F453423

General Info

Members Datasets Scaffolds Average Seq Length
487 263 974 148

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1010557|Ga0081540_10105577
Length 164
Sequence MIEEGKPAPDFELATDAGERVKLSDFRGKPVVLYFYPKDDTPGCTVEACGFRDVYSEFEQRGAVVLGVSPDDEATHVKFKQKYSLPFTLLADPEHQVADEYGVWGEKKFGGKTYWGVKRSTFVIDADGNVAKVMHNVKPDGHPEQVLAILPSGPASQSPLRATT

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
82 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
83 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
84 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 11.91
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1010557 3300005983 Bacteria 6239
2 JGI25406J46586_10065979 3300003203 Bacteria 1151
3 JGI25405J52794_10048011 3300003911 Bacteria 911
4 Ga0070676_10692233 3300005328 Bacteria 744
5 Ga0070683_100002174 3300005329 Bacteria 15507
6 Ga0070683_100007005 3300005329 Bacteria 9488
7 Ga0070683_100027227 3300005329 Bacteria 5155
8 Ga0070683_100229830 3300005329 Bacteria 1763
9 Ga0070683_100231281 3300005329 Bacteria 1757
10 Ga0070680_100094140 3300005336 Bacteria 2482
11 Ga0070680_100190912 3300005336 Bacteria 1726
12 Ga0070682_100026116 3300005337 Bacteria 3492
13 Ga0070682_100227825 3300005337 Bacteria 1331
14 Ga0068868_100022969 3300005338 Bacteria 4716
15 Ga0068868_100093953 3300005338 Bacteria 2419
16 Ga0068868_100190650 3300005338 Bacteria 1705
17 Ga0070691_10030380 3300005341 Bacteria 2530
18 Ga0070691_10103935 3300005341 Bacteria 1414
19 Ga0070661_100995888 3300005344 Bacteria 695
20 Ga0070668_100037946 3300005347 Bacteria 3681
21 Ga0070675_100825437 3300005354 Bacteria 848
22 Ga0070673_100368055 3300005364 Bacteria 1279
23 Ga0070688_100339198 3300005365 Bacteria 1097
24 Ga0070659_101498338 3300005366 Bacteria 601
25 Ga0070667_101006829 3300005367 Bacteria 778
26 Ga0070709_10018876 3300005434 Bacteria 3979
27 Ga0070714_100033610 3300005435 Bacteria 4289
28 Ga0070713_100070163 3300005436 Bacteria 2957
29 Ga0070710_10034550 3300005437 Bacteria 2751
30 Ga0070701_10028687 3300005438 Bacteria 2737
31 Ga0070705_100017179 3300005440 Bacteria 3773
32 Ga0070705_100449234 3300005440 Bacteria 967
33 Ga0070700_100851954 3300005441 Bacteria 738
34 Ga0070694_100977580 3300005444 Bacteria 702
35 Ga0070708_100611454 3300005445 Bacteria 1027
36 Ga0070663_100131090 3300005455 Bacteria 1904
37 Ga0070662_100127748 3300005457 Bacteria 1956
38 Ga0070662_101032704 3300005457 Bacteria 704
39 Ga0070681_10575580 3300005458 Bacteria 1040
40 Ga0068867_100204126 3300005459 Bacteria 1584
41 Ga0070685_11503030 3300005466 Bacteria 519
42 Ga0070706_100347436 3300005467 Bacteria 1383
43 Ga0070706_100747683 3300005467 Bacteria 906
44 Ga0070699_100088057 3300005518 Bacteria 2711
45 Ga0070679_100148376 3300005530 Bacteria 2322
46 Ga0070679_100248383 3300005530 Bacteria 1736
47 Ga0070684_100003754 3300005535 Bacteria 11465
48 Ga0070684_100009078 3300005535 Bacteria 7816
49 Ga0070684_100043779 3300005535 Bacteria 3868
50 Ga0070684_101067080 3300005535 Bacteria 759
51 Ga0070684_101974274 3300005535 Bacteria 551
52 Ga0070697_101211534 3300005536 Bacteria 673
53 Ga0070686_100096865 3300005544 Bacteria 1985
54 Ga0070686_100125380 3300005544 Bacteria 1769
55 Ga0070695_100469563 3300005545 Bacteria 968
56 Ga0070696_100342550 3300005546 Bacteria 1156
57 Ga0070696_100356781 3300005546 Bacteria 1134
58 Ga0070693_100007863 3300005547 Bacteria 5228
59 Ga0070693_100058952 3300005547 Bacteria 2223
60 Ga0070704_100388550 3300005549 Bacteria 1188
61 Ga0070704_100623611 3300005549 Bacteria 950
62 Ga0070704_101932347 3300005549 Bacteria 547
63 Ga0070704_101994186 3300005549 Bacteria 539
64 Ga0068855_100299949 3300005563 Bacteria 1780
65 Ga0070664_100087926 3300005564 Bacteria 2687
66 Ga0070664_100744775 3300005564 Bacteria 914
67 Ga0070664_101696050 3300005564 Bacteria 599
68 Ga0068857_100005906 3300005577 Bacteria 10455
69 Ga0068857_100022277 3300005577 Bacteria 5573
70 Ga0068857_100053926 3300005577 Bacteria 3567
71 Ga0068854_100190259 3300005578 Bacteria 1608
72 Ga0068856_100065423 3300005614 Bacteria 3593
73 Ga0068856_100311934 3300005614 Bacteria 1590
74 Ga0070702_100083739 3300005615 Bacteria 1916
75 Ga0070702_100377411 3300005615 Bacteria 1007
76 Ga0068852_100330157 3300005616 Bacteria 1484
77 Ga0068864_100433169 3300005618 Bacteria 1255
78 Ga0068861_100051128 3300005719 Bacteria 3136
79 Ga0068861_101403614 3300005719 Bacteria 682
80 Ga0068870_10092967 3300005840 Bacteria 1690
81 Ga0068863_101160236 3300005841 Bacteria 778
82 Ga0068863_102005309 3300005841 Bacteria 589
83 Ga0081455_10004491 3300005937 Bacteria 15609
84 Ga0081455_10029041 3300005937 Bacteria 5046
85 Ga0081455_10053623 3300005937 Bacteria 3444
86 Ga0081455_10254982 3300005937 Bacteria 1281
87 Ga0081455_10813912 3300005937 Bacteria 586
88 Ga0081540_1008108 3300005983 Bacteria 7378
89 Ga0081540_1013154 3300005983 Bacteria 5400
90 Ga0070717_10317429 3300006028 Bacteria 1388
91 Ga0070717_10940774 3300006028 Bacteria 787
92 Ga0075363_100632264 3300006048 Bacteria 643
93 Ga0075432_10332948 3300006058 Bacteria 639
94 Ga0070715_10011512 3300006163 Bacteria 3188
95 Ga0070715_10018527 3300006163 Bacteria 2654
96 Ga0070716_100017818 3300006173 Bacteria 3690
97 Ga0070712_100032340 3300006175 Bacteria 3532
98 Ga0070712_100500488 3300006175 Bacteria 1018
99 Ga0075367_10436963 3300006178 Bacteria 829
100 Ga0068871_100657162 3300006358 Bacteria 957
101 Ga0075428_100016230 3300006844 Bacteria 8232
102 Ga0075428_100063538 3300006844 Bacteria 4042
103 Ga0075428_100115811 3300006844 Bacteria 2919
104 Ga0075431_100407704 3300006847 Bacteria 1360
105 Ga0075433_10040281 3300006852 Bacteria 4043
106 Ga0075433_10153539 3300006852 Bacteria 2048
107 Ga0075433_10158567 3300006852 Bacteria 2014
108 Ga0075433_10273700 3300006852 Bacteria 1496
109 Ga0075433_10519258 3300006852 Bacteria 1048
110 Ga0075433_10551693 3300006852 Bacteria 1013
111 Ga0075434_100079896 3300006871 Bacteria 3267
112 Ga0075434_100216953 3300006871 Bacteria 1933
113 Ga0075434_100556621 3300006871 Bacteria 1166
114 Ga0075429_100400248 3300006880 Bacteria 1202
115 Ga0075429_100482890 3300006880 Bacteria 1086
116 Ga0068865_100076199 3300006881 Bacteria 2393
117 Ga0068865_101068162 3300006881 Bacteria 710
118 Ga0075436_100162491 3300006914 Bacteria 1575
119 Ga0075435_100069076 3300007076 Bacteria 2880
120 Ga0075435_100406230 3300007076 Bacteria 1172
121 Ga0075435_100424403 3300007076 Bacteria 1145
122 Ga0075435_100470077 3300007076 Bacteria 1085
123 Ga0105240_10921586 3300009093 Bacteria 939
124 Ga0111539_10189190 3300009094 Bacteria 2402
125 Ga0111539_10195306 3300009094 Bacteria 2361
126 Ga0111539_10451985 3300009094 Bacteria 1496
127 Ga0111539_10907831 3300009094 Bacteria 1024
128 Ga0111539_12030973 3300009094 Bacteria 667
129 Ga0105245_10014549 3300009098 Bacteria 6850
130 Ga0105245_10084953 3300009098 Bacteria 2900
131 Ga0105245_13230144 3300009098 Bacteria 505
132 Ga0114129_10052117 3300009147 Bacteria 5743
133 Ga0114129_10213424 3300009147 Bacteria 2608
134 Ga0114129_10652644 3300009147 Bacteria 1358
135 Ga0114129_11489560 3300009147 Bacteria 832
136 Ga0114129_11896159 3300009147 Bacteria 723
137 Ga0114129_12313721 3300009147 Bacteria 645
138 Ga0105243_10086057 3300009148 Bacteria 2577
139 Ga0105243_10216383 3300009148 Bacteria 1690
140 Ga0105241_10026322 3300009174 Bacteria 4327
141 Ga0105242_10175153 3300009176 Bacteria 1888
142 Ga0105242_10179266 3300009176 Bacteria 1868
143 Ga0105248_11886653 3300009177 Bacteria 678
144 Ga0105237_11472705 3300009545 Bacteria 687
145 Ga0105249_10053247 3300009553 Bacteria 3699
146 Ga0105249_10411415 3300009553 Bacteria 1385
147 Ga0105239_10052781 3300010375 Bacteria 4458
148 Ga0105239_10324903 3300010375 Bacteria 1735
149 Ga0105239_10421547 3300010375 Bacteria 1512
150 Ga0105239_10590191 3300010375 Bacteria 1267
151 Ga0105239_10622540 3300010375 Bacteria 1232
152 Ga0105246_10284075 3300011119 Bacteria 1329
153 Ga0105246_10831175 3300011119 Bacteria 822
154 Ga0105246_11786288 3300011119 Bacteria 587
155 Ga0157339_1006479 3300012505 Bacteria 956
156 Ga0157342_1003900 3300012507 Bacteria 1301
157 Ga0157316_1079682 3300012510 Bacteria 510
158 Ga0157338_1006206 3300012515 Bacteria 1099
159 Ga0157373_10136600 3300013100 Bacteria 1724
160 Ga0157371_10789945 3300013102 Bacteria 715
161 Ga0157378_10397638 3300013297 Bacteria 1357
162 Ga0157378_11245498 3300013297 Bacteria 784
163 Ga0157378_11433478 3300013297 Bacteria 734
164 Ga0163162_10025172 3300013306 Bacteria 5882
165 Ga0157372_10129763 3300013307 Bacteria 2899
166 Ga0157372_10189077 3300013307 Bacteria 2385
167 Ga0157375_10260642 3300013308 Bacteria 1895
168 Ga0157375_10328200 3300013308 Bacteria 1695
169 Ga0157380_10305228 3300014326 Bacteria 1468
170 Ga0157377_10274989 3300014745 Bacteria 1101
171 Ga0157376_10080254 3300014969 Bacteria 2798
172 Ga0157376_10541533 3300014969 Bacteria 1151
173 Ga0163161_10041882 3300017792 Bacteria 3292
174 Ga0206356_11219157 3300020070 Bacteria 1531
175 Ga0207692_10131846 3300025898 Bacteria 1412
176 Ga0207642_10031814 3300025899 Bacteria 2214
177 Ga0207688_10203134 3300025901 Bacteria 1189
178 Ga0207688_10385100 3300025901 Bacteria 868
179 Ga0207688_10507873 3300025901 Bacteria 755
180 Ga0207685_10009680 3300025905 Bacteria 2810
181 Ga0207685_10075378 3300025905 Bacteria 1380
182 Ga0207699_10070474 3300025906 Bacteria 2134
183 Ga0207645_10626301 3300025907 Bacteria 731
184 Ga0207684_10180207 3300025910 Bacteria 1822
185 Ga0207654_10081185 3300025911 Bacteria 1952
186 Ga0207707_10456003 3300025912 Bacteria 1094
187 Ga0207693_10025407 3300025915 Bacteria 4697
188 Ga0207693_10053062 3300025915 Bacteria 3181
189 Ga0207693_10258021 3300025915 Bacteria 1367
190 Ga0207663_10020330 3300025916 Bacteria 3757
191 Ga0207663_10035973 3300025916 Bacteria 2975
192 Ga0207660_10060863 3300025917 Bacteria 2716
193 Ga0207646_10353602 3300025922 Bacteria 1328
194 Ga0207681_11576741 3300025923 Bacteria 550
195 Ga0207687_10018726 3300025927 Bacteria 4576
196 Ga0207687_10061662 3300025927 Bacteria 2649
197 Ga0207687_10492325 3300025927 Bacteria 1022
198 Ga0207687_10748137 3300025927 Bacteria 832
199 Ga0207700_10138383 3300025928 Bacteria 1997
200 Ga0207664_10058646 3300025929 Bacteria 3063
201 Ga0207644_10035775 3300025931 Bacteria 3482
202 Ga0207706_10065811 3300025933 Bacteria 3191
203 Ga0207706_10939061 3300025933 Bacteria 729
204 Ga0207686_10653320 3300025934 Bacteria 832
205 Ga0207709_10063804 3300025935 Bacteria 2310
206 Ga0207704_10934713 3300025938 Bacteria 731
207 Ga0207665_10067433 3300025939 Bacteria 2437
208 Ga0207691_10321524 3300025940 Bacteria 1327
209 Ga0207689_10847061 3300025942 Bacteria 772
210 Ga0207661_10020009 3300025944 Bacteria 4997
211 Ga0207661_10142724 3300025944 Bacteria 2062
212 Ga0207661_10147362 3300025944 Bacteria 2032
213 Ga0207661_10194868 3300025944 Bacteria 1778
214 Ga0207679_10099570 3300025945 Bacteria 2270
215 Ga0207679_10332098 3300025945 Bacteria 1320
216 Ga0207679_11392206 3300025945 Bacteria 644
217 Ga0207667_10336955 3300025949 Bacteria 1540
218 Ga0207712_10422745 3300025961 Bacteria 1125
219 Ga0207712_12041465 3300025961 Bacteria 513
220 Ga0207668_10021688 3300025972 Bacteria 4100
221 Ga0207640_10137731 3300025981 Bacteria 1774
222 Ga0207677_10469951 3300026023 Bacteria 1081
223 Ga0207677_11764824 3300026023 Bacteria 574
224 Ga0207678_10053619 3300026067 Bacteria 3475
225 Ga0207678_12002138 3300026067 Bacteria 504
226 Ga0207702_10005529 3300026078 Bacteria 11042
227 Ga0207702_11107760 3300026078 Bacteria 786
228 Ga0207648_10015906 3300026089 Bacteria 6896
229 Ga0207674_10001533 3300026116 Bacteria 29751
230 Ga0207674_10034811 3300026116 Bacteria 5260
231 Ga0207674_10065013 3300026116 Bacteria 3678
232 Ga0207675_100007396 3300026118 Bacteria 10378
233 Ga0207675_100314851 3300026118 Bacteria 1527
234 Ga0207683_10003316 3300026121 Bacteria 14033
235 Ga0207683_10462908 3300026121 Bacteria 1169
236 Ga0207428_10020175 3300027907 Bacteria 5667
237 Ga0207428_10055472 3300027907 Bacteria 3151
238 Ga0207428_10312742 3300027907 Bacteria 1161
239 Ga0207428_10350057 3300027907 Bacteria 1087
240 Ga0307406_10533384 3300031901 Bacteria 957
241 Ga0307416_100056427 3300032002 Bacteria 3170
242 Ga0307416_100346190 3300032002 Bacteria 1502
243 Ga0307415_100078464 3300032126 Bacteria 2349
244 Ga0373930_0102844 3300034816 Bacteria 681
245 Ga0373928_0160926 3300035084 Bacteria 627
246 Ga0373940_0032086 3300035088 Bacteria 1406
247 Ga0373944_0007939 3300035089 Bacteria 2859
248 Ga0373949_0029724 3300035090 Bacteria 1296
249 Ga0373951_0016855 3300035091 Bacteria 1651
250 Ga0373932_0363418 3300035112 Bacteria 553
251 Ga0373939_0067497 3300035114 Bacteria 1156
252 Ga0373960_0007501 3300035121 Bacteria 2586
253 Ga0373943_0003657 3300035170 Bacteria 6990
254 Ga0373946_0016439 3300035171 Bacteria 2819
255 Ga0373961_0123147 3300035241 Bacteria 861
256 Ga0373962_0053225 3300035242 Bacteria 1171
257 Ga0373962_0118666 3300035242 Bacteria 842
258 Ga0373931_0256498 3300035691 Bacteria 1065
259 Ga0373947_0000992 3300035725 Bacteria 17358
260 Ga0373925_0041259 3300037068 Bacteria 3420
261 Ga0395899_0008641 3300037312 Bacteria 7835
262 Ga0395899_0054562 3300037312 Bacteria 2957
263 Ga0395899_0288546 3300037312 Bacteria 1114
264 Ga0395900_0006244 3300037418 Bacteria 12435
265 Ga0395900_0007650 3300037418 Bacteria 11155
266 Ga0395900_0049489 3300037418 Bacteria 4330
267 Ga0395900_0063763 3300037418 Bacteria 3787
268 Ga0395900_0157619 3300037418 Bacteria 2318
269 Ga0395900_0174847 3300037418 Bacteria 2184
270 Ga0395900_0358164 3300037418 Bacteria 1431
271 Ga0395900_0729525 3300037418 Bacteria 923
272 Ga0395898_0012600 3300037466 Bacteria 8742
273 Ga0395898_0054295 3300037466 Bacteria 3910
274 Ga0395898_0065210 3300037466 Bacteria 3531
275 Ga0395898_0499802 3300037466 Bacteria 1156
276 Ga0395898_1653158 3300037466 Bacteria 564
277 Ga0395905_0007092 3300037471 Bacteria 11202
278 Ga0395905_0010901 3300037471 Bacteria 8803
279 Ga0395905_0021662 3300037471 Bacteria 6080
280 Ga0395905_0129889 3300037471 Bacteria 2369
281 Ga0395905_0953314 3300037471 Bacteria 761
282 Ga0395905_1129599 3300037471 Bacteria 687
283 Ga0395901_0005862 3300038443 Bacteria 12429
284 Ga0395901_0006748 3300038443 Bacteria 11591
285 Ga0395901_0007345 3300038443 Bacteria 11121
286 Ga0395901_0039473 3300038443 Bacteria 4885
287 Ga0395901_0094831 3300038443 Bacteria 3127
288 Ga0395901_0105389 3300038443 Bacteria 2959
289 Ga0395901_0125111 3300038443 Bacteria 2701
290 Ga0395901_0206125 3300038443 Bacteria 2060
291 Ga0395901_0478929 3300038443 Bacteria 1270
292 Ga0395901_1405882 3300038443 Bacteria 656
293 Ga0451853_0144648 3300041512 Unclassified 1264
294 Ga0451853_2215404 3300041512 Bacteria 1365
295 Ga0439450_055177 3300042008 Bacteria 951
296 Ga0439455_0093089 3300042012 Bacteria 828
297 Ga0439463_159876 3300042016 Bacteria 584
298 Ga0439464_0226612 3300042439 Bacteria 600
299 Ga0439440_0023957 3300042993 Bacteria 1396
300 Ga0466964_0007987 3300044706 Bacteria 3963
301 Ga0466959_0407988 3300045049 Bacteria 923
302 Ga0451576_0032529 3300045051 Bacteria 5552
303 Ga0466958_0989927 3300045836 Bacteria 549
304 Ga0466967_0216478 3300045976 Bacteria 1818
305 Ga0466967_0434051 3300045976 Bacteria 1282
306 Ga0466967_1875788 3300045976 Bacteria 596
307 Ga0495592_0364649 3300046454 Bacteria 923
308 Ga0495603_0001721 3300046455 Bacteria 12889
309 Ga0495603_0110932 3300046455 Bacteria 1600
310 Ga0495603_0431676 3300046455 Bacteria 755
311 Ga0495590_0200786 3300046457 Bacteria 733
312 Ga0495641_0001084 3300046461 Bacteria 23453
313 Ga0495653_0148999 3300046463 Bacteria 1637
314 Ga0495582_0007333 3300046473 Bacteria 6111
315 Ga0495582_0009918 3300046473 Bacteria 5241
316 Ga0495639_0055905 3300046475 Bacteria 1801
317 Ga0495662_0574060 3300046476 Bacteria 552
318 Ga0495664_0324934 3300046477 Bacteria 928
319 Ga0495584_0218584 3300046491 Bacteria 969
320 Ga0495585_0194534 3300046492 Bacteria 1036
321 Ga0495594_0002461 3300046499 Bacteria 9634
322 Ga0495594_0088604 3300046499 Bacteria 1733
323 Ga0495607_0530310 3300046501 Bacteria 519
324 Ga0495628_0618636 3300046516 Bacteria 772
325 Ga0495637_0153922 3300046520 Bacteria 866
326 Ga0495644_0273500 3300046523 Bacteria 658
327 Ga0495663_0120034 3300046525 Bacteria 880
328 Ga0495663_0130234 3300046525 Bacteria 848
329 Ga0495642_0033634 3300046528 Bacteria 2062
330 Ga0495642_0401674 3300046528 Bacteria 604
331 Ga0495652_0640732 3300046529 Bacteria 721
332 Ga0495665_0174193 3300046531 Bacteria 1119
333 Ga0495665_0663279 3300046531 Bacteria 519
334 Ga0495586_0065410 3300046535 Bacteria 1982
335 Ga0495609_0103454 3300046538 Bacteria 1233
336 Ga0495656_0064079 3300046615 Bacteria 1613
337 Ga0495611_0371076 3300046648 Bacteria 656
338 Ga0495659_0200664 3300046664 Bacteria 818
339 Ga0495588_0000750 3300046674 Bacteria 14820
340 Ga0495588_0014847 3300046674 Bacteria 3738
341 Ga0495588_0661646 3300046674 Bacteria 546
342 Ga0495599_0396102 3300046678 Bacteria 823
343 Ga0495647_0037973 3300046681 Bacteria 1820
344 Ga0495658_0057271 3300046683 Bacteria 2226
345 Ga0495624_0471702 3300046690 Bacteria 752
346 Ga0495670_0105233 3300046691 Bacteria 1457
347 Ga0495671_0121937 3300046692 Bacteria 1272
348 Ga0495660_0169775 3300046810 Bacteria 1063
349 Ga0495581_0000328 3300047315 Bacteria 23476
350 Ga0495676_0001211 3300047321 Bacteria 22079
351 Ga0495676_0044874 3300047321 Bacteria 3603
352 Ga0495679_126106 3300047446 Bacteria 697
353 Ga0495685_125915 3300047447 Bacteria 840
354 Ga0496100_0015682 3300048903 Bacteria 4429
355 Ga0496100_0084823 3300048903 Bacteria 2148
356 Ga0496100_0092329 3300048903 Bacteria 2068
357 Ga0496100_0939057 3300048903 Bacteria 680
358 Ga0496100_1024637 3300048903 Bacteria 650
359 Ga0496101_0536943 3300048904 Bacteria 924
360 Ga0496101_1148250 3300048904 Bacteria 609
361 Ga0496102_0082461 3300048905 Bacteria 2965
362 Ga0496102_0102265 3300048905 Bacteria 2664
363 Ga0496102_0880210 3300048905 Bacteria 817
364 Ga0496102_0947057 3300048905 Bacteria 782
365 Ga0496103_0011725 3300048906 Bacteria 5200
366 Ga0496104_0002068 3300048907 Bacteria 17435
367 Ga0496104_0718542 3300048907 Bacteria 906
368 Ga0496105_0004758 3300048908 Bacteria 10247
369 Ga0496105_0052992 3300048908 Bacteria 3350
370 Ga0496105_0368464 3300048908 Bacteria 1145
371 Ga0496106_0008428 3300048909 Bacteria 7627
372 Ga0496106_0095490 3300048909 Bacteria 2300
373 Ga0496106_0192745 3300048909 Bacteria 1621
374 Ga0496106_0512289 3300048909 Bacteria 963
375 Ga0496107_0001767 3300048910 Bacteria 13615
376 Ga0496107_0097130 3300048910 Bacteria 2156
377 Ga0496107_0166259 3300048910 Bacteria 1636
378 Ga0496108_0042070 3300048911 Bacteria 3813
379 Ga0496108_0329451 3300048911 Bacteria 1331
380 Ga0496108_0377931 3300048911 Bacteria 1237
381 Ga0496108_0413724 3300048911 Bacteria 1178
382 Ga0496108_0426765 3300048911 Bacteria 1158
383 Ga0496109_0030204 3300048912 Bacteria 4857
384 Ga0496109_0064346 3300048912 Bacteria 3356
385 Ga0496109_0106451 3300048912 Bacteria 2605
386 Ga0496109_0150001 3300048912 Bacteria 2183
387 Ga0496109_0788347 3300048912 Bacteria 888
388 Ga0496109_1013361 3300048912 Bacteria 768
389 Ga0496110_0005118 3300048913 Bacteria 10243
390 Ga0496110_0050969 3300048913 Bacteria 3636
391 Ga0496110_0175373 3300048913 Bacteria 1946
392 Ga0496110_0359449 3300048913 Bacteria 1327
393 Ga0496111_0002625 3300048914 Bacteria 10894
394 Ga0496111_0042642 3300048914 Bacteria 3259
395 Ga0496111_0070831 3300048914 Bacteria 2537
396 Ga0496111_0087639 3300048914 Bacteria 2278
397 Ga0496111_0304599 3300048914 Bacteria 1181
398 Ga0496111_0325959 3300048914 Bacteria 1137
399 Ga0496112_0006354 3300048915 Bacteria 10370
400 Ga0496112_0036594 3300048915 Bacteria 4788
401 Ga0496112_0127036 3300048915 Bacteria 2520
402 Ga0496112_0860624 3300048915 Bacteria 830
403 Ga0496113_0020517 3300048916 Bacteria 4647
404 Ga0496113_0128723 3300048916 Bacteria 1985
405 Ga0496113_0274927 3300048916 Bacteria 1347
406 Ga0496113_0691935 3300048916 Bacteria 814
407 Ga0496113_0731286 3300048916 Bacteria 789
408 Ga0496114_0143856 3300048917 Bacteria 2066
409 Ga0496114_0162515 3300048917 Bacteria 1942
410 Ga0496115_0067028 3300048918 Bacteria 2902
411 Ga0496115_0070554 3300048918 Bacteria 2832
412 Ga0501031_0012115 3300049568 Bacteria 5621
413 Ga0501031_0193091 3300049568 Unclassified 1329
414 Ga0501032_0113292 3300049569 Bacteria 1794
415 Ga0501032_0965247 3300049569 Unclassified 536
416 Ga0501036_0081568 3300049572 Bacteria 2733
417 Ga0501036_1175633 3300049572 Unclassified 625
418 Ga0501038_0015452 3300049574 Bacteria 6940
419 Ga0501038_0261405 3300049574 Unclassified 1368
420 Ga0501039_0009414 3300049575 Bacteria 7447
421 Ga0501039_0261222 3300049575 Unclassified 1361
422 Ga0501040_0049211 3300049576 Bacteria 2881
423 Ga0501040_0049843 3300049576 Unclassified 2864
424 Ga0501041_0003191 3300049577 Bacteria 9428
425 Ga0501041_0340659 3300049577 Bacteria 947
426 Ga0501042_0008000 3300049578 Bacteria 6957
427 Ga0501042_0536614 3300049578 Bacteria 850
428 Ga0501043_0553292 3300049579 Bacteria 854
429 Ga0501046_0025552 3300049580 Bacteria 4833
430 Ga0501048_0005396 3300049582 Bacteria 9721
431 Ga0501067_0004430 3300049583 Bacteria 7740
432 Ga0501068_0007311 3300049584 Bacteria 6117
433 Ga0501069_0005357 3300049585 Bacteria 6673
434 Ga0501069_0405736 3300049585 Bacteria 807
435 Ga0501070_0014595 3300049586 Bacteria 6611
436 Ga0501070_0142728 3300049586 Bacteria 1977
437 Ga0501072_0042425 3300049588 Bacteria 3573
438 Ga0501073_0049816 3300049589 Bacteria 2936
439 Ga0501074_0014109 3300049590 Bacteria 5809
440 Ga0501075_0006673 3300049591 Bacteria 7960
441 Ga0501075_0093071 3300049591 Bacteria 2288
442 Ga0501076_0014406 3300049592 Bacteria 5955
443 Ga0501077_0003200 3300049593 Bacteria 9860
444 Ga0501079_0008001 3300049741 Bacteria 8012
445 Ga0501079_0052876 3300049741 Unclassified 3134
446 Ga0501079_1328837 3300049741 Bacteria 566
447 Ga0501080_0054326 3300049742 Bacteria 3729
448 Ga0501081_0243561 3300049743 Unclassified 1311
449 Ga0501083_0030898 3300049744 Bacteria 3676
450 Ga0501083_0281111 3300049744 Bacteria 1083
451 Ga0501035_0013923 3300049822 Bacteria 7422
452 Ga0501045_0075289 3300049824 Bacteria 2486
453 Ga0501045_0161431 3300049824 Unclassified 1668
454 nmdc:mga06z11_705783_c1 3300050494 Bacteria 614
455 nmdc:mga05p37_192508_c1 3300050507 Bacteria 2475
456 nmdc:mga05p37_479049_c1 3300050507 Bacteria 1434
457 nmdc:mga09592_1291108_c1 3300050508 Bacteria 600
458 nmdc:mga09592_33408_c1 3300050508 Bacteria 4294
459 nmdc:mga09592_822352_c1 3300050508 Bacteria 785
460 nmdc:mga06r32_1550684_c1 3300050510 Bacteria 602
461 nmdc:mga06r32_174228_c1 3300050510 Bacteria 2135
462 nmdc:mga06r32_238784_c1 3300050510 Bacteria 1805
463 nmdc:mga08y16_1125599_c1 3300050511 Bacteria 759
464 nmdc:mga08y16_165613_c1 3300050511 Bacteria 2296
465 nmdc:mga08y16_240953_c1 3300050511 Bacteria 1870
466 nmdc:mga08y16_981166_c1 3300050511 Bacteria 826
467 nmdc:mga0n895_114384_c1 3300050512 Bacteria 2716
468 nmdc:mga0n895_4880_c1 3300050512 Bacteria 11111
469 nmdc:mga0n895_594893_c1 3300050512 Bacteria 1109
470 nmdc:mga0rr50_18709_c1 3300050513 Bacteria 4660
471 nmdc:mga0rr50_601191_c1 3300050513 Bacteria 938
472 nmdc:mga0rr50_691876_c1 3300050513 Bacteria 870
473 nmdc:mga0rr50_74607_c1 3300050513 Bacteria 2597
474 nmdc:mga0rr50_893014_c1 3300050513 Bacteria 758
475 nmdc:mga08x19_20431_c1 3300050514 Bacteria 4077
476 nmdc:mga0a205_13456_c1 3300050515 Bacteria 7618
477 nmdc:mga0a205_397364_c1 3300050515 Bacteria 1242
478 nmdc:mga0a205_44523_c1 3300050515 Bacteria 4278
479 nmdc:mga0a205_526004_c1 3300050515 Bacteria 1039
480 nmdc:mga0a205_798876_c1 3300050515 Bacteria 791
481 Ga0495601_0527101 3300053077 Bacteria 761
482 Ga0495619_0587550 3300053085 Bacteria 762
483 Ga0501084_0441425 3300054114 Bacteria 1100
484 Ga0501082_0024511 3300060353 Bacteria 5200
485 Ga0501082_0464227 3300060353 Unclassified 1106
486 Ga0530510_0008238 3300061734 Bacteria 7268
487 Ga0530510_0069659 3300061734 Bacteria 2552
488 Ga0081540_1010557
489 JGI25406J46586_10065979
490 JGI25405J52794_10048011
491 Ga0070676_10692233
492 Ga0070683_100002174
493 Ga0070683_100007005
494 Ga0070683_100027227
495 Ga0070683_100229830
496 Ga0070683_100231281
497 Ga0070680_100094140
498 Ga0070680_100190912
499 Ga0070682_100026116
500 Ga0070682_100227825
501 Ga0068868_100022969
502 Ga0068868_100093953
503 Ga0068868_100190650
504 Ga0070691_10030380
505 Ga0070691_10103935
506 Ga0070661_100995888
507 Ga0070668_100037946
508 Ga0070675_100825437
509 Ga0070673_100368055
510 Ga0070688_100339198
511 Ga0070659_101498338
512 Ga0070667_101006829
513 Ga0070709_10018876
514 Ga0070714_100033610
515 Ga0070713_100070163
516 Ga0070710_10034550
517 Ga0070701_10028687
518 Ga0070705_100017179
519 Ga0070705_100449234
520 Ga0070700_100851954
521 Ga0070694_100977580
522 Ga0070708_100611454
523 Ga0070663_100131090
524 Ga0070662_100127748
525 Ga0070662_101032704
526 Ga0070681_10575580
527 Ga0068867_100204126
528 Ga0070685_11503030
529 Ga0070706_100347436
530 Ga0070706_100747683
531 Ga0070699_100088057
532 Ga0070679_100148376
533 Ga0070679_100248383
534 Ga0070684_100003754
535 Ga0070684_100009078
536 Ga0070684_100043779
537 Ga0070684_101067080
538 Ga0070684_101974274
539 Ga0070697_101211534
540 Ga0070686_100096865
541 Ga0070686_100125380
542 Ga0070695_100469563
543 Ga0070696_100342550
544 Ga0070696_100356781
545 Ga0070693_100007863
546 Ga0070693_100058952
547 Ga0070704_100388550
548 Ga0070704_100623611
549 Ga0070704_101932347
550 Ga0070704_101994186
551 Ga0068855_100299949
552 Ga0070664_100087926
553 Ga0070664_100744775
554 Ga0070664_101696050
555 Ga0068857_100005906
556 Ga0068857_100022277
557 Ga0068857_100053926
558 Ga0068854_100190259
559 Ga0068856_100065423
560 Ga0068856_100311934
561 Ga0070702_100083739
562 Ga0070702_100377411
563 Ga0068852_100330157
564 Ga0068864_100433169
565 Ga0068861_100051128
566 Ga0068861_101403614
567 Ga0068870_10092967
568 Ga0068863_101160236
569 Ga0068863_102005309
570 Ga0081455_10004491
571 Ga0081455_10029041
572 Ga0081455_10053623
573 Ga0081455_10254982
574 Ga0081455_10813912
575 Ga0081540_1008108
576 Ga0081540_1013154
577 Ga0070717_10317429
578 Ga0070717_10940774
579 Ga0075363_100632264
580 Ga0075432_10332948
581 Ga0070715_10011512
582 Ga0070715_10018527
583 Ga0070716_100017818
584 Ga0070712_100032340
585 Ga0070712_100500488
586 Ga0075367_10436963
587 Ga0068871_100657162
588 Ga0075428_100016230
589 Ga0075428_100063538
590 Ga0075428_100115811
591 Ga0075431_100407704
592 Ga0075433_10040281
593 Ga0075433_10153539
594 Ga0075433_10158567
595 Ga0075433_10273700
596 Ga0075433_10519258
597 Ga0075433_10551693
598 Ga0075434_100079896
599 Ga0075434_100216953
600 Ga0075434_100556621
601 Ga0075429_100400248
602 Ga0075429_100482890
603 Ga0068865_100076199
604 Ga0068865_101068162
605 Ga0075436_100162491
606 Ga0075435_100069076
607 Ga0075435_100406230
608 Ga0075435_100424403
609 Ga0075435_100470077
610 Ga0105240_10921586
611 Ga0111539_10189190
612 Ga0111539_10195306
613 Ga0111539_10451985
614 Ga0111539_10907831
615 Ga0111539_12030973
616 Ga0105245_10014549
617 Ga0105245_10084953
618 Ga0105245_13230144
619 Ga0114129_10052117
620 Ga0114129_10213424
621 Ga0114129_10652644
622 Ga0114129_11489560
623 Ga0114129_11896159
624 Ga0114129_12313721
625 Ga0105243_10086057
626 Ga0105243_10216383
627 Ga0105241_10026322
628 Ga0105242_10175153
629 Ga0105242_10179266
630 Ga0105248_11886653
631 Ga0105237_11472705
632 Ga0105249_10053247
633 Ga0105249_10411415
634 Ga0105239_10052781
635 Ga0105239_10324903
636 Ga0105239_10421547
637 Ga0105239_10590191
638 Ga0105239_10622540
639 Ga0105246_10284075
640 Ga0105246_10831175
641 Ga0105246_11786288
642 Ga0157339_1006479
643 Ga0157342_1003900
644 Ga0157316_1079682
645 Ga0157338_1006206
646 Ga0157373_10136600
647 Ga0157371_10789945
648 Ga0157378_10397638
649 Ga0157378_11245498
650 Ga0157378_11433478
651 Ga0163162_10025172
652 Ga0157372_10129763
653 Ga0157372_10189077
654 Ga0157375_10260642
655 Ga0157375_10328200
656 Ga0157380_10305228
657 Ga0157377_10274989
658 Ga0157376_10080254
659 Ga0157376_10541533
660 Ga0163161_10041882
661 Ga0206356_11219157
662 Ga0207692_10131846
663 Ga0207642_10031814
664 Ga0207688_10203134
665 Ga0207688_10385100
666 Ga0207688_10507873
667 Ga0207685_10009680
668 Ga0207685_10075378
669 Ga0207699_10070474
670 Ga0207645_10626301
671 Ga0207684_10180207
672 Ga0207654_10081185
673 Ga0207707_10456003
674 Ga0207693_10025407
675 Ga0207693_10053062
676 Ga0207693_10258021
677 Ga0207663_10020330
678 Ga0207663_10035973
679 Ga0207660_10060863
680 Ga0207646_10353602
681 Ga0207681_11576741
682 Ga0207687_10018726
683 Ga0207687_10061662
684 Ga0207687_10492325
685 Ga0207687_10748137
686 Ga0207700_10138383
687 Ga0207664_10058646
688 Ga0207644_10035775
689 Ga0207706_10065811
690 Ga0207706_10939061
691 Ga0207686_10653320
692 Ga0207709_10063804
693 Ga0207704_10934713
694 Ga0207665_10067433
695 Ga0207691_10321524
696 Ga0207689_10847061
697 Ga0207661_10020009
698 Ga0207661_10142724
699 Ga0207661_10147362
700 Ga0207661_10194868
701 Ga0207679_10099570
702 Ga0207679_10332098
703 Ga0207679_11392206
704 Ga0207667_10336955
705 Ga0207712_10422745
706 Ga0207712_12041465
707 Ga0207668_10021688
708 Ga0207640_10137731
709 Ga0207677_10469951
710 Ga0207677_11764824
711 Ga0207678_10053619
712 Ga0207678_12002138
713 Ga0207702_10005529
714 Ga0207702_11107760
715 Ga0207648_10015906
716 Ga0207674_10001533
717 Ga0207674_10034811
718 Ga0207674_10065013
719 Ga0207675_100007396
720 Ga0207675_100314851
721 Ga0207683_10003316
722 Ga0207683_10462908
723 Ga0207428_10020175
724 Ga0207428_10055472
725 Ga0207428_10312742
726 Ga0207428_10350057
727 Ga0307406_10533384
728 Ga0307416_100056427
729 Ga0307416_100346190
730 Ga0307415_100078464
731 Ga0373930_0102844
732 Ga0373928_0160926
733 Ga0373940_0032086
734 Ga0373944_0007939
735 Ga0373949_0029724
736 Ga0373951_0016855
737 Ga0373932_0363418
738 Ga0373939_0067497
739 Ga0373960_0007501
740 Ga0373943_0003657
741 Ga0373946_0016439
742 Ga0373961_0123147
743 Ga0373962_0053225
744 Ga0373962_0118666
745 Ga0373931_0256498
746 Ga0373947_0000992
747 Ga0373925_0041259
748 Ga0395899_0008641
749 Ga0395899_0054562
750 Ga0395899_0288546
751 Ga0395900_0006244
752 Ga0395900_0007650
753 Ga0395900_0049489
754 Ga0395900_0063763
755 Ga0395900_0157619
756 Ga0395900_0174847
757 Ga0395900_0358164
758 Ga0395900_0729525
759 Ga0395898_0012600
760 Ga0395898_0054295
761 Ga0395898_0065210
762 Ga0395898_0499802
763 Ga0395898_1653158
764 Ga0395905_0007092
765 Ga0395905_0010901
766 Ga0395905_0021662
767 Ga0395905_0129889
768 Ga0395905_0953314
769 Ga0395905_1129599
770 Ga0395901_0005862
771 Ga0395901_0006748
772 Ga0395901_0007345
773 Ga0395901_0039473
774 Ga0395901_0094831
775 Ga0395901_0105389
776 Ga0395901_0125111
777 Ga0395901_0206125
778 Ga0395901_0478929
779 Ga0395901_1405882
780 Ga0451853_0144648
781 Ga0451853_2215404
782 Ga0439450_055177
783 Ga0439455_0093089
784 Ga0439463_159876
785 Ga0439464_0226612
786 Ga0439440_0023957
787 Ga0466964_0007987
788 Ga0466959_0407988
789 Ga0451576_0032529
790 Ga0466958_0989927
791 Ga0466967_0216478
792 Ga0466967_0434051
793 Ga0466967_1875788
794 Ga0495592_0364649
795 Ga0495603_0001721
796 Ga0495603_0110932
797 Ga0495603_0431676
798 Ga0495590_0200786
799 Ga0495641_0001084
800 Ga0495653_0148999
801 Ga0495582_0007333
802 Ga0495582_0009918
803 Ga0495639_0055905
804 Ga0495662_0574060
805 Ga0495664_0324934
806 Ga0495584_0218584
807 Ga0495585_0194534
808 Ga0495594_0002461
809 Ga0495594_0088604
810 Ga0495607_0530310
811 Ga0495628_0618636
812 Ga0495637_0153922
813 Ga0495644_0273500
814 Ga0495663_0120034
815 Ga0495663_0130234
816 Ga0495642_0033634
817 Ga0495642_0401674
818 Ga0495652_0640732
819 Ga0495665_0174193
820 Ga0495665_0663279
821 Ga0495586_0065410
822 Ga0495609_0103454
823 Ga0495656_0064079
824 Ga0495611_0371076
825 Ga0495659_0200664
826 Ga0495588_0000750
827 Ga0495588_0014847
828 Ga0495588_0661646
829 Ga0495599_0396102
830 Ga0495647_0037973
831 Ga0495658_0057271
832 Ga0495624_0471702
833 Ga0495670_0105233
834 Ga0495671_0121937
835 Ga0495660_0169775
836 Ga0495581_0000328
837 Ga0495676_0001211
838 Ga0495676_0044874
839 Ga0495679_126106
840 Ga0495685_125915
841 Ga0496100_0015682
842 Ga0496100_0084823
843 Ga0496100_0092329
844 Ga0496100_0939057
845 Ga0496100_1024637
846 Ga0496101_0536943
847 Ga0496101_1148250
848 Ga0496102_0082461
849 Ga0496102_0102265
850 Ga0496102_0880210
851 Ga0496102_0947057
852 Ga0496103_0011725
853 Ga0496104_0002068
854 Ga0496104_0718542
855 Ga0496105_0004758
856 Ga0496105_0052992
857 Ga0496105_0368464
858 Ga0496106_0008428
859 Ga0496106_0095490
860 Ga0496106_0192745
861 Ga0496106_0512289
862 Ga0496107_0001767
863 Ga0496107_0097130
864 Ga0496107_0166259
865 Ga0496108_0042070
866 Ga0496108_0329451
867 Ga0496108_0377931
868 Ga0496108_0413724
869 Ga0496108_0426765
870 Ga0496109_0030204
871 Ga0496109_0064346
872 Ga0496109_0106451
873 Ga0496109_0150001
874 Ga0496109_0788347
875 Ga0496109_1013361
876 Ga0496110_0005118
877 Ga0496110_0050969
878 Ga0496110_0175373
879 Ga0496110_0359449
880 Ga0496111_0002625
881 Ga0496111_0042642
882 Ga0496111_0070831
883 Ga0496111_0087639
884 Ga0496111_0304599
885 Ga0496111_0325959
886 Ga0496112_0006354
887 Ga0496112_0036594
888 Ga0496112_0127036
889 Ga0496112_0860624
890 Ga0496113_0020517
891 Ga0496113_0128723
892 Ga0496113_0274927
893 Ga0496113_0691935
894 Ga0496113_0731286
895 Ga0496114_0143856
896 Ga0496114_0162515
897 Ga0496115_0067028
898 Ga0496115_0070554
899 Ga0501031_0012115
900 Ga0501031_0193091
901 Ga0501032_0113292
902 Ga0501032_0965247
903 Ga0501036_0081568
904 Ga0501036_1175633
905 Ga0501038_0015452
906 Ga0501038_0261405
907 Ga0501039_0009414
908 Ga0501039_0261222
909 Ga0501040_0049211
910 Ga0501040_0049843
911 Ga0501041_0003191
912 Ga0501041_0340659
913 Ga0501042_0008000
914 Ga0501042_0536614
915 Ga0501043_0553292
916 Ga0501046_0025552
917 Ga0501048_0005396
918 Ga0501067_0004430
919 Ga0501068_0007311
920 Ga0501069_0005357
921 Ga0501069_0405736
922 Ga0501070_0014595
923 Ga0501070_0142728
924 Ga0501072_0042425
925 Ga0501073_0049816
926 Ga0501074_0014109
927 Ga0501075_0006673
928 Ga0501075_0093071
929 Ga0501076_0014406
930 Ga0501077_0003200
931 Ga0501079_0008001
932 Ga0501079_0052876
933 Ga0501079_1328837
934 Ga0501080_0054326
935 Ga0501081_0243561
936 Ga0501083_0030898
937 Ga0501083_0281111
938 Ga0501035_0013923
939 Ga0501045_0075289
940 Ga0501045_0161431
941 nmdc:mga06z11_705783_c1
942 nmdc:mga05p37_192508_c1
943 nmdc:mga05p37_479049_c1
944 nmdc:mga09592_1291108_c1
945 nmdc:mga09592_33408_c1
946 nmdc:mga09592_822352_c1
947 nmdc:mga06r32_1550684_c1
948 nmdc:mga06r32_174228_c1
949 nmdc:mga06r32_238784_c1
950 nmdc:mga08y16_1125599_c1
951 nmdc:mga08y16_165613_c1
952 nmdc:mga08y16_240953_c1
953 nmdc:mga08y16_981166_c1
954 nmdc:mga0n895_114384_c1
955 nmdc:mga0n895_4880_c1
956 nmdc:mga0n895_594893_c1
957 nmdc:mga0rr50_18709_c1
958 nmdc:mga0rr50_601191_c1
959 nmdc:mga0rr50_691876_c1
960 nmdc:mga0rr50_74607_c1
961 nmdc:mga0rr50_893014_c1
962 nmdc:mga08x19_20431_c1
963 nmdc:mga0a205_13456_c1
964 nmdc:mga0a205_397364_c1
965 nmdc:mga0a205_44523_c1
966 nmdc:mga0a205_526004_c1
967 nmdc:mga0a205_798876_c1
968 Ga0495601_0527101
969 Ga0495619_0587550
970 Ga0501084_0441425
971 Ga0501082_0024511
972 Ga0501082_0464227
973 Ga0530510_0008238
974 Ga0530510_0069659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

5

133

0.99

PF08534

Redoxin

Redoxin

3

150

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9522 11 144
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9515 11 144
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9514 11 144
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9513 11 144
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9457 1 144
ID Description Score Start End Superfamily
af_O94561_50_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9599 6 144 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9525 2 144 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9522 11 144 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9445 3 144 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9436 2 144 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0P9S8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9928 1 144 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2N2F4W9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9904 2 143 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-T0CBZ4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9885 2 144 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A7X8YSU7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9879 2 144 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A2N9LLS1-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9873 1 144 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454

Map