F453476

General Info

Members Datasets Scaffolds Average Seq Length
487 245 974 202

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0095316|Ga0395900_0095316_80_736
Length 218
Sequence LRQIRRLEPVRLADYNKVVYDVFKTRYEFACPERGEARVALSSFRRIEQLPGAAHPAVYEVAFDCGCGGRHPGLVTHEELDWAPLGLGEGVFLNLMTAKLDRLEDELADLAARKIQAGEWPWSFFCYPEERPRPIFPSSFFLLAPAADGGSVGIAVRCPVCGSVSVNLVSAEHVDLPFHNDAEVGVVEHVFAADADRVVDEFTSELYSGHFDARRLGL

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.55
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 8.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0095316 3300037418 Bacteria 3058
2 Ga0070676_10685332 3300005328 Unclassified 747
3 Ga0070683_100029653 3300005329 Bacteria 4957
4 Ga0070683_100243377 3300005329 Bacteria 1711
5 Ga0070683_100728212 3300005329 Unclassified 950
6 Ga0070690_100030426 3300005330 Bacteria 3354
7 Ga0070690_100032470 3300005330 Bacteria 3261
8 Ga0070680_100135090 3300005336 Bacteria 2066
9 Ga0068868_100021337 3300005338 Bacteria 4877
10 Ga0068868_100065453 3300005338 Bacteria 2888
11 Ga0068868_100282425 3300005338 Bacteria 1405
12 Ga0070660_100015792 3300005339 Bacteria 5462
13 Ga0070660_100056838 3300005339 Bacteria 3028
14 Ga0070689_100430978 3300005340 Bacteria 1119
15 Ga0070691_10037542 3300005341 Bacteria 2286
16 Ga0070661_100257748 3300005344 Unclassified 1347
17 Ga0070692_10065909 3300005345 Bacteria 1918
18 Ga0070668_100022054 3300005347 Bacteria 4814
19 Ga0070671_100109526 3300005355 Bacteria 2320
20 Ga0070671_100292196 3300005355 Bacteria 1387
21 Ga0070673_100130052 3300005364 Bacteria 2111
22 Ga0070688_100275356 3300005365 Bacteria 1207
23 Ga0070659_100186139 3300005366 Bacteria 1705
24 Ga0070659_100217171 3300005366 Bacteria 1577
25 Ga0070703_10029095 3300005406 Bacteria 1656
26 Ga0070709_10009177 3300005434 Bacteria 5445
27 Ga0070709_10024822 3300005434 Bacteria 3534
28 Ga0070714_100038774 3300005435 Bacteria 4007
29 Ga0070714_100158537 3300005435 Bacteria 2045
30 Ga0070714_100632413 3300005435 Unclassified 1029
31 Ga0070713_100041201 3300005436 Bacteria 3761
32 Ga0070713_100263925 3300005436 Bacteria 1574
33 Ga0070710_10051464 3300005437 Bacteria 2312
34 Ga0070710_10092614 3300005437 Bacteria 1785
35 Ga0070710_10119152 3300005437 Bacteria 1595
36 Ga0070711_100054240 3300005439 Bacteria 2766
37 Ga0070711_100145530 3300005439 Bacteria 1782
38 Ga0070711_100224802 3300005439 Bacteria 1461
39 Ga0070705_100013196 3300005440 Bacteria 4220
40 Ga0070705_100064216 3300005440 Bacteria 2192
41 Ga0070705_100068124 3300005440 Unclassified 2141
42 Ga0070705_100091597 3300005440 Bacteria 1896
43 Ga0070705_100396590 3300005440 Unclassified 1021
44 Ga0070700_100187341 3300005441 Bacteria 1444
45 Ga0070700_100233865 3300005441 Bacteria 1309
46 Ga0070694_100021140 3300005444 Bacteria 4155
47 Ga0070694_100097762 3300005444 Bacteria 2071
48 Ga0070694_100361092 3300005444 Unclassified 1128
49 Ga0070694_100384540 3300005444 Bacteria 1095
50 Ga0070708_100124729 3300005445 Bacteria 2379
51 Ga0070708_100536677 3300005445 Bacteria 1103
52 Ga0070678_100090602 3300005456 Bacteria 2344
53 Ga0070662_100017440 3300005457 Bacteria 4842
54 Ga0070662_100082784 3300005457 Bacteria 2393
55 Ga0070681_10005563 3300005458 Bacteria 12170
56 Ga0070681_10015890 3300005458 Bacteria 7505
57 Ga0068867_100097261 3300005459 Bacteria 2242
58 Ga0070685_10065405 3300005466 Bacteria 2140
59 Ga0070706_100004250 3300005467 Bacteria 13897
60 Ga0070706_100182334 3300005467 Bacteria 1960
61 Ga0070706_100189542 3300005467 Bacteria 1921
62 Ga0070706_100398621 3300005467 Bacteria 1281
63 Ga0070707_100011707 3300005468 Bacteria 8187
64 Ga0070707_100590009 3300005468 Unclassified 1073
65 Ga0070707_100790699 3300005468 Unclassified 912
66 Ga0070707_101139771 3300005468 Unclassified 746
67 Ga0070698_100012522 3300005471 Bacteria 8981
68 Ga0070698_100018669 3300005471 Bacteria 7300
69 Ga0070698_100149878 3300005471 Bacteria 2280
70 Ga0070698_100414219 3300005471 Bacteria 1281
71 Ga0070699_100042554 3300005518 Bacteria 3931
72 Ga0070699_100046359 3300005518 Bacteria 3761
73 Ga0070699_100269151 3300005518 Bacteria 1524
74 Ga0070679_100028786 3300005530 Bacteria 5479
75 Ga0070684_100094323 3300005535 Bacteria 2665
76 Ga0070684_100536011 3300005535 Unclassified 1086
77 Ga0070697_100537186 3300005536 Bacteria 1024
78 Ga0068853_100288168 3300005539 Bacteria 1515
79 Ga0070686_100035224 3300005544 Bacteria 3090
80 Ga0070695_100038132 3300005545 Bacteria 3031
81 Ga0070695_100139720 3300005545 Bacteria 1678
82 Ga0070695_100341201 3300005545 Bacteria 1119
83 Ga0070696_100027367 3300005546 Bacteria 3884
84 Ga0070696_100219868 3300005546 Bacteria 1425
85 Ga0070696_100616791 3300005546 Bacteria 876
86 Ga0070693_100000955 3300005547 Bacteria 12824
87 Ga0070693_100007441 3300005547 Bacteria 5354
88 Ga0070693_100010299 3300005547 Bacteria 4681
89 Ga0070693_100257023 3300005547 Bacteria 1160
90 Ga0070704_100503301 3300005549 Bacteria 1051
91 Ga0070704_100586007 3300005549 Bacteria 978
92 Ga0070704_100701470 3300005549 Bacteria 897
93 Ga0068855_100106370 3300005563 Bacteria 3225
94 Ga0068855_100272815 3300005563 Bacteria 1880
95 Ga0068855_100303325 3300005563 Bacteria 1768
96 Ga0070664_100575856 3300005564 Bacteria 1043
97 Ga0070664_100583733 3300005564 Bacteria 1036
98 Ga0070664_100592991 3300005564 Bacteria 1027
99 Ga0068854_100041637 3300005578 Bacteria 3247
100 Ga0068856_100009373 3300005614 Bacteria 9508
101 Ga0068856_100167748 3300005614 Bacteria 2207
102 Ga0068856_100711384 3300005614 Bacteria 1025
103 Ga0070702_100004649 3300005615 Bacteria 6294
104 Ga0070702_100029577 3300005615 Bacteria 2981
105 Ga0070702_100139886 3300005615 Bacteria 1540
106 Ga0068864_100185310 3300005618 Bacteria 1905
107 Ga0068864_100374615 3300005618 Bacteria 1348
108 Ga0068861_100417167 3300005719 Bacteria 1195
109 Ga0068863_100233360 3300005841 Bacteria 1775
110 Ga0081455_10005540 3300005937 Bacteria 13828
111 Ga0081455_10024075 3300005937 Bacteria 5648
112 Ga0081540_1002560 3300005983 Bacteria 14749
113 Ga0081540_1003067 3300005983 Bacteria 13383
114 Ga0081540_1012281 3300005983 Bacteria 5654
115 Ga0070717_10027966 3300006028 Bacteria 4510
116 Ga0070717_10053896 3300006028 Bacteria 3316
117 Ga0070717_10070065 3300006028 Bacteria 2921
118 Ga0075432_10006518 3300006058 Bacteria 3975
119 Ga0075432_10083487 3300006058 Bacteria 1161
120 Ga0075432_10103254 3300006058 Bacteria 1055
121 Ga0070715_10001178 3300006163 Bacteria 7508
122 Ga0070715_10021794 3300006163 Bacteria 2490
123 Ga0070715_10111757 3300006163 Bacteria 1290
124 Ga0070716_100123572 3300006173 Bacteria 1624
125 Ga0070716_100191068 3300006173 Bacteria 1353
126 Ga0070716_100426342 3300006173 Unclassified 961
127 Ga0070712_100002050 3300006175 Bacteria 12332
128 Ga0070712_100029726 3300006175 Bacteria 3665
129 Ga0070712_100045451 3300006175 Bacteria 3032
130 Ga0097621_100176659 3300006237 Bacteria 1843
131 Ga0068871_100009711 3300006358 Bacteria 6985
132 Ga0075428_100068886 3300006844 Bacteria 3870
133 Ga0075428_100111253 3300006844 Bacteria 2984
134 Ga0075431_100079348 3300006847 Bacteria 3388
135 Ga0075431_100283699 3300006847 Bacteria 1677
136 Ga0075433_10004549 3300006852 Bacteria 10816
137 Ga0075433_10039097 3300006852 Bacteria 4100
138 Ga0075434_100068369 3300006871 Bacteria 3538
139 Ga0075434_100214392 3300006871 Bacteria 1945
140 Ga0075434_100254003 3300006871 Bacteria 1777
141 Ga0075434_100561108 3300006871 Unclassified 1161
142 Ga0075429_100129439 3300006880 Bacteria 2208
143 Ga0068865_100014843 3300006881 Bacteria 4957
144 Ga0075436_100000947 3300006914 Bacteria 19413
145 Ga0075436_100007807 3300006914 Bacteria 7318
146 Ga0075436_100011264 3300006914 Bacteria 6134
147 Ga0075436_100014628 3300006914 Bacteria 5378
148 Ga0075435_100013944 3300007076 Bacteria 5994
149 Ga0075435_100026919 3300007076 Bacteria 4492
150 Ga0105240_10086768 3300009093 Bacteria 3833
151 Ga0111539_10045344 3300009094 Bacteria 5263
152 Ga0111539_10247440 3300009094 Bacteria 2076
153 Ga0111539_10442600 3300009094 Bacteria 1513
154 Ga0105245_10017950 3300009098 Bacteria 6179
155 Ga0105245_10022625 3300009098 Bacteria 5518
156 Ga0105245_10094899 3300009098 Bacteria 2750
157 Ga0105245_10169323 3300009098 Bacteria 2079
158 Ga0114129_10020152 3300009147 Bacteria 9492
159 Ga0114129_10213940 3300009147 Bacteria 2604
160 Ga0114129_10369420 3300009147 Bacteria 1896
161 Ga0114129_10451607 3300009147 Bacteria 1686
162 Ga0105243_10029361 3300009148 Bacteria 4228
163 Ga0105243_10306381 3300009148 Unclassified 1441
164 Ga0105241_10054450 3300009174 Bacteria 3062
165 Ga0105241_11145073 3300009174 Bacteria 734
166 Ga0105242_10043725 3300009176 Bacteria 3625
167 Ga0105242_10167258 3300009176 Bacteria 1930
168 Ga0105242_10752745 3300009176 Unclassified 959
169 Ga0105248_10221176 3300009177 Bacteria 2132
170 Ga0105248_10225876 3300009177 Bacteria 2107
171 Ga0105249_10070141 3300009553 Bacteria 3235
172 Ga0105249_10279078 3300009553 Bacteria 1668
173 Ga0105249_10881003 3300009553 Unclassified 962
174 Ga0105239_10138261 3300010375 Bacteria 2713
175 Ga0105239_10153954 3300010375 Bacteria 2567
176 Ga0105239_10447099 3300010375 Bacteria 1466
177 Ga0105239_11021626 3300010375 Bacteria 951
178 Ga0157373_10020182 3300013100 Bacteria 4847
179 Ga0157371_10108376 3300013102 Bacteria 1971
180 Ga0157371_10369425 3300013102 Unclassified 1046
181 Ga0157371_10433029 3300013102 Bacteria 965
182 Ga0157370_10032325 3300013104 Bacteria 5110
183 Ga0157378_10243703 3300013297 Bacteria 1718
184 Ga0163162_10312379 3300013306 Bacteria 1704
185 Ga0163162_10458183 3300013306 Bacteria 1407
186 Ga0157372_10297694 3300013307 Bacteria 1877
187 Ga0157372_11096271 3300013307 Unclassified 921
188 Ga0157375_10072197 3300013308 Bacteria 3467
189 Ga0157375_10120317 3300013308 Bacteria 2734
190 Ga0163163_10008456 3300014325 Bacteria 9146
191 Ga0157380_10032619 3300014326 Bacteria 4008
192 Ga0157377_10226578 3300014745 Bacteria 1199
193 Ga0157379_10182301 3300014968 Bacteria 1897
194 Ga0157379_10969317 3300014968 Bacteria 809
195 Ga0157376_10176812 3300014969 Bacteria 1948
196 Ga0163161_10159646 3300017792 Bacteria 1719
197 Ga0197907_11066681 3300020069 Bacteria 1278
198 Ga0206354_11512944 3300020081 Bacteria 799
199 Ga0207653_10001158 3300025885 Bacteria 8636
200 Ga0207692_10029866 3300025898 Unclassified 2594
201 Ga0207692_10037578 3300025898 Bacteria 2369
202 Ga0207692_10082205 3300025898 Bacteria 1725
203 Ga0207688_10007553 3300025901 Bacteria 5916
204 Ga0207685_10027426 3300025905 Bacteria 1993
205 Ga0207699_10029836 3300025906 Bacteria 3045
206 Ga0207684_10063192 3300025910 Bacteria 3143
207 Ga0207684_10728314 3300025910 Unclassified 841
208 Ga0207654_10009906 3300025911 Bacteria 4846
209 Ga0207707_10012425 3300025912 Bacteria 7402
210 Ga0207707_10048341 3300025912 Bacteria 3705
211 Ga0207693_10003727 3300025915 Bacteria 12990
212 Ga0207693_10005384 3300025915 Bacteria 10693
213 Ga0207693_10010262 3300025915 Bacteria 7601
214 Ga0207693_10035327 3300025915 Bacteria 3941
215 Ga0207693_10035435 3300025915 Bacteria 3935
216 Ga0207663_10001144 3300025916 Bacteria 12231
217 Ga0207660_10219112 3300025917 Bacteria 1493
218 Ga0207662_10188218 3300025918 Bacteria 1331
219 Ga0207657_10000054 3300025919 Bacteria 106767
220 Ga0207657_10041998 3300025919 Bacteria 4038
221 Ga0207649_10253101 3300025920 Unclassified 1269
222 Ga0207652_10165542 3300025921 Bacteria 1982
223 Ga0207646_10110608 3300025922 Unclassified 2465
224 Ga0207646_10357128 3300025922 Bacteria 1320
225 Ga0207646_10831454 3300025922 Unclassified 821
226 Ga0207681_10246183 3300025923 Bacteria 1394
227 Ga0207687_10043574 3300025927 Bacteria 3093
228 Ga0207687_10090701 3300025927 Bacteria 2228
229 Ga0207687_10226938 3300025927 Bacteria 1473
230 Ga0207664_10016122 3300025929 Bacteria 5444
231 Ga0207664_10021164 3300025929 Bacteria 4831
232 Ga0207664_10351028 3300025929 Unclassified 1305
233 Ga0207664_10396363 3300025929 Bacteria 1227
234 Ga0207644_10027581 3300025931 Bacteria 3925
235 Ga0207706_10019932 3300025933 Bacteria 6028
236 Ga0207706_10080270 3300025933 Bacteria 2868
237 Ga0207686_10079068 3300025934 Bacteria 2140
238 Ga0207709_10305652 3300025935 Bacteria 1185
239 Ga0207669_10017321 3300025937 Bacteria 3692
240 Ga0207665_10006983 3300025939 Bacteria 7472
241 Ga0207665_10010282 3300025939 Bacteria 6143
242 Ga0207665_10024684 3300025939 Bacteria 3964
243 Ga0207665_10447724 3300025939 Bacteria 990
244 Ga0207711_10243433 3300025941 Bacteria 1650
245 Ga0207711_10386920 3300025941 Bacteria 1298
246 Ga0207661_10121827 3300025944 Bacteria 2221
247 Ga0207661_10154164 3300025944 Bacteria 1988
248 Ga0207661_10422650 3300025944 Bacteria 1211
249 Ga0207679_10292105 3300025945 Bacteria 1402
250 Ga0207679_10365133 3300025945 Bacteria 1262
251 Ga0207667_10460212 3300025949 Bacteria 1292
252 Ga0207667_10642265 3300025949 Bacteria 1067
253 Ga0207651_11128611 3300025960 Bacteria 703
254 Ga0207712_10219299 3300025961 Bacteria 1520
255 Ga0207712_11080726 3300025961 Unclassified 714
256 Ga0207668_10273960 3300025972 Bacteria 1381
257 Ga0207668_10287734 3300025972 Bacteria 1351
258 Ga0207677_10027397 3300026023 Bacteria 3588
259 Ga0207677_10134405 3300026023 Bacteria 1883
260 Ga0207708_10004374 3300026075 Bacteria 10410
261 Ga0207708_10057437 3300026075 Bacteria 2969
262 Ga0207702_10009726 3300026078 Bacteria 8076
263 Ga0207702_10241739 3300026078 Bacteria 1692
264 Ga0207702_10440603 3300026078 Bacteria 1262
265 Ga0207641_10105187 3300026088 Bacteria 2493
266 Ga0207648_10013296 3300026089 Bacteria 7666
267 Ga0207676_10332309 3300026095 Bacteria 1399
268 Ga0207676_10867732 3300026095 Bacteria 883
269 Ga0207675_100008182 3300026118 Bacteria 9857
270 Ga0207675_100154558 3300026118 Bacteria 2186
271 Ga0207683_10000626 3300026121 Bacteria 32385
272 Ga0207683_10137940 3300026121 Bacteria 2196
273 Ga0207683_10298203 3300026121 Bacteria 1475
274 Ga0207428_10003755 3300027907 Bacteria 14580
275 Ga0207428_10008369 3300027907 Bacteria 9344
276 Ga0268265_10213370 3300028380 Bacteria 1684
277 Ga0268265_10262343 3300028380 Bacteria 1537
278 Ga0268264_10089408 3300028381 Bacteria 2652
279 Ga0265338_10053196 3300028800 Bacteria 3625
280 Ga0265320_10055137 3300031240 Unclassified 1915
281 Ga0373930_0012813 3300034816 Bacteria 1536
282 Ga0373950_0032657 3300034818 Bacteria 969
283 Ga0373958_0010690 3300034819 Bacteria 1536
284 Ga0373959_0014889 3300034820 Bacteria 1422
285 Ga0373959_0077014 3300034820 Bacteria 763
286 Ga0373938_0019893 3300034957 Bacteria 1347
287 Ga0373926_0120057 3300035083 Bacteria 991
288 Ga0373928_0002875 3300035084 Bacteria 3321
289 Ga0373929_0006586 3300035085 Bacteria 2101
290 Ga0373929_0017103 3300035085 Bacteria 1429
291 Ga0373940_0027949 3300035088 Bacteria 1485
292 Ga0373944_0015378 3300035089 Bacteria 2146
293 Ga0373951_0002495 3300035091 Bacteria 4633
294 Ga0373951_0007593 3300035091 Bacteria 2462
295 Ga0373951_0112060 3300035091 Bacteria 735
296 Ga0373932_0011264 3300035112 Bacteria 2181
297 Ga0373939_0019371 3300035114 Bacteria 1835
298 Ga0373939_0109806 3300035114 Bacteria 959
299 Ga0373941_0021205 3300035115 Bacteria 1830
300 Ga0373945_0001474 3300035116 Bacteria 7190
301 Ga0373960_0003999 3300035121 Bacteria 3364
302 Ga0373960_0019140 3300035121 Bacteria 1795
303 Ga0373943_0015075 3300035170 Bacteria 3509
304 Ga0373946_0012758 3300035171 Bacteria 3150
305 Ga0373961_0019078 3300035241 Bacteria 1798
306 Ga0373931_0020526 3300035691 Bacteria 3306
307 Ga0373925_0126941 3300037068 Bacteria 1985
308 Ga0373925_0601133 3300037068 Unclassified 906
309 Ga0395899_0013460 3300037312 Bacteria 6256
310 Ga0395899_0020886 3300037312 Bacteria 4965
311 Ga0395899_0037352 3300037312 Bacteria 3641
312 Ga0395899_0118031 3300037312 Bacteria 1902
313 Ga0395900_0005039 3300037418 Bacteria 13865
314 Ga0395900_0016906 3300037418 Bacteria 7446
315 Ga0395900_0018665 3300037418 Bacteria 7072
316 Ga0395900_0042494 3300037418 Bacteria 4684
317 Ga0395900_0167590 3300037418 Bacteria 2238
318 Ga0395900_0720261 3300037418 Unclassified 930
319 Ga0395900_0817845 3300037418 Bacteria 859
320 Ga0395898_0006272 3300037466 Bacteria 12714
321 Ga0395898_0007564 3300037466 Bacteria 11531
322 Ga0395898_0008928 3300037466 Bacteria 10558
323 Ga0395898_0012453 3300037466 Bacteria 8793
324 Ga0395898_0013583 3300037466 Bacteria 8380
325 Ga0395898_0030941 3300037466 Bacteria 5352
326 Ga0395898_0180940 3300037466 Bacteria 2015
327 Ga0395898_0286919 3300037466 Bacteria 1570
328 Ga0395905_0008121 3300037471 Bacteria 10371
329 Ga0395905_0028429 3300037471 Bacteria 5271
330 Ga0395905_0106122 3300037471 Bacteria 2638
331 Ga0395905_0148721 3300037471 Bacteria 2203
332 Ga0395905_0186378 3300037471 Unclassified 1947
333 Ga0395905_0259425 3300037471 Bacteria 1623
334 Ga0395905_0438154 3300037471 Bacteria 1204
335 Ga0395901_0001394 3300038443 Bacteria 25270
336 Ga0395901_0017535 3300038443 Bacteria 7309
337 Ga0395901_0019177 3300038443 Bacteria 6992
338 Ga0395901_0023082 3300038443 Bacteria 6376
339 Ga0395901_0030335 3300038443 Bacteria 5570
340 Ga0395901_0049742 3300038443 Bacteria 4355
341 Ga0395901_0192331 3300038443 Unclassified 2139
342 Ga0395901_0605985 3300038443 Unclassified 1104
343 Ga0451789_0389984 3300041443 Bacteria 2929
344 Ga0451793_0296080 3300041452 Bacteria 3032
345 Ga0451800_0094151 3300041459 Unclassified 1119
346 Ga0451807_0032653 3300041486 Bacteria 2585
347 Ga0451835_0334288 3300041492 Bacteria 3336
348 Ga0451839_0654644 3300041496 Bacteria 922
349 Ga0451841_1124884 3300041498 Bacteria 1745
350 Ga0451847_0671274 3300041503 Bacteria 2562
351 Ga0439448_0006641 3300042005 Bacteria 3331
352 Ga0439448_0013028 3300042005 Bacteria 2496
353 Ga0439450_049030 3300042008 Bacteria 999
354 Ga0439458_0042450 3300042157 Bacteria 1107
355 Ga0466966_0043226 3300044684 Bacteria 2889
356 Ga0466963_0266891 3300044694 Bacteria 1202
357 Ga0466960_0083838 3300044901 Bacteria 1612
358 Ga0451576_0050107 3300045051 Bacteria 4381
359 Ga0466967_0330945 3300045976 Bacteria 1471
360 Ga0495603_0003409 3300046455 Bacteria 9462
361 Ga0495603_0070989 3300046455 Bacteria 2047
362 Ga0495629_0334292 3300046459 Bacteria 1035
363 Ga0495641_0001038 3300046461 Bacteria 23885
364 Ga0495580_0267786 3300046472 Bacteria 1167
365 Ga0495582_0150856 3300046473 Bacteria 1319
366 Ga0495639_0076174 3300046475 Bacteria 1556
367 Ga0495584_0124885 3300046491 Bacteria 1304
368 Ga0495594_0000335 3300046499 Bacteria 23428
369 Ga0495608_0028335 3300046511 Bacteria 3807
370 Ga0495618_0072882 3300046514 Unclassified 2186
371 Ga0495630_0098348 3300046517 Bacteria 2213
372 Ga0495644_0265313 3300046523 Bacteria 668
373 Ga0495666_0141455 3300046526 Bacteria 1121
374 Ga0495609_0034769 3300046538 Bacteria 2283
375 Ga0495645_0484832 3300046543 Unclassified 775
376 Ga0495622_0083398 3300046557 Bacteria 1471
377 Ga0495635_0042962 3300046663 Unclassified 3120
378 Ga0495661_0192861 3300046665 Bacteria 1072
379 Ga0495588_0001807 3300046674 Bacteria 9121
380 Ga0495657_0025871 3300046675 Bacteria 4163
381 Ga0495647_0017910 3300046681 Bacteria 2514
382 Ga0495658_0008901 3300046683 Bacteria 4992
383 Ga0495600_0261549 3300046809 Bacteria 1099
384 Ga0495581_0110071 3300047315 Bacteria 1602
385 Ga0495676_0013466 3300047321 Bacteria 7349
386 Ga0495676_0028678 3300047321 Bacteria 4750
387 Ga0495676_0108914 3300047321 Bacteria 2037
388 Ga0495680_0097394 3300047322 Unclassified 2196
389 Ga0495684_0005146 3300047471 Bacteria 10198
390 Ga0496100_0021451 3300048903 Bacteria 3890
391 Ga0496100_0084580 3300048903 Bacteria 2150
392 Ga0496100_0174277 3300048903 Bacteria 1551
393 Ga0496101_0021420 3300048904 Bacteria 4441
394 Ga0496101_0023119 3300048904 Bacteria 4289
395 Ga0496101_0034235 3300048904 Bacteria 3587
396 Ga0496101_0840923 3300048904 Bacteria 723
397 Ga0496102_0015057 3300048905 Bacteria 6732
398 Ga0496102_0158096 3300048905 Bacteria 2131
399 Ga0496102_0203294 3300048905 Bacteria 1867
400 Ga0496102_1278277 3300048905 Bacteria 653
401 Ga0496103_0010477 3300048906 Bacteria 5486
402 Ga0496103_0029435 3300048906 Bacteria 3338
403 Ga0496103_0060400 3300048906 Bacteria 2356
404 Ga0496104_0000772 3300048907 Bacteria 27396
405 Ga0496104_0007557 3300048907 Bacteria 9613
406 Ga0496104_0019887 3300048907 Bacteria 6148
407 Ga0496104_0365797 3300048907 Bacteria 1354
408 Ga0496105_0000542 3300048908 Bacteria 24896
409 Ga0496105_0006817 3300048908 Bacteria 8786
410 Ga0496105_0007198 3300048908 Bacteria 8588
411 Ga0496105_0035703 3300048908 Bacteria 4092
412 Ga0496105_0049343 3300048908 Bacteria 3475
413 Ga0496106_0072840 3300048909 Bacteria 2628
414 Ga0496106_0250940 3300048909 Bacteria 1414
415 Ga0496107_0026053 3300048910 Bacteria 4143
416 Ga0496107_0026371 3300048910 Bacteria 4118
417 Ga0496107_0160394 3300048910 Bacteria 1666
418 Ga0496107_0166089 3300048910 Bacteria 1636
419 Ga0496108_0001522 3300048911 Bacteria 18337
420 Ga0496108_0005130 3300048911 Bacteria 10585
421 Ga0496108_0102464 3300048911 Bacteria 2442
422 Ga0496108_0514751 3300048911 Bacteria 1045
423 Ga0496108_0720349 3300048911 Bacteria 864
424 Ga0496109_0008161 3300048912 Bacteria 8880
425 Ga0496109_0050357 3300048912 Bacteria 3793
426 Ga0496109_0135923 3300048912 Bacteria 2297
427 Ga0496109_0236157 3300048912 Unclassified 1720
428 Ga0496110_0000787 3300048913 Bacteria 22120
429 Ga0496110_0003110 3300048913 Bacteria 12598
430 Ga0496110_0065452 3300048913 Bacteria 3213
431 Ga0496110_0087142 3300048913 Unclassified 2789
432 Ga0496110_0249034 3300048913 Bacteria 1617
433 Ga0496111_0003211 3300048914 Bacteria 10089
434 Ga0496111_0019344 3300048914 Bacteria 4728
435 Ga0496111_0197433 3300048914 Bacteria 1496
436 Ga0496112_0047814 3300048915 Bacteria 4196
437 Ga0496112_0108928 3300048915 Bacteria 2740
438 Ga0496112_0128782 3300048915 Bacteria 2502
439 Ga0496112_0163256 3300048915 Bacteria 2194
440 Ga0496112_0212202 3300048915 Bacteria 1893
441 Ga0496113_0003511 3300048916 Bacteria 9405
442 Ga0496113_0008566 3300048916 Bacteria 6671
443 Ga0496113_0173723 3300048916 Bacteria 1707
444 Ga0496114_0028260 3300048917 Bacteria 4600
445 Ga0496114_0047640 3300048917 Bacteria 3565
446 Ga0496114_0156851 3300048917 Bacteria 1977
447 Ga0496114_0228615 3300048917 Bacteria 1634
448 Ga0496114_0495164 3300048917 Bacteria 1081
449 Ga0496115_0041664 3300048918 Bacteria 3655
450 Ga0496115_0083210 3300048918 Bacteria 2608
451 Ga0496115_0092358 3300048918 Unclassified 2474
452 Ga0501047_0076721 3300049581 Bacteria 3216
453 Ga0501047_0590399 3300049581 Bacteria 933
454 Ga0501067_0014258 3300049583 Bacteria 4401
455 Ga0501068_0332198 3300049584 Bacteria 975
456 Ga0501069_0006339 3300049585 Bacteria 6183
457 Ga0501070_0106455 3300049586 Bacteria 2318
458 Ga0501071_0043668 3300049587 Bacteria 3215
459 Ga0501072_0240474 3300049588 Bacteria 1442
460 Ga0501074_0282185 3300049590 Bacteria 1181
461 Ga0501074_0345102 3300049590 Bacteria 1057
462 Ga0501075_0525221 3300049591 Bacteria 903
463 Ga0501076_0093366 3300049592 Bacteria 2422
464 Ga0501080_0052517 3300049742 Bacteria 3793
465 nmdc:mga05p37_16747_c1 3300050507 Bacteria 8836
466 nmdc:mga05p37_28859_c1 3300050507 Bacteria 6768
467 nmdc:mga09592_208855_c1 3300050508 Bacteria 1691
468 nmdc:mga06r32_14955_c1 3300050510 Bacteria 7043
469 nmdc:mga08y16_10048_c1 3300050511 Bacteria 9931
470 nmdc:mga08y16_149690_c1 3300050511 Bacteria 2426
471 nmdc:mga08y16_3967_c1 3300050511 Bacteria 15416
472 nmdc:mga08y16_471557_c1 3300050511 Bacteria 1278
473 nmdc:mga0n895_13060_c1 3300050512 Bacteria 7471
474 nmdc:mga0n895_21569_c1 3300050512 Bacteria 6027
475 nmdc:mga0n895_69449_c1 3300050512 Bacteria 3491
476 nmdc:mga0rr50_17069_c1 3300050513 Bacteria 4836
477 nmdc:mga0rr50_41457_c1 3300050513 Bacteria 3355
478 nmdc:mga0rr50_5990_c1 3300050513 Bacteria 7335
479 nmdc:mga0rr50_9586_c1 3300050513 Bacteria 6097
480 nmdc:mga08x19_125630_c1 3300050514 Bacteria 1723
481 nmdc:mga08x19_195103_c1 3300050514 Bacteria 1387
482 nmdc:mga08x19_37646_c1 3300050514 Bacteria 3071
483 nmdc:mga0a205_24138_c1 3300050515 Bacteria 5775
484 nmdc:mga0a205_6428_c1 3300050515 Bacteria 10624
485 Ga0495595_0273728 3300053084 Unclassified 847
486 Ga0495619_0166085 3300053085 Unclassified 1525
487 Ga0530510_0162069 3300061734 Bacteria 1654
488 Ga0395900_0095316
489 Ga0070676_10685332
490 Ga0070683_100029653
491 Ga0070683_100243377
492 Ga0070683_100728212
493 Ga0070690_100030426
494 Ga0070690_100032470
495 Ga0070680_100135090
496 Ga0068868_100021337
497 Ga0068868_100065453
498 Ga0068868_100282425
499 Ga0070660_100015792
500 Ga0070660_100056838
501 Ga0070689_100430978
502 Ga0070691_10037542
503 Ga0070661_100257748
504 Ga0070692_10065909
505 Ga0070668_100022054
506 Ga0070671_100109526
507 Ga0070671_100292196
508 Ga0070673_100130052
509 Ga0070688_100275356
510 Ga0070659_100186139
511 Ga0070659_100217171
512 Ga0070703_10029095
513 Ga0070709_10009177
514 Ga0070709_10024822
515 Ga0070714_100038774
516 Ga0070714_100158537
517 Ga0070714_100632413
518 Ga0070713_100041201
519 Ga0070713_100263925
520 Ga0070710_10051464
521 Ga0070710_10092614
522 Ga0070710_10119152
523 Ga0070711_100054240
524 Ga0070711_100145530
525 Ga0070711_100224802
526 Ga0070705_100013196
527 Ga0070705_100064216
528 Ga0070705_100068124
529 Ga0070705_100091597
530 Ga0070705_100396590
531 Ga0070700_100187341
532 Ga0070700_100233865
533 Ga0070694_100021140
534 Ga0070694_100097762
535 Ga0070694_100361092
536 Ga0070694_100384540
537 Ga0070708_100124729
538 Ga0070708_100536677
539 Ga0070678_100090602
540 Ga0070662_100017440
541 Ga0070662_100082784
542 Ga0070681_10005563
543 Ga0070681_10015890
544 Ga0068867_100097261
545 Ga0070685_10065405
546 Ga0070706_100004250
547 Ga0070706_100182334
548 Ga0070706_100189542
549 Ga0070706_100398621
550 Ga0070707_100011707
551 Ga0070707_100590009
552 Ga0070707_100790699
553 Ga0070707_101139771
554 Ga0070698_100012522
555 Ga0070698_100018669
556 Ga0070698_100149878
557 Ga0070698_100414219
558 Ga0070699_100042554
559 Ga0070699_100046359
560 Ga0070699_100269151
561 Ga0070679_100028786
562 Ga0070684_100094323
563 Ga0070684_100536011
564 Ga0070697_100537186
565 Ga0068853_100288168
566 Ga0070686_100035224
567 Ga0070695_100038132
568 Ga0070695_100139720
569 Ga0070695_100341201
570 Ga0070696_100027367
571 Ga0070696_100219868
572 Ga0070696_100616791
573 Ga0070693_100000955
574 Ga0070693_100007441
575 Ga0070693_100010299
576 Ga0070693_100257023
577 Ga0070704_100503301
578 Ga0070704_100586007
579 Ga0070704_100701470
580 Ga0068855_100106370
581 Ga0068855_100272815
582 Ga0068855_100303325
583 Ga0070664_100575856
584 Ga0070664_100583733
585 Ga0070664_100592991
586 Ga0068854_100041637
587 Ga0068856_100009373
588 Ga0068856_100167748
589 Ga0068856_100711384
590 Ga0070702_100004649
591 Ga0070702_100029577
592 Ga0070702_100139886
593 Ga0068864_100185310
594 Ga0068864_100374615
595 Ga0068861_100417167
596 Ga0068863_100233360
597 Ga0081455_10005540
598 Ga0081455_10024075
599 Ga0081540_1002560
600 Ga0081540_1003067
601 Ga0081540_1012281
602 Ga0070717_10027966
603 Ga0070717_10053896
604 Ga0070717_10070065
605 Ga0075432_10006518
606 Ga0075432_10083487
607 Ga0075432_10103254
608 Ga0070715_10001178
609 Ga0070715_10021794
610 Ga0070715_10111757
611 Ga0070716_100123572
612 Ga0070716_100191068
613 Ga0070716_100426342
614 Ga0070712_100002050
615 Ga0070712_100029726
616 Ga0070712_100045451
617 Ga0097621_100176659
618 Ga0068871_100009711
619 Ga0075428_100068886
620 Ga0075428_100111253
621 Ga0075431_100079348
622 Ga0075431_100283699
623 Ga0075433_10004549
624 Ga0075433_10039097
625 Ga0075434_100068369
626 Ga0075434_100214392
627 Ga0075434_100254003
628 Ga0075434_100561108
629 Ga0075429_100129439
630 Ga0068865_100014843
631 Ga0075436_100000947
632 Ga0075436_100007807
633 Ga0075436_100011264
634 Ga0075436_100014628
635 Ga0075435_100013944
636 Ga0075435_100026919
637 Ga0105240_10086768
638 Ga0111539_10045344
639 Ga0111539_10247440
640 Ga0111539_10442600
641 Ga0105245_10017950
642 Ga0105245_10022625
643 Ga0105245_10094899
644 Ga0105245_10169323
645 Ga0114129_10020152
646 Ga0114129_10213940
647 Ga0114129_10369420
648 Ga0114129_10451607
649 Ga0105243_10029361
650 Ga0105243_10306381
651 Ga0105241_10054450
652 Ga0105241_11145073
653 Ga0105242_10043725
654 Ga0105242_10167258
655 Ga0105242_10752745
656 Ga0105248_10221176
657 Ga0105248_10225876
658 Ga0105249_10070141
659 Ga0105249_10279078
660 Ga0105249_10881003
661 Ga0105239_10138261
662 Ga0105239_10153954
663 Ga0105239_10447099
664 Ga0105239_11021626
665 Ga0157373_10020182
666 Ga0157371_10108376
667 Ga0157371_10369425
668 Ga0157371_10433029
669 Ga0157370_10032325
670 Ga0157378_10243703
671 Ga0163162_10312379
672 Ga0163162_10458183
673 Ga0157372_10297694
674 Ga0157372_11096271
675 Ga0157375_10072197
676 Ga0157375_10120317
677 Ga0163163_10008456
678 Ga0157380_10032619
679 Ga0157377_10226578
680 Ga0157379_10182301
681 Ga0157379_10969317
682 Ga0157376_10176812
683 Ga0163161_10159646
684 Ga0197907_11066681
685 Ga0206354_11512944
686 Ga0207653_10001158
687 Ga0207692_10029866
688 Ga0207692_10037578
689 Ga0207692_10082205
690 Ga0207688_10007553
691 Ga0207685_10027426
692 Ga0207699_10029836
693 Ga0207684_10063192
694 Ga0207684_10728314
695 Ga0207654_10009906
696 Ga0207707_10012425
697 Ga0207707_10048341
698 Ga0207693_10003727
699 Ga0207693_10005384
700 Ga0207693_10010262
701 Ga0207693_10035327
702 Ga0207693_10035435
703 Ga0207663_10001144
704 Ga0207660_10219112
705 Ga0207662_10188218
706 Ga0207657_10000054
707 Ga0207657_10041998
708 Ga0207649_10253101
709 Ga0207652_10165542
710 Ga0207646_10110608
711 Ga0207646_10357128
712 Ga0207646_10831454
713 Ga0207681_10246183
714 Ga0207687_10043574
715 Ga0207687_10090701
716 Ga0207687_10226938
717 Ga0207664_10016122
718 Ga0207664_10021164
719 Ga0207664_10351028
720 Ga0207664_10396363
721 Ga0207644_10027581
722 Ga0207706_10019932
723 Ga0207706_10080270
724 Ga0207686_10079068
725 Ga0207709_10305652
726 Ga0207669_10017321
727 Ga0207665_10006983
728 Ga0207665_10010282
729 Ga0207665_10024684
730 Ga0207665_10447724
731 Ga0207711_10243433
732 Ga0207711_10386920
733 Ga0207661_10121827
734 Ga0207661_10154164
735 Ga0207661_10422650
736 Ga0207679_10292105
737 Ga0207679_10365133
738 Ga0207667_10460212
739 Ga0207667_10642265
740 Ga0207651_11128611
741 Ga0207712_10219299
742 Ga0207712_11080726
743 Ga0207668_10273960
744 Ga0207668_10287734
745 Ga0207677_10027397
746 Ga0207677_10134405
747 Ga0207708_10004374
748 Ga0207708_10057437
749 Ga0207702_10009726
750 Ga0207702_10241739
751 Ga0207702_10440603
752 Ga0207641_10105187
753 Ga0207648_10013296
754 Ga0207676_10332309
755 Ga0207676_10867732
756 Ga0207675_100008182
757 Ga0207675_100154558
758 Ga0207683_10000626
759 Ga0207683_10137940
760 Ga0207683_10298203
761 Ga0207428_10003755
762 Ga0207428_10008369
763 Ga0268265_10213370
764 Ga0268265_10262343
765 Ga0268264_10089408
766 Ga0265338_10053196
767 Ga0265320_10055137
768 Ga0373930_0012813
769 Ga0373950_0032657
770 Ga0373958_0010690
771 Ga0373959_0014889
772 Ga0373959_0077014
773 Ga0373938_0019893
774 Ga0373926_0120057
775 Ga0373928_0002875
776 Ga0373929_0006586
777 Ga0373929_0017103
778 Ga0373940_0027949
779 Ga0373944_0015378
780 Ga0373951_0002495
781 Ga0373951_0007593
782 Ga0373951_0112060
783 Ga0373932_0011264
784 Ga0373939_0019371
785 Ga0373939_0109806
786 Ga0373941_0021205
787 Ga0373945_0001474
788 Ga0373960_0003999
789 Ga0373960_0019140
790 Ga0373943_0015075
791 Ga0373946_0012758
792 Ga0373961_0019078
793 Ga0373931_0020526
794 Ga0373925_0126941
795 Ga0373925_0601133
796 Ga0395899_0013460
797 Ga0395899_0020886
798 Ga0395899_0037352
799 Ga0395899_0118031
800 Ga0395900_0005039
801 Ga0395900_0016906
802 Ga0395900_0018665
803 Ga0395900_0042494
804 Ga0395900_0167590
805 Ga0395900_0720261
806 Ga0395900_0817845
807 Ga0395898_0006272
808 Ga0395898_0007564
809 Ga0395898_0008928
810 Ga0395898_0012453
811 Ga0395898_0013583
812 Ga0395898_0030941
813 Ga0395898_0180940
814 Ga0395898_0286919
815 Ga0395905_0008121
816 Ga0395905_0028429
817 Ga0395905_0106122
818 Ga0395905_0148721
819 Ga0395905_0186378
820 Ga0395905_0259425
821 Ga0395905_0438154
822 Ga0395901_0001394
823 Ga0395901_0017535
824 Ga0395901_0019177
825 Ga0395901_0023082
826 Ga0395901_0030335
827 Ga0395901_0049742
828 Ga0395901_0192331
829 Ga0395901_0605985
830 Ga0451789_0389984
831 Ga0451793_0296080
832 Ga0451800_0094151
833 Ga0451807_0032653
834 Ga0451835_0334288
835 Ga0451839_0654644
836 Ga0451841_1124884
837 Ga0451847_0671274
838 Ga0439448_0006641
839 Ga0439448_0013028
840 Ga0439450_049030
841 Ga0439458_0042450
842 Ga0466966_0043226
843 Ga0466963_0266891
844 Ga0466960_0083838
845 Ga0451576_0050107
846 Ga0466967_0330945
847 Ga0495603_0003409
848 Ga0495603_0070989
849 Ga0495629_0334292
850 Ga0495641_0001038
851 Ga0495580_0267786
852 Ga0495582_0150856
853 Ga0495639_0076174
854 Ga0495584_0124885
855 Ga0495594_0000335
856 Ga0495608_0028335
857 Ga0495618_0072882
858 Ga0495630_0098348
859 Ga0495644_0265313
860 Ga0495666_0141455
861 Ga0495609_0034769
862 Ga0495645_0484832
863 Ga0495622_0083398
864 Ga0495635_0042962
865 Ga0495661_0192861
866 Ga0495588_0001807
867 Ga0495657_0025871
868 Ga0495647_0017910
869 Ga0495658_0008901
870 Ga0495600_0261549
871 Ga0495581_0110071
872 Ga0495676_0013466
873 Ga0495676_0028678
874 Ga0495676_0108914
875 Ga0495680_0097394
876 Ga0495684_0005146
877 Ga0496100_0021451
878 Ga0496100_0084580
879 Ga0496100_0174277
880 Ga0496101_0021420
881 Ga0496101_0023119
882 Ga0496101_0034235
883 Ga0496101_0840923
884 Ga0496102_0015057
885 Ga0496102_0158096
886 Ga0496102_0203294
887 Ga0496102_1278277
888 Ga0496103_0010477
889 Ga0496103_0029435
890 Ga0496103_0060400
891 Ga0496104_0000772
892 Ga0496104_0007557
893 Ga0496104_0019887
894 Ga0496104_0365797
895 Ga0496105_0000542
896 Ga0496105_0006817
897 Ga0496105_0007198
898 Ga0496105_0035703
899 Ga0496105_0049343
900 Ga0496106_0072840
901 Ga0496106_0250940
902 Ga0496107_0026053
903 Ga0496107_0026371
904 Ga0496107_0160394
905 Ga0496107_0166089
906 Ga0496108_0001522
907 Ga0496108_0005130
908 Ga0496108_0102464
909 Ga0496108_0514751
910 Ga0496108_0720349
911 Ga0496109_0008161
912 Ga0496109_0050357
913 Ga0496109_0135923
914 Ga0496109_0236157
915 Ga0496110_0000787
916 Ga0496110_0003110
917 Ga0496110_0065452
918 Ga0496110_0087142
919 Ga0496110_0249034
920 Ga0496111_0003211
921 Ga0496111_0019344
922 Ga0496111_0197433
923 Ga0496112_0047814
924 Ga0496112_0108928
925 Ga0496112_0128782
926 Ga0496112_0163256
927 Ga0496112_0212202
928 Ga0496113_0003511
929 Ga0496113_0008566
930 Ga0496113_0173723
931 Ga0496114_0028260
932 Ga0496114_0047640
933 Ga0496114_0156851
934 Ga0496114_0228615
935 Ga0496114_0495164
936 Ga0496115_0041664
937 Ga0496115_0083210
938 Ga0496115_0092358
939 Ga0501047_0076721
940 Ga0501047_0590399
941 Ga0501067_0014258
942 Ga0501068_0332198
943 Ga0501069_0006339
944 Ga0501070_0106455
945 Ga0501071_0043668
946 Ga0501072_0240474
947 Ga0501074_0282185
948 Ga0501074_0345102
949 Ga0501075_0525221
950 Ga0501076_0093366
951 Ga0501080_0052517
952 nmdc:mga05p37_16747_c1
953 nmdc:mga05p37_28859_c1
954 nmdc:mga09592_208855_c1
955 nmdc:mga06r32_14955_c1
956 nmdc:mga08y16_10048_c1
957 nmdc:mga08y16_149690_c1
958 nmdc:mga08y16_3967_c1
959 nmdc:mga08y16_471557_c1
960 nmdc:mga0n895_13060_c1
961 nmdc:mga0n895_21569_c1
962 nmdc:mga0n895_69449_c1
963 nmdc:mga0rr50_17069_c1
964 nmdc:mga0rr50_41457_c1
965 nmdc:mga0rr50_5990_c1
966 nmdc:mga0rr50_9586_c1
967 nmdc:mga08x19_125630_c1
968 nmdc:mga08x19_195103_c1
969 nmdc:mga08x19_37646_c1
970 nmdc:mga0a205_24138_c1
971 nmdc:mga0a205_6428_c1
972 Ga0495595_0273728
973 Ga0495619_0166085
974 Ga0530510_0162069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hns-assembly1.cif.gz_A structure of nitrincola lacisaponensis flavin-containing monooxygenase (fmo) in complex with fad and nadp+ 0.8577 123 153
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8459 26 59
2xlr-assembly2.cif.gz_A joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78asp mutant 0.8224 127 153
2vq7-assembly2.cif.gz_C bacterial flavin-containing monooxygenase in complex with nadp: native data 0.8106 127 153
2dsb-assembly1.cif.gz_B crystal structure of human adp-ribose pyrophosphatase nudt5 0.7832 27 59
ID Description Score Start End Superfamily
af_I1MWN9_30_410_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8593 124 152 3.50.50.60
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8456 26 59 3.90.79.10
af_Q01976_20_226_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8409 27 59 3.90.79.10
5qj4D00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7847 27 59 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7778 27 59 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A1D3DUG6-F1-model_v4 Uncharacterized protein 0.8268 26 59
AF-A0A379FKB5-F1-model_v4 ADP compounds hydrolase nudE (EC 3.6.1.-) 0.8184 27 60 GO:0016787
AF-A0A3E4KJN5-F1-model_v4 deleted 0.8107 106 152
AF-A0A542ET37-F1-model_v4 Uncharacterized protein 0.7778 10 59
AF-A0A2P4P5P9-F1-model_v4 Protein kinase domain-containing protein 0.7745 22 59

Map