F453571

General Info

Members Datasets Scaffolds Average Seq Length
488 210 976 243

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100102222|Ga0070696_1001022222
Length 262
Sequence MARVRVGAAFRAEAKTLTEHYLSRLPQFFLTPGGACPYLPGKVERKVFARLMGPHAAPLNDALTHSGFRRSQMIAYRPACDGCAACISVRVVVGEFSPSRSMRRLERNNADMVRTVVPPEATREQFALLQTYLASRHAGGGMSDMGLFDYVAMVEETPVETMLIEYRIKDSSSAGGRLVACALTDVLQDGLSMVYSFFDPQLSHRSLGTYMILDHVRAAKAKRLPFVYLGYWVRGSRKMDYKARFRPLEALGSSGWKRLATD

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 0.2
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100102222 3300005546 Bacteria 2055
2 JGI25165J46597_1000003 3300003214 Bacteria 694080
3 JGI25153J46596_10002369 3300003215 Bacteria 10910
4 rootH2_10023555 3300003320 Bacteria 10517
5 Ga0070658_10085027 3300005327 Bacteria 2601
6 Ga0070658_10225747 3300005327 Bacteria 1585
7 Ga0070683_100102947 3300005329 Bacteria 2689
8 Ga0070683_100109249 3300005329 Bacteria 2609
9 Ga0070690_100066499 3300005330 Bacteria 2334
10 Ga0070670_100127869 3300005331 Bacteria 2193
11 Ga0070670_100485012 3300005331 Bacteria 1098
12 Ga0070666_10008749 3300005335 Bacteria 6294
13 Ga0070680_100001314 3300005336 Bacteria 18009
14 Ga0070680_100004447 3300005336 Bacteria 10557
15 Ga0070680_100226154 3300005336 Bacteria 1580
16 Ga0068868_100074299 3300005338 Bacteria 2715
17 Ga0068868_100083199 3300005338 Bacteria 2568
18 Ga0070660_100002648 3300005339 Bacteria 12308
19 Ga0070660_100017800 3300005339 Bacteria 5183
20 Ga0070660_100208803 3300005339 Bacteria 1585
21 Ga0070691_10005809 3300005341 Bacteria 5632
22 Ga0070668_100394333 3300005347 Bacteria 1181
23 Ga0070675_100104054 3300005354 Bacteria 2394
24 Ga0070674_100208023 3300005356 Bacteria 1515
25 Ga0070673_100060623 3300005364 Bacteria 2999
26 Ga0070659_100007738 3300005366 Bacteria 7813
27 Ga0070667_100007992 3300005367 Bacteria 8773
28 Ga0070667_100420082 3300005367 Bacteria 1219
29 Ga0070709_10357823 3300005434 Bacteria 1080
30 Ga0070714_100056078 3300005435 Bacteria 3369
31 Ga0070714_100239039 3300005435 Bacteria 1676
32 Ga0070713_100000008 3300005436 Bacteria 160153
33 Ga0070713_100323884 3300005436 Bacteria 1424
34 Ga0070710_10100954 3300005437 Bacteria 1718
35 Ga0070663_100148770 3300005455 Bacteria 1794
36 Ga0070678_100063751 3300005456 Bacteria 2728
37 Ga0070678_100197305 3300005456 Bacteria 1659
38 Ga0070681_10000002 3300005458 Bacteria 821814
39 Ga0070681_10048260 3300005458 Bacteria 4255
40 Ga0070681_10051067 3300005458 Bacteria 4125
41 Ga0070681_10076160 3300005458 Bacteria 3314
42 Ga0070681_10175822 3300005458 Bacteria 2063
43 Ga0068867_100032226 3300005459 Bacteria 3788
44 Ga0068867_100063019 3300005459 Bacteria 2756
45 Ga0068867_100327608 3300005459 Bacteria 1271
46 Ga0070699_100215215 3300005518 Bacteria 1711
47 Ga0070679_100000062 3300005530 Bacteria 79849
48 Ga0070679_100037974 3300005530 Bacteria 4785
49 Ga0070679_100077450 3300005530 Bacteria 3314
50 Ga0070679_100135633 3300005530 Bacteria 2443
51 Ga0070679_100147657 3300005530 Bacteria 2329
52 Ga0070679_100250633 3300005530 Bacteria 1727
53 Ga0070684_100156357 3300005535 Bacteria 2067
54 Ga0068853_100000341 3300005539 Bacteria 32498
55 Ga0070672_100184388 3300005543 Bacteria 1740
56 Ga0070696_100448941 3300005546 Bacteria 1017
57 Ga0070693_100011272 3300005547 Bacteria 4501
58 Ga0070665_100001163 3300005548 Bacteria 32337
59 Ga0070665_100011628 3300005548 Bacteria 8896
60 Ga0070665_100034336 3300005548 Bacteria 5101
61 Ga0070665_100043938 3300005548 Bacteria 4488
62 Ga0070665_100146348 3300005548 Bacteria 2365
63 Ga0068855_100011332 3300005563 Bacteria 10763
64 Ga0068855_100021405 3300005563 Bacteria 7753
65 Ga0068855_100189368 3300005563 Bacteria 2322
66 Ga0068855_100488437 3300005563 Bacteria 1339
67 Ga0068855_100701008 3300005563 Bacteria 1083
68 Ga0068857_100001169 3300005577 Bacteria 20462
69 Ga0068856_100001117 3300005614 Bacteria 28344
70 Ga0068856_100037401 3300005614 Bacteria 4763
71 Ga0068856_100186102 3300005614 Bacteria 2090
72 Ga0068856_100407617 3300005614 Bacteria 1379
73 Ga0068852_100024332 3300005616 Bacteria 4892
74 Ga0068852_100032685 3300005616 Bacteria 4311
75 Ga0068852_100274786 3300005616 Bacteria 1622
76 Ga0068859_100543065 3300005617 Bacteria 1257
77 Ga0068851_10104220 3300005834 Bacteria 1508
78 Ga0068870_10121082 3300005840 Bacteria 1507
79 Ga0068863_100100964 3300005841 Bacteria 2742
80 Ga0068858_100110206 3300005842 Bacteria 2570
81 Ga0070712_100000202 3300006175 Bacteria 33503
82 Ga0070712_100017546 3300006175 Bacteria 4636
83 Ga0097621_100000230 3300006237 Bacteria 37430
84 Ga0097621_100119106 3300006237 Bacteria 2238
85 Ga0097621_100314641 3300006237 Bacteria 1385
86 Ga0097621_100406664 3300006237 Bacteria 1219
87 Ga0068871_100000019 3300006358 Bacteria 86487
88 Ga0068871_100034446 3300006358 Bacteria 4018
89 Ga0068871_100470075 3300006358 Bacteria 1130
90 Ga0075428_100085322 3300006844 Bacteria 3444
91 Ga0075431_100167307 3300006847 Bacteria 2260
92 Ga0075434_100146800 3300006871 Bacteria 2379
93 Ga0068865_100051498 3300006881 Bacteria 2850
94 Ga0068865_100279805 3300006881 Bacteria 1328
95 Ga0075436_100000053 3300006914 Bacteria 69483
96 Ga0075436_100033695 3300006914 Bacteria 3531
97 Ga0097620_100542990 3300006931 Bacteria 1257
98 Ga0075435_100160948 3300007076 Bacteria 1891
99 Ga0099795_10030824 3300007788 Bacteria 1843
100 Ga0105240_10000132 3300009093 Bacteria 152512
101 Ga0105240_10067704 3300009093 Bacteria 4426
102 Ga0105240_10100451 3300009093 Bacteria 3520
103 Ga0105240_10236045 3300009093 Bacteria 2122
104 Ga0105240_10263943 3300009093 Bacteria 1985
105 Ga0105240_10421024 3300009093 Bacteria 1500
106 Ga0105240_10523396 3300009093 Bacteria 1316
107 Ga0111539_10128144 3300009094 Bacteria 2973
108 Ga0105245_10052641 3300009098 Bacteria 3651
109 Ga0105245_10618326 3300009098 Bacteria 1111
110 Ga0105243_10019334 3300009148 Bacteria 5163
111 Ga0105241_10076237 3300009174 Bacteria 2614
112 Ga0105241_10149745 3300009174 Bacteria 1908
113 Ga0105242_10257101 3300009176 Bacteria 1576
114 Ga0105242_10397409 3300009176 Bacteria 1285
115 Ga0105248_10000015 3300009177 Bacteria 322959
116 Ga0105237_10056167 3300009545 Bacteria 3941
117 Ga0105237_10227057 3300009545 Bacteria 1867
118 Ga0105237_10379895 3300009545 Bacteria 1417
119 Ga0105238_10007262 3300009551 Bacteria 11091
120 Ga0105238_10053870 3300009551 Bacteria 4042
121 Ga0105238_10057605 3300009551 Bacteria 3896
122 Ga0105238_10516014 3300009551 Unclassified 1197
123 Ga0105249_10089120 3300009553 Bacteria 2882
124 Ga0105239_10002163 3300010375 Bacteria 25281
125 Ga0105239_10025555 3300010375 Bacteria 6501
126 Ga0105239_10041722 3300010375 Bacteria 5028
127 Ga0105239_10132703 3300010375 Bacteria 2771
128 Ga0105239_10225159 3300010375 Bacteria 2104
129 Ga0105246_10013883 3300011119 Bacteria 5056
130 Ga0105246_10031645 3300011119 Bacteria 3502
131 Ga0105246_10116081 3300011119 Bacteria 1975
132 Ga0157373_10103527 3300013100 Bacteria 2002
133 Ga0157373_10103913 3300013100 Bacteria 1998
134 Ga0157370_10057064 3300013104 Bacteria 3715
135 Ga0157370_10143423 3300013104 Bacteria 2225
136 Ga0157370_10266871 3300013104 Bacteria 1581
137 Ga0157369_10015232 3300013105 Bacteria 8676
138 Ga0157369_10049909 3300013105 Bacteria 4534
139 Ga0157369_10186388 3300013105 Bacteria 2182
140 Ga0157369_10250358 3300013105 Bacteria 1849
141 Ga0157374_10030873 3300013296 Bacteria 4866
142 Ga0157378_10077387 3300013297 Bacteria 2998
143 Ga0157378_10117129 3300013297 Bacteria 2450
144 Ga0157378_10207455 3300013297 Bacteria 1856
145 Ga0157378_10230878 3300013297 Bacteria 1763
146 Ga0163162_10017760 3300013306 Bacteria 6960
147 Ga0163162_10037780 3300013306 Bacteria 4819
148 Ga0163162_10071602 3300013306 Bacteria 3520
149 Ga0157372_10018261 3300013307 Bacteria 7538
150 Ga0157372_10031080 3300013307 Bacteria 5846
151 Ga0157372_10034088 3300013307 Bacteria 5595
152 Ga0157372_10065869 3300013307 Bacteria 4069
153 Ga0157372_10636364 3300013307 Bacteria 1242
154 Ga0157372_10715123 3300013307 Bacteria 1165
155 Ga0157375_10250756 3300013308 Bacteria 1931
156 Ga0163163_10000002 3300014325 Bacteria 609846
157 Ga0163163_10144952 3300014325 Bacteria 2418
158 Ga0157380_10315686 3300014326 Unclassified 1446
159 Ga0157377_10089815 3300014745 Bacteria 1812
160 Ga0157379_10000040 3300014968 Bacteria 79019
161 Ga0157379_10014098 3300014968 Bacteria 7006
162 Ga0157379_10014253 3300014968 Bacteria 6973
163 Ga0157379_10249759 3300014968 Bacteria 1610
164 Ga0157376_10031482 3300014969 Bacteria 4249
165 Ga0157376_10225077 3300014969 Bacteria 1740
166 Ga0157376_10266858 3300014969 Bacteria 1606
167 Ga0163161_10021014 3300017792 Bacteria 4587
168 Ga0209233_1000015 3300025261 Bacteria 980563
169 Ga0209233_1040654 3300025261 Bacteria 1010
170 Ga0209758_1000013 3300025297 Bacteria 873003
171 Ga0209758_1058383 3300025297 Bacteria 1291
172 Ga0207680_10002508 3300025903 Bacteria 8565
173 Ga0207680_10012045 3300025903 Bacteria 4394
174 Ga0207680_10072042 3300025903 Bacteria 2144
175 Ga0207645_10233019 3300025907 Bacteria 1216
176 Ga0207643_10067754 3300025908 Bacteria 2049
177 Ga0207705_10000343 3300025909 Bacteria 42039
178 Ga0207654_10019619 3300025911 Unclassified 3572
179 Ga0207654_10078301 3300025911 Bacteria 1983
180 Ga0207654_10080786 3300025911 Bacteria 1956
181 Ga0207707_10000002 3300025912 Bacteria 1142054
182 Ga0207707_10002189 3300025912 Bacteria 17706
183 Ga0207707_10059208 3300025912 Bacteria 3333
184 Ga0207707_10292885 3300025912 Bacteria 1408
185 Ga0207695_10000003 3300025913 Bacteria 1368691
186 Ga0207695_10007385 3300025913 Bacteria 14020
187 Ga0207695_10010291 3300025913 Bacteria 11454
188 Ga0207695_10011048 3300025913 Bacteria 10972
189 Ga0207695_10025890 3300025913 Bacteria 6556
190 Ga0207695_10032396 3300025913 Bacteria 5719
191 Ga0207695_10075727 3300025913 Bacteria 3423
192 Ga0207695_10170918 3300025913 Bacteria 2099
193 Ga0207695_10207821 3300025913 Bacteria 1870
194 Ga0207695_10450710 3300025913 Bacteria 1170
195 Ga0207671_10029810 3300025914 Bacteria 4073
196 Ga0207671_10294746 3300025914 Bacteria 1281
197 Ga0207671_10372563 3300025914 Bacteria 1134
198 Ga0207693_10000642 3300025915 Bacteria 31334
199 Ga0207663_10086852 3300025916 Bacteria 2064
200 Ga0207660_10000025 3300025917 Bacteria 69889
201 Ga0207660_10001422 3300025917 Bacteria 16050
202 Ga0207660_10120390 3300025917 Bacteria 1987
203 Ga0207660_10180538 3300025917 Bacteria 1639
204 Ga0207657_10000340 3300025919 Bacteria 49509
205 Ga0207657_10026872 3300025919 Bacteria 5279
206 Ga0207649_10005018 3300025920 Bacteria 7156
207 Ga0207649_10111658 3300025920 Bacteria 1827
208 Ga0207652_10000053 3300025921 Bacteria 118700
209 Ga0207652_10002223 3300025921 Bacteria 16560
210 Ga0207652_10112584 3300025921 Bacteria 2415
211 Ga0207652_10132590 3300025921 Bacteria 2223
212 Ga0207652_10203669 3300025921 Bacteria 1781
213 Ga0207694_10000016 3300025924 Bacteria 349087
214 Ga0207694_10014680 3300025924 Bacteria 5905
215 Ga0207694_10029649 3300025924 Bacteria 4176
216 Ga0207694_10042978 3300025924 Bacteria 3487
217 Ga0207694_10101120 3300025924 Bacteria 2284
218 Ga0207650_10154879 3300025925 Bacteria 1812
219 Ga0207650_10272045 3300025925 Bacteria 1377
220 Ga0207659_10155278 3300025926 Bacteria 1791
221 Ga0207659_10496739 3300025926 Bacteria 1032
222 Ga0207687_10093426 3300025927 Bacteria 2199
223 Ga0207687_10125123 3300025927 Bacteria 1929
224 Ga0207700_10784641 3300025928 Unclassified 852
225 Ga0207664_10020741 3300025929 Bacteria 4878
226 Ga0207664_10128516 3300025929 Bacteria 2130
227 Ga0207664_10424427 3300025929 Bacteria 1185
228 Ga0207690_10104411 3300025932 Bacteria 2030
229 Ga0207686_10189766 3300025934 Bacteria 1464
230 Ga0207686_10207874 3300025934 Bacteria 1406
231 Ga0207709_10046086 3300025935 Bacteria 2644
232 Ga0207704_10172186 3300025938 Bacteria 1554
233 Ga0207704_10385939 3300025938 Bacteria 1101
234 Ga0207691_10197725 3300025940 Bacteria 1751
235 Ga0207691_10553149 3300025940 Bacteria 976
236 Ga0207711_10000003 3300025941 Bacteria 1042791
237 Ga0207711_10000005 3300025941 Bacteria 822972
238 Ga0207711_10000009 3300025941 Bacteria 580864
239 Ga0207711_10120029 3300025941 Bacteria 2346
240 Ga0207689_10028364 3300025942 Bacteria 4683
241 Ga0207667_10000021 3300025949 Bacteria 370524
242 Ga0207667_10005118 3300025949 Bacteria 16010
243 Ga0207667_10017858 3300025949 Bacteria 7974
244 Ga0207667_10018481 3300025949 Bacteria 7815
245 Ga0207667_10048888 3300025949 Bacteria 4470
246 Ga0207667_10103984 3300025949 Bacteria 2929
247 Ga0207667_10118693 3300025949 Bacteria 2726
248 Ga0207651_10059000 3300025960 Bacteria 2655
249 Ga0207651_10134852 3300025960 Bacteria 1897
250 Ga0207651_10516007 3300025960 Bacteria 1035
251 Ga0207668_10436677 3300025972 Bacteria 1114
252 Ga0207640_10521508 3300025981 Unclassified 993
253 Ga0207677_10015479 3300026023 Bacteria 4489
254 Ga0207677_10021908 3300026023 Bacteria 3916
255 Ga0207703_10069002 3300026035 Bacteria 2914
256 Ga0207703_10846153 3300026035 Bacteria 875
257 Ga0207639_10000313 3300026041 Bacteria 34326
258 Ga0207639_10035827 3300026041 Bacteria 3674
259 Ga0207639_10136550 3300026041 Bacteria 2037
260 Ga0207702_10042811 3300026078 Bacteria 3800
261 Ga0207702_10155321 3300026078 Bacteria 2085
262 Ga0207648_10012605 3300026089 Bacteria 7910
263 Ga0207648_10029656 3300026089 Bacteria 4851
264 Ga0207648_10203602 3300026089 Bacteria 1756
265 Ga0207676_10197167 3300026095 Bacteria 1776
266 Ga0207674_10001294 3300026116 Bacteria 32678
267 Ga0207674_10100133 3300026116 Bacteria 2880
268 Ga0207674_10157852 3300026116 Bacteria 2223
269 Ga0207674_10266000 3300026116 Bacteria 1662
270 Ga0207683_10005021 3300026121 Bacteria 11364
271 Ga0207698_10060996 3300026142 Bacteria 2936
272 Ga0207698_10673232 3300026142 Bacteria 1027
273 Ga0268266_10000798 3300028379 Bacteria 41871
274 Ga0268266_10047464 3300028379 Bacteria 3679
275 Ga0268266_10073532 3300028379 Bacteria 2966
276 Ga0268266_10249420 3300028379 Bacteria 1641
277 Ga0268266_10382636 3300028379 Bacteria 1327
278 Ga0268265_10378513 3300028380 Bacteria 1301
279 Ga0265337_1005587 3300028556 Bacteria 4971
280 Ga0265318_10000025 3300028577 Bacteria 159237
281 Ga0265318_10023033 3300028577 Bacteria 2486
282 Ga0265338_10006695 3300028800 Bacteria 14564
283 Ga0265338_10010795 3300028800 Bacteria 10649
284 Ga0265338_10044953 3300028800 Bacteria 4068
285 Ga0265338_10118737 3300028800 Bacteria 2113
286 Ga0265330_10005963 3300031235 Bacteria 6031
287 Ga0265332_10049554 3300031238 Bacteria 1806
288 Ga0265320_10000042 3300031240 Bacteria 124844
289 Ga0265325_10001961 3300031241 Bacteria 14176
290 Ga0265325_10005186 3300031241 Bacteria 8095
291 Ga0265325_10015487 3300031241 Bacteria 4287
292 Ga0265325_10028393 3300031241 Bacteria 3017
293 Ga0265340_10000148 3300031247 Bacteria 35937
294 Ga0265340_10003723 3300031247 Bacteria 8584
295 Ga0265340_10057661 3300031247 Bacteria 1866
296 Ga0265340_10165813 3300031247 Bacteria 1002
297 Ga0265339_10009376 3300031249 Bacteria 6157
298 Ga0265339_10120678 3300031249 Bacteria 1348
299 Ga0265331_10006088 3300031250 Bacteria 7178
300 Ga0265327_10001912 3300031251 Bacteria 24043
301 Ga0265316_10021309 3300031344 Bacteria 5492
302 Ga0265316_10022960 3300031344 Bacteria 5249
303 Ga0265316_10049984 3300031344 Bacteria 3291
304 Ga0265316_10099720 3300031344 Bacteria 2209
305 Ga0265316_10447518 3300031344 Bacteria 926
306 Ga0265313_10002675 3300031595 Bacteria 15121
307 Ga0265313_10004479 3300031595 Bacteria 10698
308 Ga0265313_10007317 3300031595 Bacteria 7574
309 Ga0265313_10014330 3300031595 Bacteria 4690
310 Ga0265313_10017637 3300031595 Bacteria 4045
311 Ga0265313_10026788 3300031595 Bacteria 3030
312 Ga0265314_10000270 3300031711 Bacteria 76077
313 Ga0265314_10008851 3300031711 Bacteria 8596
314 Ga0265314_10034887 3300031711 Bacteria 3671
315 Ga0265314_10077398 3300031711 Bacteria 2206
316 Ga0265314_10105518 3300031711 Bacteria 1802
317 Ga0265314_10112996 3300031711 Bacteria 1723
318 Ga0265314_10220680 3300031711 Bacteria 1107
319 Ga0265342_10014816 3300031712 Bacteria 5160
320 Ga0265342_10148380 3300031712 Bacteria 1304
321 Ga0265342_10253682 3300031712 Bacteria 938
322 Ga0307516_10034940 3300031730 Bacteria 5047
323 Ga0307516_10132456 3300031730 Bacteria 2271
324 Ga0307416_100787215 3300032002 Bacteria 1046
325 Ga0373943_0046088 3300035170 Bacteria 2126
326 Ga0373935_0027045 3300035692 Bacteria 3546
327 Ga0373935_0147156 3300035692 Bacteria 1596
328 Ga0373947_0037403 3300035725 Unclassified 2880
329 Ga0373937_0004089 3300036401 Bacteria 12375
330 Ga0373937_0020860 3300036401 Bacteria 5877
331 Ga0373937_0116811 3300036401 Bacteria 2485
332 Ga0373937_0755065 3300036401 Bacteria 920
333 Ga0373925_0003173 3300037068 Bacteria 12858
334 Ga0373925_0416569 3300037068 Unclassified 1097
335 Ga0395900_0124077 3300037418 Bacteria 2649
336 Ga0395898_0011856 3300037466 Bacteria 9029
337 Ga0436365_0175907 3300039437 Bacteria 948
338 Ga0436365_0653879 3300039437 Bacteria 1100
339 Ga0436365_0775900 3300039437 Bacteria 2600
340 Ga0436365_1026614 3300039437 Bacteria 53933
341 Ga0436365_1612150 3300039437 Bacteria 85869
342 Ga0451795_0443194 3300041456 Bacteria 838
343 Ga0466957_0441159 3300044842 Bacteria 896
344 Ga0466967_0703321 3300045976 Bacteria 1001
345 Ga0495629_0247292 3300046459 Unclassified 1227
346 Ga0495580_0004755 3300046472 Bacteria 11363
347 Ga0495580_0382640 3300046472 Bacteria 950
348 Ga0495662_0053494 3300046476 Bacteria 1950
349 Ga0495664_0026019 3300046477 Bacteria 3407
350 Ga0495585_0057097 3300046492 Bacteria 2155
351 Ga0495585_0060782 3300046492 Bacteria 2079
352 Ga0495583_0105729 3300046506 Bacteria 1197
353 Ga0495652_0045866 3300046529 Bacteria 3755
354 Ga0495652_0075765 3300046529 Bacteria 2793
355 Ga0495652_0350886 3300046529 Bacteria 1057
356 Ga0495665_0030720 3300046531 Bacteria 2875
357 Ga0495586_0151161 3300046535 Bacteria 1306
358 Ga0495645_0055700 3300046543 Bacteria 2871
359 Ga0495645_0217706 3300046543 Bacteria 1286
360 Ga0495622_0001592 3300046557 Bacteria 11217
361 Ga0495656_0061626 3300046615 Bacteria 1639
362 Ga0495658_0024102 3300046683 Bacteria 3237
363 Ga0495658_0214357 3300046683 Bacteria 1204
364 Ga0495670_0052116 3300046691 Bacteria 2048
365 Ga0495649_0127815 3300046694 Bacteria 1342
366 Ga0495636_0171194 3300047318 Bacteria 982
367 Ga0495680_0383793 3300047322 Bacteria 973
368 Ga0495675_0024360 3300047444 Bacteria 3858
369 Ga0495677_0102809 3300047445 Bacteria 1083
370 Ga0495684_0110642 3300047471 Bacteria 2073
371 Ga0496120_0135487 3300048923 Bacteria 1256
372 Ga0501031_0030012 3300049568 Bacteria 3546
373 Ga0501032_0040050 3300049569 Bacteria 3185
374 Ga0501032_0114940 3300049569 Bacteria 1780
375 Ga0501032_0133286 3300049569 Bacteria 1638
376 Ga0501032_0280704 3300049569 Bacteria 1078
377 Ga0501033_0030403 3300049570 Bacteria 4059
378 Ga0501033_0031416 3300049570 Bacteria 3990
379 Ga0501033_0056990 3300049570 Bacteria 2888
380 Ga0501033_0060877 3300049570 Bacteria 2783
381 Ga0501033_0174081 3300049570 Bacteria 1545
382 Ga0501033_0387637 3300049570 Bacteria 976
383 Ga0501034_0009345 3300049571 Bacteria 10273
384 Ga0501034_0223983 3300049571 Bacteria 1832
385 Ga0501034_0256589 3300049571 Bacteria 1692
386 Ga0501034_0310913 3300049571 Bacteria 1510
387 Ga0501034_0422277 3300049571 Bacteria 1254
388 Ga0501036_0027545 3300049572 Bacteria 4801
389 Ga0501036_0096989 3300049572 Bacteria 2493
390 Ga0501037_0054376 3300049573 Bacteria 2927
391 Ga0501037_0123165 3300049573 Bacteria 1863
392 Ga0501037_0211706 3300049573 Bacteria 1367
393 Ga0501037_0322521 3300049573 Bacteria 1069
394 Ga0501038_0038675 3300049574 Bacteria 4176
395 Ga0501038_0104067 3300049574 Bacteria 2359
396 Ga0501038_0149190 3300049574 Bacteria 1907
397 Ga0501039_0029398 3300049575 Bacteria 4232
398 Ga0501039_0353999 3300049575 Bacteria 1154
399 Ga0501043_0031186 3300049579 Bacteria 4191
400 Ga0501043_0174920 3300049579 Bacteria 1674
401 Ga0501043_0547646 3300049579 Bacteria 860
402 Ga0501046_0001673 3300049580 Bacteria 21221
403 Ga0501046_0003387 3300049580 Bacteria 14627
404 Ga0501046_0245152 3300049580 Bacteria 1320
405 Ga0501047_0001962 3300049581 Bacteria 19762
406 Ga0501047_0015028 3300049581 Bacteria 7368
407 Ga0501047_0042202 3300049581 Bacteria 4408
408 Ga0501047_0044821 3300049581 Bacteria 4274
409 Ga0501047_0064842 3300049581 Bacteria 3523
410 Ga0501047_0528223 3300049581 Bacteria 1005
411 Ga0501048_0008824 3300049582 Bacteria 7593
412 Ga0501048_0181740 3300049582 Bacteria 1491
413 Ga0501067_0001033 3300049583 Bacteria 14971
414 Ga0501067_0002421 3300049583 Bacteria 10306
415 Ga0501067_0005428 3300049583 Bacteria 7078
416 Ga0501067_0320832 3300049583 Bacteria 863
417 Ga0501068_0004638 3300049584 Bacteria 7480
418 Ga0501068_0142816 3300049584 Bacteria 1501
419 Ga0501069_0005020 3300049585 Bacteria 6866
420 Ga0501069_0015102 3300049585 Bacteria 4137
421 Ga0501069_0115094 3300049585 Bacteria 1534
422 Ga0501070_0000002 3300049586 Bacteria 347524
423 Ga0501070_0013327 3300049586 Bacteria 6933
424 Ga0501070_0061566 3300049586 Bacteria 3109
425 Ga0501070_0073465 3300049586 Bacteria 2830
426 Ga0501070_0112840 3300049586 Bacteria 2246
427 Ga0501070_0159223 3300049586 Bacteria 1862
428 Ga0501072_0023947 3300049588 Bacteria 4745
429 Ga0501072_0024632 3300049588 Bacteria 4684
430 Ga0501073_0005990 3300049589 Bacteria 9072
431 Ga0501073_0030129 3300049589 Bacteria 3875
432 Ga0501073_0040588 3300049589 Bacteria 3292
433 Ga0501073_0134432 3300049589 Bacteria 1714
434 Ga0501073_0341895 3300049589 Bacteria 1033
435 Ga0501074_0004607 3300049590 Bacteria 9872
436 Ga0501079_0028598 3300049741 Bacteria 4278
437 Ga0501079_0346725 3300049741 Bacteria 1163
438 Ga0501080_0000572 3300049742 Bacteria 29159
439 Ga0501080_0016569 3300049742 Bacteria 6808
440 Ga0501080_0063447 3300049742 Bacteria 3439
441 Ga0501080_0119643 3300049742 Bacteria 2441
442 Ga0501080_0120221 3300049742 Bacteria 2435
443 Ga0501080_0331403 3300049742 Bacteria 1376
444 Ga0501080_0614713 3300049742 Bacteria 964
445 Ga0501083_0015277 3300049744 Bacteria 5377
446 Ga0501083_0402679 3300049744 Bacteria 890
447 Ga0501083_0455996 3300049744 Bacteria 832
448 Ga0501035_0000579 3300049822 Bacteria 40337
449 Ga0501035_0004197 3300049822 Bacteria 13693
450 Ga0501035_0006818 3300049822 Bacteria 10671
451 Ga0501035_0032458 3300049822 Bacteria 4750
452 Ga0501035_0032960 3300049822 Bacteria 4712
453 Ga0501035_0066754 3300049822 Bacteria 3192
454 Ga0501035_0073234 3300049822 Bacteria 3031
455 Ga0501035_0105036 3300049822 Bacteria 2477
456 Ga0501035_0156637 3300049822 Bacteria 1974
457 Ga0501035_0178622 3300049822 Bacteria 1830
458 Ga0501035_0185194 3300049822 Bacteria 1792
459 Ga0501035_0730449 3300049822 Bacteria 796
460 Ga0501044_0001067 3300049823 Bacteria 32903
461 Ga0501044_0001467 3300049823 Bacteria 27692
462 Ga0501044_0025362 3300049823 Bacteria 6283
463 Ga0501044_0036599 3300049823 Bacteria 5134
464 Ga0501044_0063308 3300049823 Bacteria 3779
465 Ga0501044_0066375 3300049823 Bacteria 3679
466 Ga0501044_0088972 3300049823 Bacteria 3117
467 Ga0501044_0095622 3300049823 Bacteria 2993
468 Ga0501044_0098557 3300049823 Bacteria 2942
469 Ga0501044_0156149 3300049823 Bacteria 2261
470 Ga0501044_0298988 3300049823 Bacteria 1539
471 Ga0501044_0320189 3300049823 Bacteria 1475
472 Ga0501044_0407847 3300049823 Bacteria 1270
473 Ga0501045_0020340 3300049824 Bacteria 4741
474 nmdc:mga06r32_164344_c1 3300050510 Bacteria 2202
475 nmdc:mga08y16_106388_c1 3300050511 Bacteria 2920
476 nmdc:mga08x19_7796_c1 3300050514 Bacteria 6360
477 Ga0500643_000003 3300053087 Bacteria 876659
478 Ga0500555_035395 3300053103 Bacteria 1403
479 Ga0500595_001067 3300053119 Bacteria 15236
480 Ga0500559_0051327 3300053136 Bacteria 1821
481 Ga0500568_0036891 3300053139 Bacteria 1986
482 Ga0500573_0000002 3300053140 Bacteria 407088
483 Ga0500639_102674 3300053163 Bacteria 1404
484 Ga0501084_0000324 3300054114 Bacteria 36445
485 Ga0501084_0006410 3300054114 Bacteria 9672
486 Ga0501084_0035218 3300054114 Bacteria 4185
487 Ga0501082_0034595 3300060353 Bacteria 4354
488 Ga0501082_0161689 3300060353 Bacteria 1946
489 Ga0070696_100102222
490 JGI25165J46597_1000003
491 JGI25153J46596_10002369
492 rootH2_10023555
493 Ga0070658_10085027
494 Ga0070658_10225747
495 Ga0070683_100102947
496 Ga0070683_100109249
497 Ga0070690_100066499
498 Ga0070670_100127869
499 Ga0070670_100485012
500 Ga0070666_10008749
501 Ga0070680_100001314
502 Ga0070680_100004447
503 Ga0070680_100226154
504 Ga0068868_100074299
505 Ga0068868_100083199
506 Ga0070660_100002648
507 Ga0070660_100017800
508 Ga0070660_100208803
509 Ga0070691_10005809
510 Ga0070668_100394333
511 Ga0070675_100104054
512 Ga0070674_100208023
513 Ga0070673_100060623
514 Ga0070659_100007738
515 Ga0070667_100007992
516 Ga0070667_100420082
517 Ga0070709_10357823
518 Ga0070714_100056078
519 Ga0070714_100239039
520 Ga0070713_100000008
521 Ga0070713_100323884
522 Ga0070710_10100954
523 Ga0070663_100148770
524 Ga0070678_100063751
525 Ga0070678_100197305
526 Ga0070681_10000002
527 Ga0070681_10048260
528 Ga0070681_10051067
529 Ga0070681_10076160
530 Ga0070681_10175822
531 Ga0068867_100032226
532 Ga0068867_100063019
533 Ga0068867_100327608
534 Ga0070699_100215215
535 Ga0070679_100000062
536 Ga0070679_100037974
537 Ga0070679_100077450
538 Ga0070679_100135633
539 Ga0070679_100147657
540 Ga0070679_100250633
541 Ga0070684_100156357
542 Ga0068853_100000341
543 Ga0070672_100184388
544 Ga0070696_100448941
545 Ga0070693_100011272
546 Ga0070665_100001163
547 Ga0070665_100011628
548 Ga0070665_100034336
549 Ga0070665_100043938
550 Ga0070665_100146348
551 Ga0068855_100011332
552 Ga0068855_100021405
553 Ga0068855_100189368
554 Ga0068855_100488437
555 Ga0068855_100701008
556 Ga0068857_100001169
557 Ga0068856_100001117
558 Ga0068856_100037401
559 Ga0068856_100186102
560 Ga0068856_100407617
561 Ga0068852_100024332
562 Ga0068852_100032685
563 Ga0068852_100274786
564 Ga0068859_100543065
565 Ga0068851_10104220
566 Ga0068870_10121082
567 Ga0068863_100100964
568 Ga0068858_100110206
569 Ga0070712_100000202
570 Ga0070712_100017546
571 Ga0097621_100000230
572 Ga0097621_100119106
573 Ga0097621_100314641
574 Ga0097621_100406664
575 Ga0068871_100000019
576 Ga0068871_100034446
577 Ga0068871_100470075
578 Ga0075428_100085322
579 Ga0075431_100167307
580 Ga0075434_100146800
581 Ga0068865_100051498
582 Ga0068865_100279805
583 Ga0075436_100000053
584 Ga0075436_100033695
585 Ga0097620_100542990
586 Ga0075435_100160948
587 Ga0099795_10030824
588 Ga0105240_10000132
589 Ga0105240_10067704
590 Ga0105240_10100451
591 Ga0105240_10236045
592 Ga0105240_10263943
593 Ga0105240_10421024
594 Ga0105240_10523396
595 Ga0111539_10128144
596 Ga0105245_10052641
597 Ga0105245_10618326
598 Ga0105243_10019334
599 Ga0105241_10076237
600 Ga0105241_10149745
601 Ga0105242_10257101
602 Ga0105242_10397409
603 Ga0105248_10000015
604 Ga0105237_10056167
605 Ga0105237_10227057
606 Ga0105237_10379895
607 Ga0105238_10007262
608 Ga0105238_10053870
609 Ga0105238_10057605
610 Ga0105238_10516014
611 Ga0105249_10089120
612 Ga0105239_10002163
613 Ga0105239_10025555
614 Ga0105239_10041722
615 Ga0105239_10132703
616 Ga0105239_10225159
617 Ga0105246_10013883
618 Ga0105246_10031645
619 Ga0105246_10116081
620 Ga0157373_10103527
621 Ga0157373_10103913
622 Ga0157370_10057064
623 Ga0157370_10143423
624 Ga0157370_10266871
625 Ga0157369_10015232
626 Ga0157369_10049909
627 Ga0157369_10186388
628 Ga0157369_10250358
629 Ga0157374_10030873
630 Ga0157378_10077387
631 Ga0157378_10117129
632 Ga0157378_10207455
633 Ga0157378_10230878
634 Ga0163162_10017760
635 Ga0163162_10037780
636 Ga0163162_10071602
637 Ga0157372_10018261
638 Ga0157372_10031080
639 Ga0157372_10034088
640 Ga0157372_10065869
641 Ga0157372_10636364
642 Ga0157372_10715123
643 Ga0157375_10250756
644 Ga0163163_10000002
645 Ga0163163_10144952
646 Ga0157380_10315686
647 Ga0157377_10089815
648 Ga0157379_10000040
649 Ga0157379_10014098
650 Ga0157379_10014253
651 Ga0157379_10249759
652 Ga0157376_10031482
653 Ga0157376_10225077
654 Ga0157376_10266858
655 Ga0163161_10021014
656 Ga0209233_1000015
657 Ga0209233_1040654
658 Ga0209758_1000013
659 Ga0209758_1058383
660 Ga0207680_10002508
661 Ga0207680_10012045
662 Ga0207680_10072042
663 Ga0207645_10233019
664 Ga0207643_10067754
665 Ga0207705_10000343
666 Ga0207654_10019619
667 Ga0207654_10078301
668 Ga0207654_10080786
669 Ga0207707_10000002
670 Ga0207707_10002189
671 Ga0207707_10059208
672 Ga0207707_10292885
673 Ga0207695_10000003
674 Ga0207695_10007385
675 Ga0207695_10010291
676 Ga0207695_10011048
677 Ga0207695_10025890
678 Ga0207695_10032396
679 Ga0207695_10075727
680 Ga0207695_10170918
681 Ga0207695_10207821
682 Ga0207695_10450710
683 Ga0207671_10029810
684 Ga0207671_10294746
685 Ga0207671_10372563
686 Ga0207693_10000642
687 Ga0207663_10086852
688 Ga0207660_10000025
689 Ga0207660_10001422
690 Ga0207660_10120390
691 Ga0207660_10180538
692 Ga0207657_10000340
693 Ga0207657_10026872
694 Ga0207649_10005018
695 Ga0207649_10111658
696 Ga0207652_10000053
697 Ga0207652_10002223
698 Ga0207652_10112584
699 Ga0207652_10132590
700 Ga0207652_10203669
701 Ga0207694_10000016
702 Ga0207694_10014680
703 Ga0207694_10029649
704 Ga0207694_10042978
705 Ga0207694_10101120
706 Ga0207650_10154879
707 Ga0207650_10272045
708 Ga0207659_10155278
709 Ga0207659_10496739
710 Ga0207687_10093426
711 Ga0207687_10125123
712 Ga0207700_10784641
713 Ga0207664_10020741
714 Ga0207664_10128516
715 Ga0207664_10424427
716 Ga0207690_10104411
717 Ga0207686_10189766
718 Ga0207686_10207874
719 Ga0207709_10046086
720 Ga0207704_10172186
721 Ga0207704_10385939
722 Ga0207691_10197725
723 Ga0207691_10553149
724 Ga0207711_10000003
725 Ga0207711_10000005
726 Ga0207711_10000009
727 Ga0207711_10120029
728 Ga0207689_10028364
729 Ga0207667_10000021
730 Ga0207667_10005118
731 Ga0207667_10017858
732 Ga0207667_10018481
733 Ga0207667_10048888
734 Ga0207667_10103984
735 Ga0207667_10118693
736 Ga0207651_10059000
737 Ga0207651_10134852
738 Ga0207651_10516007
739 Ga0207668_10436677
740 Ga0207640_10521508
741 Ga0207677_10015479
742 Ga0207677_10021908
743 Ga0207703_10069002
744 Ga0207703_10846153
745 Ga0207639_10000313
746 Ga0207639_10035827
747 Ga0207639_10136550
748 Ga0207702_10042811
749 Ga0207702_10155321
750 Ga0207648_10012605
751 Ga0207648_10029656
752 Ga0207648_10203602
753 Ga0207676_10197167
754 Ga0207674_10001294
755 Ga0207674_10100133
756 Ga0207674_10157852
757 Ga0207674_10266000
758 Ga0207683_10005021
759 Ga0207698_10060996
760 Ga0207698_10673232
761 Ga0268266_10000798
762 Ga0268266_10047464
763 Ga0268266_10073532
764 Ga0268266_10249420
765 Ga0268266_10382636
766 Ga0268265_10378513
767 Ga0265337_1005587
768 Ga0265318_10000025
769 Ga0265318_10023033
770 Ga0265338_10006695
771 Ga0265338_10010795
772 Ga0265338_10044953
773 Ga0265338_10118737
774 Ga0265330_10005963
775 Ga0265332_10049554
776 Ga0265320_10000042
777 Ga0265325_10001961
778 Ga0265325_10005186
779 Ga0265325_10015487
780 Ga0265325_10028393
781 Ga0265340_10000148
782 Ga0265340_10003723
783 Ga0265340_10057661
784 Ga0265340_10165813
785 Ga0265339_10009376
786 Ga0265339_10120678
787 Ga0265331_10006088
788 Ga0265327_10001912
789 Ga0265316_10021309
790 Ga0265316_10022960
791 Ga0265316_10049984
792 Ga0265316_10099720
793 Ga0265316_10447518
794 Ga0265313_10002675
795 Ga0265313_10004479
796 Ga0265313_10007317
797 Ga0265313_10014330
798 Ga0265313_10017637
799 Ga0265313_10026788
800 Ga0265314_10000270
801 Ga0265314_10008851
802 Ga0265314_10034887
803 Ga0265314_10077398
804 Ga0265314_10105518
805 Ga0265314_10112996
806 Ga0265314_10220680
807 Ga0265342_10014816
808 Ga0265342_10148380
809 Ga0265342_10253682
810 Ga0307516_10034940
811 Ga0307516_10132456
812 Ga0307416_100787215
813 Ga0373943_0046088
814 Ga0373935_0027045
815 Ga0373935_0147156
816 Ga0373947_0037403
817 Ga0373937_0004089
818 Ga0373937_0020860
819 Ga0373937_0116811
820 Ga0373937_0755065
821 Ga0373925_0003173
822 Ga0373925_0416569
823 Ga0395900_0124077
824 Ga0395898_0011856
825 Ga0436365_0175907
826 Ga0436365_0653879
827 Ga0436365_0775900
828 Ga0436365_1026614
829 Ga0436365_1612150
830 Ga0451795_0443194
831 Ga0466957_0441159
832 Ga0466967_0703321
833 Ga0495629_0247292
834 Ga0495580_0004755
835 Ga0495580_0382640
836 Ga0495662_0053494
837 Ga0495664_0026019
838 Ga0495585_0057097
839 Ga0495585_0060782
840 Ga0495583_0105729
841 Ga0495652_0045866
842 Ga0495652_0075765
843 Ga0495652_0350886
844 Ga0495665_0030720
845 Ga0495586_0151161
846 Ga0495645_0055700
847 Ga0495645_0217706
848 Ga0495622_0001592
849 Ga0495656_0061626
850 Ga0495658_0024102
851 Ga0495658_0214357
852 Ga0495670_0052116
853 Ga0495649_0127815
854 Ga0495636_0171194
855 Ga0495680_0383793
856 Ga0495675_0024360
857 Ga0495677_0102809
858 Ga0495684_0110642
859 Ga0496120_0135487
860 Ga0501031_0030012
861 Ga0501032_0040050
862 Ga0501032_0114940
863 Ga0501032_0133286
864 Ga0501032_0280704
865 Ga0501033_0030403
866 Ga0501033_0031416
867 Ga0501033_0056990
868 Ga0501033_0060877
869 Ga0501033_0174081
870 Ga0501033_0387637
871 Ga0501034_0009345
872 Ga0501034_0223983
873 Ga0501034_0256589
874 Ga0501034_0310913
875 Ga0501034_0422277
876 Ga0501036_0027545
877 Ga0501036_0096989
878 Ga0501037_0054376
879 Ga0501037_0123165
880 Ga0501037_0211706
881 Ga0501037_0322521
882 Ga0501038_0038675
883 Ga0501038_0104067
884 Ga0501038_0149190
885 Ga0501039_0029398
886 Ga0501039_0353999
887 Ga0501043_0031186
888 Ga0501043_0174920
889 Ga0501043_0547646
890 Ga0501046_0001673
891 Ga0501046_0003387
892 Ga0501046_0245152
893 Ga0501047_0001962
894 Ga0501047_0015028
895 Ga0501047_0042202
896 Ga0501047_0044821
897 Ga0501047_0064842
898 Ga0501047_0528223
899 Ga0501048_0008824
900 Ga0501048_0181740
901 Ga0501067_0001033
902 Ga0501067_0002421
903 Ga0501067_0005428
904 Ga0501067_0320832
905 Ga0501068_0004638
906 Ga0501068_0142816
907 Ga0501069_0005020
908 Ga0501069_0015102
909 Ga0501069_0115094
910 Ga0501070_0000002
911 Ga0501070_0013327
912 Ga0501070_0061566
913 Ga0501070_0073465
914 Ga0501070_0112840
915 Ga0501070_0159223
916 Ga0501072_0023947
917 Ga0501072_0024632
918 Ga0501073_0005990
919 Ga0501073_0030129
920 Ga0501073_0040588
921 Ga0501073_0134432
922 Ga0501073_0341895
923 Ga0501074_0004607
924 Ga0501079_0028598
925 Ga0501079_0346725
926 Ga0501080_0000572
927 Ga0501080_0016569
928 Ga0501080_0063447
929 Ga0501080_0119643
930 Ga0501080_0120221
931 Ga0501080_0331403
932 Ga0501080_0614713
933 Ga0501083_0015277
934 Ga0501083_0402679
935 Ga0501083_0455996
936 Ga0501035_0000579
937 Ga0501035_0004197
938 Ga0501035_0006818
939 Ga0501035_0032458
940 Ga0501035_0032960
941 Ga0501035_0066754
942 Ga0501035_0073234
943 Ga0501035_0105036
944 Ga0501035_0156637
945 Ga0501035_0178622
946 Ga0501035_0185194
947 Ga0501035_0730449
948 Ga0501044_0001067
949 Ga0501044_0001467
950 Ga0501044_0025362
951 Ga0501044_0036599
952 Ga0501044_0063308
953 Ga0501044_0066375
954 Ga0501044_0088972
955 Ga0501044_0095622
956 Ga0501044_0098557
957 Ga0501044_0156149
958 Ga0501044_0298988
959 Ga0501044_0320189
960 Ga0501044_0407847
961 Ga0501045_0020340
962 nmdc:mga06r32_164344_c1
963 nmdc:mga08y16_106388_c1
964 nmdc:mga08x19_7796_c1
965 Ga0500643_000003
966 Ga0500555_035395
967 Ga0500595_001067
968 Ga0500559_0051327
969 Ga0500568_0036891
970 Ga0500573_0000002
971 Ga0500639_102674
972 Ga0501084_0000324
973 Ga0501084_0006410
974 Ga0501084_0035218
975 Ga0501082_0034595
976 Ga0501082_0161689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04376

ATE_N

Arginine-tRNA-protein transferase, N terminus

34

104

0.99

PF04377

ATE_C

Arginine-tRNA-protein transferase, C terminus

124

252

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j6v-assembly1.cif.gz_A structure of yeast arginyl-trna-protein transferase 1 0.7944 27 209
7wg4-assembly1.cif.gz_A dvaa-klate1 0.7848 26 238
7wg2-assembly1.cif.gz_A evaa-klate1 0.7845 26 238
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.7845 145 206
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.7841 145 206
ID Description Score Start End Superfamily
af_P90914_254_388_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8535 110 226 3.40.630.30
af_Q9C776_322_467_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8362 109 226 3.40.630.30
af_A0A1D8PG12_149_290_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8036 110 224 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7909 147 201 3.40.630.30
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7668 106 226 3.40.50.1820
ID Description Score Start End GO Terms
AF-A4EV57-F1-model_v4 Arginyl-tRNA-protein transferase 0.9423 72 240 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A182D3P8-F1-model_v4 Arginine-tRNA-protein transferase 0.9356 129 240 GO:0004057
GO:0005737
AF-A0A1W4UBP7-F1-model_v4 deleted 0.9334 79 240
AF-A0A848YN14-F1-model_v4 Arginyl-transferase family protein 0.9333 64 239 GO:0004057
GO:0005737
AF-W1KYX4-F1-model_v4 deleted 0.9273 59 240

Map