1376 236
24 3300049460 Ga0495682_0000005 Ga0495682_0000005_313469_314209 236
25 3300014969 Ga0157376_10746754 Ga0157376_107467541 238
26 3300046501 Ga0495607_0146249 Ga0495607_0146249_152_895 238
27 3300048924 Ga0496121_0000216 Ga0496121_0000216_69934_70677 238
28 3300053125 Ga0500618_000008 Ga0500618_000008_208139_208882 238
29 3300053125 Ga0500618_028116 Ga0500618_028116_234_977 238
30 3300053125 Ga0500618_057580 Ga0500618_057580_30_773 238
31 3300053153 Ga0500616_0000587 Ga0500616_0000587_19476_20219 238
32 3300053158 Ga0500627_0007993 Ga0500627_0007993_174_917 238
33 3300005546 Ga0070696_100602262 Ga0070696_1006022621 239
34 3300006051 Ga0075364_10000309 Ga0075364_1000030915 242
35 3300036712 Ga0316584_0100544 Ga0316584_0100544_315_1049 242
36 3300036712 Ga0316584_0302134 Ga0316584_0302134_340_1074 242
37 3300050491 nmdc:mga00v17_104_c1 nmdc:mga00v17_104_c1_1009_1752 242
38 iso_pu_bacteria 2508501114 2509076505 242
39 iso_pu_bacteria 2511231025 2511380870 242
40 iso_pu_bacteria 2511231035 2511436779 242
41 iso_pu_bacteria 2643221618 2644104353 242
42 iso_pu_bacteria 2643221626 2644147551 242
43 iso_pu_bacteria 2643221655 2644313346 242
44 iso_pu_bacteria 2643221659 2644331649 242
45 iso_pu_bacteria 2643221698 2644541819 242
46 iso_pu_bacteria 2643221712 2644612971 242
47 iso_pu_bacteria 2706794495 2707101564 242
48 iso_pu_bacteria 2838675328 2838675362 242
49 iso_pu_bacteria 2838714209 2838714243 242
50 iso_pu_bacteria 2838719591 2838721955 242
51 iso_pu_bacteria 2838724970 2838725004 242
52 iso_pu_bacteria 2841846520 2841848934 242
53 iso_pu_bacteria 2842124991 2842125035 242
54 iso_pu_bacteria 2842130223 2842130257 242
55 iso_pu_bacteria 2842152218 2842154573 242
56 iso_pu_bacteria 2842170452 2842170486 242
57 iso_pu_bacteria 2842175837 2842178193 242
58 iso_pu_bacteria 2842187318 2842187352 242
59 iso_pu_bacteria 2842211629 2842211663 242
60 iso_pu_bacteria 2842224351 2842226717 242
61 iso_pu_bacteria 2844163670 2844167101 242
62 iso_pu_bacteria 2854601825 2854603711 242
63 iso_pu_bacteria 2854911287 2854916447 242
64 iso_pu_bacteria 2876601092 2876601763 242
65 iso_pu_bacteria 2884298095 2884301217 242
66 iso_pu_bacteria 2899275550 2899275830 242
67 iso_pu_bacteria 2904504865 2904508688 242
68 iso_pu_bacteria 2915650412 2915652661 242
69 iso_pu_bacteria 2919114240 2919114274 242
70 iso_pu_bacteria 2926754445 2926755294 242
71 iso_pu_bacteria 2929138655 2929144074 242
72 iso_pu_bacteria 2933006813 2933009218 242
73 iso_pu_bacteria 2941499720 2941504251 242
74 iso_pu_bacteria 8016733728 8016733960 242
75 iso_pu_bacteria 8019499862 8019504541 242
76 iso_pu_bacteria 8057132660 8057134069 242
77 iso_pu_bacteria 2558860983 2561467997 243
78 iso_pu_bacteria 2582581308 2585277904 243
79 iso_pu_bacteria 2582581315 2585326850 243
80 iso_pu_bacteria 2582581316 2585332526 243
81 iso_pu_bacteria 2585427527 2585533232 243
82 iso_pu_bacteria 2585427530 2585555653 243
83 iso_pu_bacteria 2585427634 2586000578 243
84 iso_pu_bacteria 2615840626 2616309173 243
85 iso_pu_bacteria 2617270742 2617381182 243
86 iso_pu_bacteria 2775507266 2778175261 243
87 iso_pu_bacteria 2818991453 2819641863 243
88 iso_pu_bacteria 2818991461 2819683635 243
89 iso_pu_bacteria 2821123053 2821126542 243
90 iso_pu_bacteria 2838736955 2838736983 243
91 iso_pu_bacteria 2841840854 2841842648 243
92 iso_pu_bacteria 2842140634 2842142428 243
93 iso_pu_bacteria 2842482326 2842486839 243
94 iso_pu_bacteria 2842775625 2842777113 243
95 iso_pu_bacteria 2857531043 2857533104 243
96 iso_pu_bacteria 2919171160 2919172771 243
97 iso_pu_bacteria 8005658619 8005661683 243
98 3300039437 Ga0436365_0009921 Ga0436365_0009921_51_791 244
99 iso_pu_bacteria 2513237351 2514587037 244
100 iso_pu_bacteria 2891048133 2891049054 244
101 iso_pu_bacteria 8055431914 8055431960 244
102 iso_pu_bacteria 2713897090 2715500377 245
103 iso_pu_bacteria 2775506902 2776269010 245
104 iso_pu_bacteria 2775506904 2776283853 245
105 iso_pu_bacteria 2791355082 2792581517 245
106 iso_pu_bacteria 2883291878 2883294861 245
107 iso_pu_bacteria 2883354860 2883356653 245
108 iso_pu_bacteria 8049293176 8049295598 245
109 3300003791 Ga0055530_10000763 Ga0055530_100007633 246
110 3300003791 Ga0055530_10001299 Ga0055530_100012996 246
111 3300003792 Ga0055540_1000504 Ga0055540_100050426 246
112 3300003794 Ga0055531_10004306 Ga0055531_100043066 246
113 3300003856 Ga0058692_1000171 Ga0058692_10001717 246
114 3300003856 Ga0058692_1000679 Ga0058692_10006795 246
115 3300003856 Ga0058692_1002252 Ga0058692_10022523 246
116 3300006051 Ga0075364_10118036 Ga0075364_101180362 246
117 3300006051 Ga0075364_10139922 Ga0075364_101399221 246
118 3300006948 Ga0099826_10003742 Ga0099826_100037428 246
119 3300009011 Ga0105251_10025854 Ga0105251_100258542 246
120 3300009092 Ga0105250_10000002 Ga0105250_10000002106 246
121 3300013100 Ga0157373_10000189 Ga0157373_1000018937 246
122 3300013102 Ga0157371_10006536 Ga0157371_100065362 246
123 3300013306 Ga0163162_10107547 Ga0163162_101075473 246
124 3300014325 Ga0163163_10267306 Ga0163163_102673062 246
125 3300025711 Ga0207696_1000239 Ga0207696_10002399 246
126 3300025711 Ga0207696_1000390 Ga0207696_10003905 246
127 3300025728 Ga0207655_1020750 Ga0207655_10207502 246
128 3300027312 Ga0209371_1000417 Ga0209371_100041735 246
129 3300027312 Ga0209371_1000830 Ga0209371_10008309 246
130 3300027666 Ga0209282_1012967 Ga0209282_10129673 246
131 3300030500 Ga0268256_1000202 Ga0268256_100020226 246
132 3300030500 Ga0268256_1003757 Ga0268256_10037574 246
133 3300030744 Ga0316181_1033551 Ga0316181_10335512 246
134 3300031824 Ga0307413_10141381 Ga0307413_101413812 246
135 3300031852 Ga0307410_10185745 Ga0307410_101857452 246
136 3300031995 Ga0307409_100500388 Ga0307409_1005003882 246
137 3300032002 Ga0307416_100086679 Ga0307416_1000866793 246
138 3300032126 Ga0307415_100267398 Ga0307415_1002673982 246
139 3300046452 Ga0495617_008308 Ga0495617_008308_260_1000 246
140 3300046458 Ga0495591_000111 Ga0495591_000111_56260_57000 246
141 3300046530 Ga0495654_0000250 Ga0495654_0000250_10270_11010 246
142 3300046616 Ga0495668_0005994 Ga0495668_0005994_3746_4486 246
143 3300046660 Ga0495625_0119943 Ga0495625_0119943_877_1617 246
144 3300046674 Ga0495588_0001469 Ga0495588_0001469_7977_8717 246
145 3300047470 Ga0495681_0027166 Ga0495681_0027166_1633_2388 246
146 3300048903 Ga0496100_0087102 Ga0496100_0087102_829_1569 246
147 3300048904 Ga0496101_0000164 Ga0496101_0000164_17974_18714 246
148 3300048919 Ga0496116_0023132 Ga0496116_0023132_2002_2742 246
149 3300048919 Ga0496116_0094523 Ga0496116_0094523_372_1166 246
150 3300048920 Ga0496117_0009777 Ga0496117_0009777_3422_4216 246
151 3300048921 Ga0496118_0056669 Ga0496118_0056669_1078_1872 246
152 3300048922 Ga0496119_0023643 Ga0496119_0023643_2567_3307 246
153 3300048922 Ga0496119_0031778 Ga0496119_0031778_2498_3292 246
154 3300048923 Ga0496120_0001859 Ga0496120_0001859_14061_14801 246
155 3300048923 Ga0496120_0044838 Ga0496120_0044838_918_1712 246
156 3300048924 Ga0496121_0000033 Ga0496121_0000033_39539_40333 246
157 3300048925 Ga0496122_0011709 Ga0496122_0011709_2980_3720 246
158 3300048926 Ga0496123_0002476 Ga0496123_0002476_15819_16559 246
159 3300048926 Ga0496123_0052200 Ga0496123_0052200_1880_2674 246
160 3300048927 Ga0496124_0008929 Ga0496124_0008929_8135_8875 246
161 3300048927 Ga0496124_0018729 Ga0496124_0018729_1584_2378 246
162 3300048927 Ga0496124_0020408 Ga0496124_0020408_4692_5432 246
163 3300048928 Ga0496125_0000218 Ga0496125_0000218_62860_63654 246
164 3300048929 Ga0496126_0065937 Ga0496126_0065937_344_1084 246
165 3300049744 Ga0501083_0002976 Ga0501083_0002976_9539_10294 246
166 3300050491 nmdc:mga00v17_109618_c1 nmdc:mga00v17_109618_c1_779_1519 246
167 3300050491 nmdc:mga00v17_95488_c1 nmdc:mga00v17_95488_c1_1031_1825 246
168 3300050516 nmdc:mga0sz30_60112_c1 nmdc:mga0sz30_60112_c1_524_1360 246
169 3300053121 Ga0500607_106720 Ga0500607_106720_283_1023 246
170 3300053140 Ga0500573_0001480 Ga0500573_0001480_157_921 246
171 3300053140 Ga0500573_0007401 Ga0500573_0007401_2220_2984 246
172 3300053157 Ga0500624_000776 Ga0500624_000776_493_1233 246
173 3300053161 Ga0500634_0002607 Ga0500634_0002607_96_836 246
174 3300053727 Ga0500611_003527 Ga0500611_003527_582_1355 246
175 3300053730 Ga0500645_004768 Ga0500645_004768_61_825 246
176 3300060353 Ga0501082_0377170 Ga0501082_0377170_27_782 246
177 3300002737 JGI25162J39368_1000675 JGI25162J39368_10006752 247
178 3300003214 JGI25165J46597_1000398 JGI25165J46597_100039831 247
179 3300003214 JGI25165J46597_1002788 JGI25165J46597_10027882 247
180 3300003323 rootH1_10194219 rootH1_101942192 247
181 3300003781 Ga0055536_1009577 Ga0055536_10095773 247
182 3300003792 Ga0055540_1002428 Ga0055540_10024285 247
183 3300003794 Ga0055531_10003215 Ga0055531_100032156 247
184 3300005367 Ga0070667_100086660 Ga0070667_1000866602 247
185 3300005563 Ga0068855_100007441 Ga0068855_1000074419 247
186 3300005616 Ga0068852_100332330 Ga0068852_1003323302 247
187 3300009093 Ga0105240_10000097 Ga0105240_1000009777 247
188 3300009177 Ga0105248_10304263 Ga0105248_103042632 247
189 3300009177 Ga0105248_10861788 Ga0105248_108617882 247
190 3300009545 Ga0105237_10001364 Ga0105237_100013642 247
191 3300010375 Ga0105239_10000258 Ga0105239_1000025849 247
192 3300013104 Ga0157370_10178722 Ga0157370_101787223 247
193 3300013105 Ga0157369_10353027 Ga0157369_103530272 247
194 3300025233 Ga0209437_100042 Ga0209437_100042279 247
195 3300025233 Ga0209437_105280 Ga0209437_1052802 247
196 3300025253 Ga0209677_100172 Ga0209677_10017222 247
197 3300025261 Ga0209233_1000054 Ga0209233_1000054382 247
198 3300025261 Ga0209233_1000218 Ga0209233_1000218104 247
199 3300025292 Ga0209676_1014480 Ga0209676_10144802 247
200 3300025297 Ga0209758_1000341 Ga0209758_100034115 247
201 3300025298 Ga0209050_1020339 Ga0209050_10203393 247
202 3300025303 Ga0209051_1002584 Ga0209051_100258412 247
203 3300025304 Ga0209257_1003097 Ga0209257_100309713 247
204 3300025913 Ga0207695_10000187 Ga0207695_1000018781 247
205 3300025914 Ga0207671_10001438 Ga0207671_1000143830 247
206 3300025949 Ga0207667_10018605 Ga0207667_100186055 247
207 3300025986 Ga0207658_10067054 Ga0207658_100670542 247
208 3300026078 Ga0207702_10349260 Ga0207702_103492602 247
209 3300026142 Ga0207698_10380201 Ga0207698_103802012 247
210 3300046522 Ga0495643_0029652 Ga0495643_0029652_458_1201 247
211 3300046530 Ga0495654_0000147 Ga0495654_0000147_61560_62303 247
212 3300047472 Ga0495686_0009938 Ga0495686_0009938_564_1307 247
213 3300048903 Ga0496100_0000286 Ga0496100_0000286_21120_21869 247
214 3300048904 Ga0496101_0116726 Ga0496101_0116726_555_1304 247
215 3300048905 Ga0496102_0001007 Ga0496102_0001007_5588_6337 247
216 3300048906 Ga0496103_0009151 Ga0496103_0009151_511_1260 247
217 3300048909 Ga0496106_0069435 Ga0496106_0069435_10_759 247
218 3300048920 Ga0496117_0000997 Ga0496117_0000997_20217_20966 247
219 3300048921 Ga0496118_0005581 Ga0496118_0005581_10142_10891 247
220 3300048922 Ga0496119_0012240 Ga0496119_0012240_4445_5194 247
221 3300048923 Ga0496120_0010251 Ga0496120_0010251_5485_6234 247
222 3300048924 Ga0496121_0000084 Ga0496121_0000084_22341_23090 247
223 3300048925 Ga0496122_0002781 Ga0496122_0002781_845_1594 247
224 3300048926 Ga0496123_0030641 Ga0496123_0030641_107_856 247
225 3300048927 Ga0496124_0161115 Ga0496124_0161115_767_1516 247
226 3300048928 Ga0496125_0002983 Ga0496125_0002983_13873_14622 247
227 3300048929 Ga0496126_0027736 Ga0496126_0027736_1932_2681 247
228 3300049459 Ga0495678_041843 Ga0495678_041843_183_926 247
229 3300053125 Ga0500618_000122 Ga0500618_000122_20771_21514 247
230 3300053125 Ga0500618_001174 Ga0500618_001174_5423_6172 247
231 3300053177 Ga0500636_0039826 Ga0500636_0039826_1660_2409 247
232 3300003781 Ga0055536_1005157 Ga0055536_10051576 248
233 3300005354 Ga0070675_100008944 Ga0070675_1000089443 248
234 3300005364 Ga0070673_100005812 Ga0070673_1000058128 248
235 3300025284 Ga0209130_1000708 Ga0209130_100070825 248
236 3300025292 Ga0209676_1000013 Ga0209676_1000013262 248
237 3300025294 Ga0209025_1009265 Ga0209025_10092652 248
238 3300025298 Ga0209050_1000008 Ga0209050_1000008262 248
239 3300025302 Ga0207426_1005778 Ga0207426_10057786 248
240 3300025303 Ga0209051_1000005 Ga0209051_1000005262 248
241 3300025304 Ga0209257_1000048 Ga0209257_1000048262 248
242 3300025960 Ga0207651_10123230 Ga0207651_101232302 248
243 3300049569 Ga0501032_0105053 Ga0501032_0105053_511_1260 248
244 3300049570 Ga0501033_0048133 Ga0501033_0048133_998_1747 248
245 3300049571 Ga0501034_0425400 Ga0501034_0425400_453_1202 248
246 3300049574 Ga0501038_0058174 Ga0501038_0058174_1487_2236 248
247 3300049575 Ga0501039_0054997 Ga0501039_0054997_836_1585 248
248 3300049822 Ga0501035_0240839 Ga0501035_0240839_743_1492 248
249 3300005331 Ga0070670_100004917 Ga0070670_1000049174 249
250 3300005347 Ga0070668_100070008 Ga0070668_1000700082 249
251 3300005434 Ga0070709_10147855 Ga0070709_101478552 249
252 3300005458 Ga0070681_10170879 Ga0070681_101708792 249
253 3300005844 Ga0068862_100018133 Ga0068862_1000181336 249
254 3300009551 Ga0105238_10045331 Ga0105238_100453314 249
255 3300025906 Ga0207699_10044524 Ga0207699_100445242 249
256 3300025924 Ga0207694_10146995 Ga0207694_101469952 249
257 3300025925 Ga0207650_10139975 Ga0207650_101399752 249
258 3300026041 Ga0207639_10383123 Ga0207639_103831232 249
259 3300031344 Ga0265316_10373113 Ga0265316_103731132 249
260 3300035724 Ga0373933_0287633 Ga0373933_0287633_119_904 249
261 3300037312 Ga0395899_0000589 Ga0395899_0000589_33315_34067 249
262 3300037418 Ga0395900_0000375 Ga0395900_0000375_47049_47801 249
263 3300037466 Ga0395898_0000629 Ga0395898_0000629_16734_17486 249
264 3300037471 Ga0395905_0000361 Ga0395905_0000361_16717_17469 249
265 3300038443 Ga0395901_0000273 Ga0395901_0000273_16642_17394 249
266 3300046472 Ga0495580_0003875 Ga0495580_0003875_5334_6182 249
267 3300047322 Ga0495680_0267401 Ga0495680_0267401_248_1039 249
268 3300053139 Ga0500568_0000116 Ga0500568_0000116_57820_58590 249
269 3300060353 Ga0501082_0145772 Ga0501082_0145772_468_1253 249
270 iso_pu_bacteria 2765235802 2765463880 249
271 iso_pu_bacteria 2839993093 2839993833 249
272 iso_pu_bacteria 2904578770 2904579479 249
273 iso_pu_bacteria 2919119836 2919120854 249
274 iso_pu_bacteria 2928521798 2928522280 249
275 iso_pu_bacteria 2954011201 2954014295 249
276 3300006358 Ga0068871_100237404 Ga0068871_1002374041 250
277 3300028794 Ga0307515_10057315 Ga0307515_100573155 251
278 3300031249 Ga0265339_10050302 Ga0265339_100503022 251
279 3300031250 Ga0265331_10007054 Ga0265331_100070547 251
280 3300031595 Ga0265313_10000021 Ga0265313_10000021113 251
281 3300031727 Ga0316576_10018776 Ga0316576_100187764 251
282 iso_pu_bacteria 2511231002 2511245294 251
283 3300005842 Ga0068858_100332144 Ga0068858_1003321442 252
284 3300005843 Ga0068860_100074894 Ga0068860_1000748943 252
285 3300006881 Ga0068865_100315353 Ga0068865_1003153532 252
286 3300026121 Ga0207683_10354885 Ga0207683_103548851 252
287 3300028381 Ga0268264_10213045 Ga0268264_102130452 252
288 3300005338 Ga0068868_100497731 Ga0068868_1004977312 253
289 3300005356 Ga0070674_100110942 Ga0070674_1001109422 253
290 3300005364 Ga0070673_100136030 Ga0070673_1001360302 253
291 3300005440 Ga0070705_100069014 Ga0070705_1000690142 253
292 3300005456 Ga0070678_100178204 Ga0070678_1001782042 253
293 3300005459 Ga0068867_100035038 Ga0068867_1000350382 253
294 3300005544 Ga0070686_100109638 Ga0070686_1001096382 253
295 3300005549 Ga0070704_100149449 Ga0070704_1001494492 253
296 3300005719 Ga0068861_100075375 Ga0068861_1000753752 253
297 3300005842 Ga0068858_100370102 Ga0068858_1003701022 253
298 3300005843 Ga0068860_100113446 Ga0068860_1001134462 253
299 3300006237 Ga0097621_100341607 Ga0097621_1003416072 253
300 3300006358 Ga0068871_100060006 Ga0068871_1000600062 253
301 3300025937 Ga0207669_10137330 Ga0207669_101373302 253
302 3300026023 Ga0207677_10224328 Ga0207677_102243282 253
303 3300026118 Ga0207675_100129573 Ga0207675_1001295733 253
304 3300026121 Ga0207683_10026873 Ga0207683_100268733 253
305 iso_pu_bacteria 2585427591 2585828527 253
306 iso_pu_bacteria 2585427592 2585832929 253
307 iso_pu_bacteria 2667528173 2671110079 253
308 iso_pu_bacteria 2904474040 2904477086 253
309 iso_pu_bacteria 2919150387 2919153253 253
310 iso_pu_bacteria 2927143783 2927143879 253
311 3300002987 JGI25159J45721_1000407 JGI25159J45721_10004076 255
312 3300003187 JGI25151J46595_10017735 JGI25151J46595_100177351 255
313 3300003354 JGI25160J50197_1000172 JGI25160J50197_100017244 255
314 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000785 255
315 3300003771 Ga0055526_1003566 Ga0055526_10035664 255
316 3300004625 Ga0055543_1011070 Ga0055543_10110702 255
317 3300005262 Ga0065165_1018011 Ga0065165_10180113 255
318 3300005262 Ga0065165_1027467 Ga0065165_10274672 255
319 3300005262 Ga0065165_1037185 Ga0065165_10371852 255
320 3300005333 Ga0070677_10058845 Ga0070677_100588452 255
321 3300005334 Ga0068869_100000007 Ga0068869_10000000712 255
322 3300005340 Ga0070689_100131032 Ga0070689_1001310323 255
323 3300005347 Ga0070668_100010303 Ga0070668_1000103037 255
324 3300005353 Ga0070669_100009394 Ga0070669_1000093942 255
325 3300005353 Ga0070669_100081349 Ga0070669_1000813492 255
326 3300005364 Ga0070673_100044158 Ga0070673_1000441583 255
327 3300005367 Ga0070667_100001939 Ga0070667_1000019397 255
328 3300005441 Ga0070700_100291104 Ga0070700_1002911041 255
329 3300005457 Ga0070662_100032281 Ga0070662_1000322813 255
330 3300005543 Ga0070672_100055134 Ga0070672_1000551343 255
331 3300005543 Ga0070672_100144065 Ga0070672_1001440653 255
332 3300005563 Ga0068855_100089487 Ga0068855_1000894872 255
333 3300005564 Ga0070664_100291025 Ga0070664_1002910252 255
334 3300005577 Ga0068857_100000676 Ga0068857_10000067620 255
335 3300005578 Ga0068854_100175485 Ga0068854_1001754852 255
336 3300005617 Ga0068859_100003514 Ga0068859_10000351410 255
337 3300005618 Ga0068864_100001466 Ga0068864_10000146616 255
338 3300005719 Ga0068861_100001688 Ga0068861_10000168811 255
339 3300005840 Ga0068870_10068447 Ga0068870_100684473 255
340 3300005841 Ga0068863_100010047 Ga0068863_10001004711 255
341 3300005842 Ga0068858_100013010 Ga0068858_1000130105 255
342 3300005843 Ga0068860_100005878 Ga0068860_10000587811 255
343 3300005844 Ga0068862_100002922 Ga0068862_1000029229 255
344 3300006048 Ga0075363_100109893 Ga0075363_1001098932 255
345 3300006051 Ga0075364_10007527 Ga0075364_100075275 255
346 3300006931 Ga0097620_100003514 Ga0097620_10000351410 255
347 3300009177 Ga0105248_10001664 Ga0105248_1000166419 255
348 3300009553 Ga0105249_10104647 Ga0105249_101046472 255
349 3300013308 Ga0157375_10306556 Ga0157375_103065561 255
350 3300014325 Ga0163163_10036645 Ga0163163_100366452 255
351 3300014326 Ga0157380_10265672 Ga0157380_102656721 255
352 3300014968 Ga0157379_10000142 Ga0157379_1000014253 255
353 3300014969 Ga0157376_10029249 Ga0157376_100292492 255
354 3300025208 Ga0209436_107041 Ga0209436_1070412 255
355 3300025245 Ga0207425_1001535 Ga0207425_10015356 255
356 3300025263 Ga0209565_1000333 Ga0209565_10003337 255
357 3300025284 Ga0209130_1000245 Ga0209130_10002456 255
358 3300025291 Ga0209675_1003873 Ga0209675_10038735 255
359 3300025292 Ga0209676_1003354 Ga0209676_10033545 255
360 3300025294 Ga0209025_1004718 Ga0209025_10047181 255
361 3300025294 Ga0209025_1010428 Ga0209025_10104285 255
362 3300025295 Ga0209564_1002543 Ga0209564_10025434 255
363 3300025295 Ga0209564_1051481 Ga0209564_10514811 255
364 3300025298 Ga0209050_1001244 Ga0209050_10012445 255
365 3300025298 Ga0209050_1015111 Ga0209050_10151114 255
366 3300025302 Ga0207426_1000091 Ga0207426_1000091134 255
367 3300025893 Ga0207682_10033201 Ga0207682_100332012 255
368 3300025907 Ga0207645_10009537 Ga0207645_100095377 255
369 3300025908 Ga0207643_10065858 Ga0207643_100658583 255
370 3300025923 Ga0207681_10095331 Ga0207681_100953312 255
371 3300025925 Ga0207650_10054175 Ga0207650_100541753 255
372 3300025933 Ga0207706_10047586 Ga0207706_100475863 255
373 3300025936 Ga0207670_10260325 Ga0207670_102603252 255
374 3300025942 Ga0207689_10000142 Ga0207689_1000014230 255
375 3300025972 Ga0207668_10015772 Ga0207668_100157723 255
376 3300026035 Ga0207703_10000195 Ga0207703_100001953 255
377 3300026088 Ga0207641_10018427 Ga0207641_100184273 255
378 3300026095 Ga0207676_10002462 Ga0207676_100024627 255
379 3300026116 Ga0207674_10002098 Ga0207674_1000209822 255
380 3300026118 Ga0207675_100004037 Ga0207675_10000403710 255
381 3300028380 Ga0268265_10002425 Ga0268265_1000242510 255
382 3300028381 Ga0268264_10000606 Ga0268264_1000060624 255
383 3300028381 Ga0268264_10196698 Ga0268264_101966982 255
384 3300031456 Ga0307513_10000206 Ga0307513_1000020613 255
385 3300048911 Ga0496108_0179310 Ga0496108_0179310_208_1011 255
386 3300050491 nmdc:mga00v17_7500_c1 nmdc:mga00v17_7500_c1_698_1489 255
387 3300050496 nmdc:mga07m45_252781_c1 nmdc:mga07m45_252781_c1_113_904 255
388 3300053098 Ga0500650_0114579 Ga0500650_0114579_103_891 255
389 3300005843 Ga0068860_100252183 Ga0068860_1002521832 256
390 3300009098 Ga0105245_10358753 Ga0105245_103587532 256
391 3300013308 Ga0157375_10165655 Ga0157375_101656552 256
392 3300025907 Ga0207645_10085566 Ga0207645_100855662 256
393 3300026089 Ga0207648_10581497 Ga0207648_105814971 256
394 3300053117 Ga0500593_000456 Ga0500593_000456_4353_5144 256
395 3300002737 JGI25162J39368_1000092 JGI25162J39368_100009285 257
396 3300002771 JGI25163J39215_1000013 JGI25163J39215_100001368 257
397 3300002772 JGI25164J39214_1000071 JGI25164J39214_100007185 257
398 3300003751 Ga0055538_1000064 Ga0055538_100006485 257
399 3300003752 Ga0055539_1000098 Ga0055539_100009885 257
400 3300003756 Ga0055533_1000108 Ga0055533_100010885 257
401 3300003759 Ga0055525_1000141 Ga0055525_100014185 257
402 3300003841 Ga0055541_1000065 Ga0055541_10000656 257
403 3300005289 Ga0065704_10000032 Ga0065704_100000327 257
404 3300005331 Ga0070670_100004009 Ga0070670_10000400911 257
405 3300005331 Ga0070670_100024623 Ga0070670_1000246234 257
406 3300005331 Ga0070670_100071595 Ga0070670_1000715952 257
407 3300005347 Ga0070668_100005002 Ga0070668_10000500212 257
408 3300005353 Ga0070669_100031327 Ga0070669_1000313272 257
409 3300005353 Ga0070669_100202647 Ga0070669_1002026472 257
410 3300005354 Ga0070675_100008830 Ga0070675_1000088304 257
411 3300005364 Ga0070673_100115291 Ga0070673_1001152911 257
412 3300005367 Ga0070667_100033931 Ga0070667_1000339313 257
413 3300005457 Ga0070662_100066591 Ga0070662_1000665912 257
414 3300005459 Ga0068867_100130131 Ga0068867_1001301312 257
415 3300005543 Ga0070672_100024379 Ga0070672_1000243793 257
416 3300005548 Ga0070665_100307093 Ga0070665_1003070931 257
417 3300005616 Ga0068852_100563961 Ga0068852_1005639612 257
418 3300005618 Ga0068864_100018957 Ga0068864_1000189572 257
419 3300005618 Ga0068864_100031537 Ga0068864_1000315375 257
420 3300005719 Ga0068861_100354798 Ga0068861_1003547982 257
421 3300005841 Ga0068863_100001574 Ga0068863_10000157421 257
422 3300005843 Ga0068860_100073368 Ga0068860_1000733681 257
423 3300009177 Ga0105248_10049509 Ga0105248_100495092 257
424 3300013306 Ga0163162_10045639 Ga0163162_100456393 257
425 3300013308 Ga0157375_10001469 Ga0157375_1000146911 257
426 3300014325 Ga0163163_10001547 Ga0163163_1000154713 257
427 3300025207 Ga0209760_100078 Ga0209760_10007846 257
428 3300025224 Ga0209784_100001 Ga0209784_1000011883 257
429 3300025225 Ga0209566_100001 Ga0209566_1000011883 257
430 3300025226 Ga0209674_100002 Ga0209674_1000021883 257
431 3300025230 Ga0209563_100002 Ga0209563_100002418 257
432 3300025231 Ga0207427_100020 Ga0207427_100020359 257
433 3300025233 Ga0209437_100001 Ga0209437_100001418 257
434 3300025253 Ga0209677_100002 Ga0209677_100002418 257
435 3300025261 Ga0209233_1000956 Ga0209233_10009567 257
436 3300025711 Ga0207696_1001181 Ga0207696_10011817 257
437 3300025728 Ga0207655_1007482 Ga0207655_10074823 257
438 3300025923 Ga0207681_10115306 Ga0207681_101153062 257
439 3300025923 Ga0207681_10154774 Ga0207681_101547742 257
440 3300025925 Ga0207650_10024013 Ga0207650_100240132 257
441 3300025925 Ga0207650_10095453 Ga0207650_100954532 257
442 3300025925 Ga0207650_10135639 Ga0207650_101356392 257
443 3300025926 Ga0207659_10016896 Ga0207659_100168964 257
444 3300025933 Ga0207706_10008309 Ga0207706_100083099 257
445 3300025940 Ga0207691_10000111 Ga0207691_1000011137 257
446 3300025941 Ga0207711_10041717 Ga0207711_100417175 257
447 3300025960 Ga0207651_10518521 Ga0207651_105185211 257
448 3300025972 Ga0207668_10013845 Ga0207668_100138455 257
449 3300025986 Ga0207658_10094652 Ga0207658_100946522 257
450 3300026088 Ga0207641_10207885 Ga0207641_102078852 257
451 3300026089 Ga0207648_10016833 Ga0207648_100168336 257
452 3300026095 Ga0207676_10001696 Ga0207676_100016968 257
453 3300026095 Ga0207676_10108092 Ga0207676_101080922 257
454 3300026118 Ga0207675_100050221 Ga0207675_1000502215 257
455 3300028381 Ga0268264_10057162 Ga0268264_100571621 257
456 3300005336 Ga0070680_100014122 Ga0070680_1000141226 258
457 3300005458 Ga0070681_10051171 Ga0070681_100511715 258
458 3300005530 Ga0070679_100090856 Ga0070679_1000908562 258
459 3300025912 Ga0207707_10316847 Ga0207707_103168472 258
460 3300025934 Ga0207686_10192554 Ga0207686_101925542 258
461 3300053145 Ga0500586_060140 Ga0500586_060140_80_895 259
462 3300006237 Ga0097621_100011117 Ga0097621_1000111172 260
463 3300009177 Ga0105248_10024292 Ga0105248_100242927 260
464 3300013102 Ga0157371_10000008 Ga0157371_10000008269 260
465 3300014968 Ga0157379_10372149 Ga0157379_103721492 260
466 3300025941 Ga0207711_10122206 Ga0207711_101222063 260
467 3300048921 Ga0496118_0001178 Ga0496118_0001178_26067_26864 260
468 2162886007 SwRhRL2b_contig_478082 SwRhRL2b_0683.00003920 261
469 3300005434 Ga0070709_10242786 Ga0070709_102427862 261
470 3300005563 Ga0068855_100446394 Ga0068855_1004463942 261
471 3300009036 Ga0105244_10000798 Ga0105244_100007983 261
472 3300009036 Ga0105244_10018475 Ga0105244_100184753 261
473 3300009092 Ga0105250_10004268 Ga0105250_100042683 261
474 3300013306 Ga0163162_10211508 Ga0163162_102115083 261
475 3300025906 Ga0207699_10092477 Ga0207699_100924772 261
476 3300035695 Ga0373927_0035055 Ga0373927_0035055_168_998 261
477 3300046471 Ga0495650_0000043 Ga0495650_0000043_87881_88666 261
478 3300046810 Ga0495660_0000012 Ga0495660_0000012_337762_338547 261
479 3300048907 Ga0496104_0014452 Ga0496104_0014452_4259_5044 261
480 3300048919 Ga0496116_0000066 Ga0496116_0000066_12151_12936 261
481 3300048920 Ga0496117_0002474 Ga0496117_0002474_12134_12919 261
482 3300048921 Ga0496118_0008115 Ga0496118_0008115_4133_4918 261
483 3300048922 Ga0496119_0018206 Ga0496119_0018206_1127_1912 261
484 3300048925 Ga0496122_0000110 Ga0496122_0000110_12156_12941 261
485 3300048926 Ga0496123_0000081 Ga0496123_0000081_177202_177987 261
486 3300048927 Ga0496124_0000066 Ga0496124_0000066_76202_76987 261
487 3300048928 Ga0496125_0000033 Ga0496125_0000033_254759_255544 261
488 3300048929 Ga0496126_0000420 Ga0496126_0000420_12149_12934 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

213

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

144

249

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9346 17 253
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9311 17 254
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9301 15 237
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9237 16 252
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.922 15 237
ID Description Score Start End Superfamily
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9592 17 252 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9449 17 251 3.40.50.300
af_P75796_311_605_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.938 17 252 3.40.50.300
af_I6Y482_6_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9377 17 257 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9366 12 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W2BRZ0-F1-model_v4 deleted 0.9647 15 260
AF-A0A174VRL1-F1-model_v4 ABC transporter ATP-binding protein (Methionine import ATP-binding protein MetN (EC 3.6.3.-)) 0.9591 17 234 GO:0005524
GO:0016887
GO:0055085
AF-A0A366IF50-F1-model_v4 Peptide/nickel transport system ATP-binding protein/oligopeptide transport system ATP-binding protein 0.9581 17 252 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A5D4LZT8-F1-model_v4 ABC transporter ATP-binding protein 0.9555 14 252 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A1Q7CRB0-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.9536 17 252 GO:0005524
GO:0015833
GO:0016887
GO:0055085

Feature Viewer

pLDDT pTM Quality
90.66 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map