F453295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 486 | 215 | 486 | 459 |
Family's Representative Sequence
| Representative Sequence | 3300035172|Ga0373955_0023640|Ga0373955_0023640_1184_2569 |
| Length | 447 |
| Sequence | MVEKSELLRVPAFADLPDNQIAWFIDRAEELRVKAGDQYFREGDAADAMFVVLEGQIQVRGELGGETAVFALKPGDVTGVLPFSRMKQFPVGARAVTGARVMRFPASLFPELIQKRIRETTRREQQRDRLASLGKLSAGLAHELNNPASAAKRATSQLRNILKKIRDTSHELGRRDLTPAQKAEIEKLEASFVQSNEVPPDPLTLSDLEGQIDSLLRSHGQTDLWQMAADLARRNVKPEALESLFAILDADTARAALVRIAASVEVATLLNEIESGTSRISELVRAIKEYTYMDQTPLQNVDIVQSLETTLTIMNHKLKHGVVVRRDYERVPLLVNSFGSELNQVWTNIIDNAIDAMGGKGELRLRTYRDDDFVVVEIGDNGPGILPAVRSHIFEPFFTTKGVGEGTGLGLDTVQRIVRKHRGNIEVSSKPGDTRFQIWLPLTEGLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 89 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 140 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 157 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 2.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.73 |
| Rhizosphere | 94.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10030449 | 3300005328 | Bacteria | 3078 |
| 2 | Ga0070683_100022347 | 3300005329 | Bacteria | 5652 |
| 3 | Ga0070680_100135917 | 3300005336 | Bacteria | 2059 |
| 4 | Ga0070682_100010418 | 3300005337 | Bacteria | 5275 |
| 5 | Ga0068868_100017780 | 3300005338 | Bacteria | 5302 |
| 6 | Ga0068868_100067190 | 3300005338 | Bacteria | 2853 |
| 7 | Ga0068868_100117203 | 3300005338 | Bacteria | 2169 |
| 8 | Ga0070660_100013666 | 3300005339 | Bacteria | 5834 |
| 9 | Ga0070691_10007626 | 3300005341 | Bacteria | 4960 |
| 10 | Ga0070661_100014503 | 3300005344 | Bacteria | 5552 |
| 11 | Ga0070661_100022940 | 3300005344 | Bacteria | 4471 |
| 12 | Ga0070668_100006585 | 3300005347 | Bacteria | 8605 |
| 13 | Ga0070671_100051387 | 3300005355 | Bacteria | 3428 |
| 14 | Ga0070673_100143536 | 3300005364 | Bacteria | 2016 |
| 15 | Ga0070659_100010936 | 3300005366 | Bacteria | 6698 |
| 16 | Ga0070667_100076622 | 3300005367 | Bacteria | 2855 |
| 17 | Ga0070709_10001689 | 3300005434 | Bacteria | 11985 |
| 18 | Ga0070709_10027888 | 3300005434 | Bacteria | 3362 |
| 19 | Ga0070709_10030086 | 3300005434 | Bacteria | 3255 |
| 20 | Ga0070709_10048935 | 3300005434 | Bacteria | 2640 |
| 21 | Ga0070714_100015274 | 3300005435 | Bacteria | 6177 |
| 22 | Ga0070714_100016929 | 3300005435 | Bacteria | 5896 |
| 23 | Ga0070714_100196450 | 3300005435 | Bacteria | 1843 |
| 24 | Ga0070713_100004271 | 3300005436 | Bacteria | 9561 |
| 25 | Ga0070713_100004772 | 3300005436 | Bacteria | 9175 |
| 26 | Ga0070713_100006605 | 3300005436 | Bacteria | 8061 |
| 27 | Ga0070713_100012711 | 3300005436 | Bacteria | 6185 |
| 28 | Ga0070713_100047542 | 3300005436 | Bacteria | 3528 |
| 29 | Ga0070713_100116042 | 3300005436 | Bacteria | 2341 |
| 30 | Ga0070710_10012216 | 3300005437 | Bacteria | 4258 |
| 31 | Ga0070710_10019531 | 3300005437 | Unclassified | 3503 |
| 32 | Ga0070710_10089339 | 3300005437 | Bacteria | 1814 |
| 33 | Ga0070711_100004715 | 3300005439 | Bacteria | 8072 |
| 34 | Ga0070711_100009118 | 3300005439 | Bacteria | 6096 |
| 35 | Ga0070711_100041731 | 3300005439 | Unclassified | 3100 |
| 36 | Ga0070711_100146012 | 3300005439 | Bacteria | 1779 |
| 37 | Ga0070705_100092219 | 3300005440 | Bacteria | 1890 |
| 38 | Ga0070708_100000925 | 3300005445 | Bacteria | 22216 |
| 39 | Ga0070708_100001334 | 3300005445 | Bacteria | 18845 |
| 40 | Ga0070708_100001870 | 3300005445 | Bacteria | 16151 |
| 41 | Ga0070708_100010380 | 3300005445 | Bacteria | 7546 |
| 42 | Ga0070708_100042929 | 3300005445 | Bacteria | 3972 |
| 43 | Ga0070708_100078243 | 3300005445 | Bacteria | 2989 |
| 44 | Ga0070708_100195911 | 3300005445 | Bacteria | 1890 |
| 45 | Ga0070662_100002615 | 3300005457 | Bacteria | 11109 |
| 46 | Ga0070662_100022380 | 3300005457 | Bacteria | 4327 |
| 47 | Ga0070662_100033081 | 3300005457 | Bacteria | 3639 |
| 48 | Ga0070681_10004555 | 3300005458 | Bacteria | 13221 |
| 49 | Ga0070681_10028520 | 3300005458 | Bacteria | 5612 |
| 50 | Ga0070681_10124869 | 3300005458 | Bacteria | 2506 |
| 51 | Ga0068867_100014007 | 3300005459 | Bacteria | 5678 |
| 52 | Ga0068867_100116800 | 3300005459 | Bacteria | 2057 |
| 53 | Ga0068867_100209643 | 3300005459 | Bacteria | 1564 |
| 54 | Ga0070706_100000447 | 3300005467 | Bacteria | 49339 |
| 55 | Ga0070706_100003164 | 3300005467 | Bacteria | 16264 |
| 56 | Ga0070706_100010583 | 3300005467 | Bacteria | 8558 |
| 57 | Ga0070706_100062223 | 3300005467 | Bacteria | 3448 |
| 58 | Ga0070707_100000799 | 3300005468 | Bacteria | 31045 |
| 59 | Ga0070707_100002488 | 3300005468 | Bacteria | 17551 |
| 60 | Ga0070707_100010468 | 3300005468 | Bacteria | 8638 |
| 61 | Ga0070707_100011860 | 3300005468 | Bacteria | 8136 |
| 62 | Ga0070707_100022000 | 3300005468 | Bacteria | 6028 |
| 63 | Ga0070707_100139135 | 3300005468 | Bacteria | 2362 |
| 64 | Ga0070707_100172211 | 3300005468 | Bacteria | 2109 |
| 65 | Ga0070698_100001031 | 3300005471 | Bacteria | 30624 |
| 66 | Ga0070698_100001802 | 3300005471 | Bacteria | 23850 |
| 67 | Ga0070698_100054516 | 3300005471 | Bacteria | 4058 |
| 68 | Ga0070698_100138723 | 3300005471 | Bacteria | 2384 |
| 69 | Ga0070699_100000360 | 3300005518 | Bacteria | 44403 |
| 70 | Ga0070699_100006341 | 3300005518 | Bacteria | 10314 |
| 71 | Ga0070699_100006743 | 3300005518 | Bacteria | 9986 |
| 72 | Ga0070699_100010395 | 3300005518 | Bacteria | 8052 |
| 73 | Ga0070699_100098327 | 3300005518 | Bacteria | 2564 |
| 74 | Ga0070699_100103603 | 3300005518 | Bacteria | 2495 |
| 75 | Ga0070679_100045891 | 3300005530 | Bacteria | 4354 |
| 76 | Ga0070679_100135703 | 3300005530 | Bacteria | 2442 |
| 77 | Ga0070684_100022509 | 3300005535 | Bacteria | 5257 |
| 78 | Ga0070697_100000045 | 3300005536 | Bacteria | 92181 |
| 79 | Ga0070697_100000435 | 3300005536 | Bacteria | 31985 |
| 80 | Ga0070697_100005216 | 3300005536 | Bacteria | 9982 |
| 81 | Ga0070697_100009779 | 3300005536 | Bacteria | 7481 |
| 82 | Ga0070697_100029813 | 3300005536 | Bacteria | 4378 |
| 83 | Ga0070697_100054756 | 3300005536 | Bacteria | 3242 |
| 84 | Ga0070697_100153296 | 3300005536 | Bacteria | 1943 |
| 85 | Ga0068853_100044615 | 3300005539 | Bacteria | 3795 |
| 86 | Ga0070695_100028429 | 3300005545 | Bacteria | 3469 |
| 87 | Ga0070665_100069131 | 3300005548 | Bacteria | 3539 |
| 88 | Ga0068855_100003041 | 3300005563 | Bacteria | 20545 |
| 89 | Ga0068855_100121173 | 3300005563 | Bacteria | 2993 |
| 90 | Ga0070664_100002870 | 3300005564 | Bacteria | 13959 |
| 91 | Ga0070664_100048767 | 3300005564 | Bacteria | 3579 |
| 92 | Ga0070664_100104328 | 3300005564 | Bacteria | 2468 |
| 93 | Ga0068857_100000041 | 3300005577 | Bacteria | 70173 |
| 94 | Ga0068854_100004461 | 3300005578 | Bacteria | 8826 |
| 95 | Ga0068854_100005101 | 3300005578 | Bacteria | 8271 |
| 96 | Ga0068856_100004609 | 3300005614 | Bacteria | 13702 |
| 97 | Ga0068856_100012784 | 3300005614 | Bacteria | 8126 |
| 98 | Ga0068856_100026125 | 3300005614 | Bacteria | 5693 |
| 99 | Ga0068856_100035395 | 3300005614 | Bacteria | 4893 |
| 100 | Ga0068856_100042355 | 3300005614 | Bacteria | 4478 |
| 101 | Ga0068856_100044851 | 3300005614 | Bacteria | 4351 |
| 102 | Ga0068859_100004671 | 3300005617 | Bacteria | 13948 |
| 103 | Ga0068859_100006322 | 3300005617 | Bacteria | 12012 |
| 104 | Ga0068864_100001347 | 3300005618 | Bacteria | 20427 |
| 105 | Ga0068864_100062876 | 3300005618 | Bacteria | 3217 |
| 106 | Ga0068864_100181613 | 3300005618 | Bacteria | 1924 |
| 107 | Ga0068861_100013076 | 3300005719 | Bacteria | 5804 |
| 108 | Ga0068851_10044844 | 3300005834 | Bacteria | 2234 |
| 109 | Ga0068863_100130138 | 3300005841 | Unclassified | 2403 |
| 110 | Ga0068863_100339791 | 3300005841 | Bacteria | 1461 |
| 111 | Ga0068858_100033812 | 3300005842 | Bacteria | 4742 |
| 112 | Ga0068858_100071251 | 3300005842 | Bacteria | 3223 |
| 113 | Ga0068860_100014414 | 3300005843 | Bacteria | 7744 |
| 114 | Ga0068862_100051938 | 3300005844 | Bacteria | 3507 |
| 115 | Ga0070717_10003200 | 3300006028 | Bacteria | 11700 |
| 116 | Ga0070717_10009825 | 3300006028 | Bacteria | 7205 |
| 117 | Ga0070717_10018181 | 3300006028 | Bacteria | 5485 |
| 118 | Ga0070717_10023963 | 3300006028 | Bacteria | 4842 |
| 119 | Ga0070717_10037918 | 3300006028 | Bacteria | 3915 |
| 120 | Ga0070717_10092662 | 3300006028 | Bacteria | 2553 |
| 121 | Ga0070717_10181930 | 3300006028 | Bacteria | 1833 |
| 122 | Ga0070715_10005968 | 3300006163 | Bacteria | 4108 |
| 123 | Ga0070716_100015742 | 3300006173 | Bacteria | 3891 |
| 124 | Ga0070716_100020395 | 3300006173 | Bacteria | 3479 |
| 125 | Ga0070716_100022067 | 3300006173 | Bacteria | 3361 |
| 126 | Ga0070716_100034250 | 3300006173 | Bacteria | 2783 |
| 127 | Ga0070716_100069874 | 3300006173 | Bacteria | 2060 |
| 128 | Ga0070716_100071329 | 3300006173 | Unclassified | 2042 |
| 129 | Ga0070712_100000370 | 3300006175 | Bacteria | 25384 |
| 130 | Ga0070712_100001018 | 3300006175 | Bacteria | 16902 |
| 131 | Ga0070712_100001309 | 3300006175 | Bacteria | 15064 |
| 132 | Ga0070712_100008154 | 3300006175 | Bacteria | 6578 |
| 133 | Ga0070712_100033499 | 3300006175 | Bacteria | 3477 |
| 134 | Ga0070712_100088630 | 3300006175 | Unclassified | 2261 |
| 135 | Ga0097621_100001702 | 3300006237 | Bacteria | 15036 |
| 136 | Ga0097621_100057064 | 3300006237 | Bacteria | 3192 |
| 137 | Ga0097621_100109668 | 3300006237 | Bacteria | 2331 |
| 138 | Ga0097621_100217018 | 3300006237 | Unclassified | 1665 |
| 139 | Ga0068871_100000567 | 3300006358 | Bacteria | 25299 |
| 140 | Ga0068871_100094219 | 3300006358 | Bacteria | 2499 |
| 141 | Ga0068871_100141585 | 3300006358 | Bacteria | 2045 |
| 142 | Ga0068871_100248038 | 3300006358 | Unclassified | 1550 |
| 143 | Ga0075431_100036619 | 3300006847 | Bacteria | 5053 |
| 144 | Ga0075433_10000750 | 3300006852 | Bacteria | 22261 |
| 145 | Ga0075433_10065459 | 3300006852 | Bacteria | 3188 |
| 146 | Ga0075434_100000235 | 3300006871 | Bacteria | 38289 |
| 147 | Ga0075434_100019125 | 3300006871 | Bacteria | 6622 |
| 148 | Ga0075434_100032840 | 3300006871 | Bacteria | 5119 |
| 149 | Ga0075434_100041036 | 3300006871 | Unclassified | 4583 |
| 150 | Ga0075434_100141249 | 3300006871 | Bacteria | 2428 |
| 151 | Ga0075434_100266012 | 3300006871 | Bacteria | 1734 |
| 152 | Ga0068865_100006463 | 3300006881 | Bacteria | 7151 |
| 153 | Ga0075436_100001682 | 3300006914 | Bacteria | 15120 |
| 154 | Ga0075436_100008991 | 3300006914 | Bacteria | 6835 |
| 155 | Ga0075436_100014517 | 3300006914 | Bacteria | 5397 |
| 156 | Ga0097620_100004671 | 3300006931 | Bacteria | 13948 |
| 157 | Ga0097620_100006322 | 3300006931 | Bacteria | 12012 |
| 158 | Ga0075435_100000913 | 3300007076 | Bacteria | 18604 |
| 159 | Ga0075435_100034333 | 3300007076 | Bacteria | 4018 |
| 160 | Ga0075435_100199168 | 3300007076 | Bacteria | 1697 |
| 161 | Ga0099795_10028592 | 3300007788 | Unclassified | 1898 |
| 162 | Ga0099795_10045537 | 3300007788 | Bacteria | 1578 |
| 163 | Ga0105240_10017819 | 3300009093 | Bacteria | 9557 |
| 164 | Ga0105240_10022968 | 3300009093 | Bacteria | 8261 |
| 165 | Ga0105240_10041408 | 3300009093 | Bacteria | 5879 |
| 166 | Ga0105240_10135838 | 3300009093 | Bacteria | 2945 |
| 167 | Ga0105245_10007693 | 3300009098 | Bacteria | 9438 |
| 168 | Ga0105245_10039381 | 3300009098 | Bacteria | 4207 |
| 169 | Ga0105247_10019668 | 3300009101 | Bacteria | 4054 |
| 170 | Ga0114129_10068915 | 3300009147 | Bacteria | 4931 |
| 171 | Ga0114129_10338061 | 3300009147 | Bacteria | 1998 |
| 172 | Ga0105241_10004435 | 3300009174 | Bacteria | 10379 |
| 173 | Ga0105241_10011600 | 3300009174 | Bacteria | 6461 |
| 174 | Ga0105241_10043833 | 3300009174 | Bacteria | 3388 |
| 175 | Ga0105242_10064905 | 3300009176 | Bacteria | 3010 |
| 176 | Ga0105248_10028476 | 3300009177 | Bacteria | 6224 |
| 177 | Ga0105248_10125604 | 3300009177 | Bacteria | 2894 |
| 178 | Ga0105248_10382075 | 3300009177 | Bacteria | 1586 |
| 179 | Ga0105237_10092154 | 3300009545 | Bacteria | 3020 |
| 180 | Ga0105238_10263676 | 3300009551 | Bacteria | 1703 |
| 181 | Ga0105249_10008547 | 3300009553 | Bacteria | 8927 |
| 182 | Ga0105239_10006179 | 3300010375 | Bacteria | 13938 |
| 183 | Ga0105239_10053451 | 3300010375 | Bacteria | 4431 |
| 184 | Ga0105239_10072098 | 3300010375 | Bacteria | 3796 |
| 185 | Ga0105239_10205064 | 3300010375 | Bacteria | 2209 |
| 186 | Ga0105239_10256535 | 3300010375 | Bacteria | 1965 |
| 187 | Ga0157373_10001908 | 3300013100 | Bacteria | 15811 |
| 188 | Ga0157373_10054660 | 3300013100 | Bacteria | 2837 |
| 189 | Ga0157371_10025437 | 3300013102 | Bacteria | 4314 |
| 190 | Ga0157371_10159264 | 3300013102 | Unclassified | 1612 |
| 191 | Ga0157370_10045203 | 3300013104 | Bacteria | 4226 |
| 192 | Ga0157369_10010720 | 3300013105 | Bacteria | 10431 |
| 193 | Ga0157369_10040512 | 3300013105 | Bacteria | 5084 |
| 194 | Ga0157374_10001430 | 3300013296 | Bacteria | 20184 |
| 195 | Ga0157374_10003385 | 3300013296 | Bacteria | 13400 |
| 196 | Ga0157374_10060427 | 3300013296 | Bacteria | 3547 |
| 197 | Ga0157374_10067755 | 3300013296 | Bacteria | 3356 |
| 198 | Ga0157378_10001642 | 3300013297 | Bacteria | 20217 |
| 199 | Ga0157378_10003467 | 3300013297 | Bacteria | 13995 |
| 200 | Ga0157378_10049818 | 3300013297 | Bacteria | 3727 |
| 201 | Ga0157378_10173487 | 3300013297 | Unclassified | 2024 |
| 202 | Ga0157378_10210191 | 3300013297 | Bacteria | 1845 |
| 203 | Ga0163162_10005925 | 3300013306 | Bacteria | 11827 |
| 204 | Ga0163162_10009993 | 3300013306 | Bacteria | 9229 |
| 205 | Ga0157372_10001165 | 3300013307 | Bacteria | 28486 |
| 206 | Ga0157372_10001690 | 3300013307 | Bacteria | 23867 |
| 207 | Ga0157372_10013051 | 3300013307 | Bacteria | 8862 |
| 208 | Ga0157372_10017142 | 3300013307 | Bacteria | 7777 |
| 209 | Ga0157372_10046371 | 3300013307 | Bacteria | 4825 |
| 210 | Ga0157372_10120941 | 3300013307 | Bacteria | 3007 |
| 211 | Ga0157375_10004422 | 3300013308 | Bacteria | 12205 |
| 212 | Ga0157375_10009833 | 3300013308 | Bacteria | 8411 |
| 213 | Ga0157375_10030909 | 3300013308 | Bacteria | 5055 |
| 214 | Ga0163163_10009560 | 3300014325 | Bacteria | 8663 |
| 215 | Ga0163163_10068185 | 3300014325 | Bacteria | 3539 |
| 216 | Ga0163163_10099762 | 3300014325 | Bacteria | 2925 |
| 217 | Ga0163163_10226484 | 3300014325 | Bacteria | 1919 |
| 218 | Ga0182008_10030138 | 3300014497 | Bacteria | 2736 |
| 219 | Ga0157377_10141847 | 3300014745 | Unclassified | 1477 |
| 220 | Ga0157377_10165124 | 3300014745 | Bacteria | 1380 |
| 221 | Ga0157379_10028482 | 3300014968 | Bacteria | 4967 |
| 222 | Ga0157379_10038331 | 3300014968 | Bacteria | 4277 |
| 223 | Ga0157376_10056574 | 3300014969 | Unclassified | 3277 |
| 224 | Ga0157376_10163196 | 3300014969 | Bacteria | 2022 |
| 225 | Ga0182005_1020947 | 3300015265 | Bacteria | 1796 |
| 226 | Ga0224712_10012165 | 3300022467 | Bacteria | 2698 |
| 227 | Ga0224572_1000138 | 3300024225 | Bacteria | 6173 |
| 228 | Ga0224572_1001045 | 3300024225 | Bacteria | 3855 |
| 229 | Ga0228598_1000939 | 3300024227 | Bacteria | 6336 |
| 230 | Ga0228598_1003185 | 3300024227 | Bacteria | 3540 |
| 231 | Ga0207692_10005821 | 3300025898 | Bacteria | 4967 |
| 232 | Ga0207692_10052885 | 3300025898 | Bacteria | 2066 |
| 233 | Ga0207642_10012720 | 3300025899 | Bacteria | 3048 |
| 234 | Ga0207710_10025552 | 3300025900 | Bacteria | 2548 |
| 235 | Ga0207680_10046705 | 3300025903 | Bacteria | 2561 |
| 236 | Ga0207680_10105337 | 3300025903 | Bacteria | 1819 |
| 237 | Ga0207647_10029697 | 3300025904 | Bacteria | 3533 |
| 238 | Ga0207685_10005255 | 3300025905 | Bacteria | 3397 |
| 239 | Ga0207685_10009212 | 3300025905 | Unclassified | 2857 |
| 240 | Ga0207699_10002027 | 3300025906 | Bacteria | 9562 |
| 241 | Ga0207699_10021313 | 3300025906 | Bacteria | 3491 |
| 242 | Ga0207645_10005103 | 3300025907 | Bacteria | 9606 |
| 243 | Ga0207684_10000822 | 3300025910 | Bacteria | 35780 |
| 244 | Ga0207684_10000963 | 3300025910 | Bacteria | 32275 |
| 245 | Ga0207684_10004018 | 3300025910 | Bacteria | 14061 |
| 246 | Ga0207684_10020898 | 3300025910 | Bacteria | 5590 |
| 247 | Ga0207684_10036445 | 3300025910 | Unclassified | 4175 |
| 248 | Ga0207654_10010181 | 3300025911 | Bacteria | 4786 |
| 249 | Ga0207654_10068783 | 3300025911 | Bacteria | 2096 |
| 250 | Ga0207707_10063314 | 3300025912 | Bacteria | 3219 |
| 251 | Ga0207707_10074727 | 3300025912 | Bacteria | 2956 |
| 252 | Ga0207707_10086818 | 3300025912 | Bacteria | 2734 |
| 253 | Ga0207707_10115189 | 3300025912 | Unclassified | 2349 |
| 254 | Ga0207695_10002608 | 3300025913 | Bacteria | 26414 |
| 255 | Ga0207695_10003769 | 3300025913 | Bacteria | 21043 |
| 256 | Ga0207695_10010837 | 3300025913 | Bacteria | 11105 |
| 257 | Ga0207695_10020113 | 3300025913 | Bacteria | 7657 |
| 258 | Ga0207695_10051270 | 3300025913 | Bacteria | 4334 |
| 259 | Ga0207671_10007596 | 3300025914 | Bacteria | 9380 |
| 260 | Ga0207693_10000039 | 3300025915 | Bacteria | 108357 |
| 261 | Ga0207693_10000192 | 3300025915 | Bacteria | 55694 |
| 262 | Ga0207693_10001863 | 3300025915 | Bacteria | 18462 |
| 263 | Ga0207693_10006146 | 3300025915 | Bacteria | 9958 |
| 264 | Ga0207693_10025874 | 3300025915 | Bacteria | 4647 |
| 265 | Ga0207693_10026963 | 3300025915 | Bacteria | 4544 |
| 266 | Ga0207693_10027949 | 3300025915 | Bacteria | 4459 |
| 267 | Ga0207663_10001621 | 3300025916 | Bacteria | 10592 |
| 268 | Ga0207663_10031778 | 3300025916 | Unclassified | 3127 |
| 269 | Ga0207663_10038300 | 3300025916 | Bacteria | 2897 |
| 270 | Ga0207663_10130216 | 3300025916 | Unclassified | 1737 |
| 271 | Ga0207657_10003489 | 3300025919 | Bacteria | 16783 |
| 272 | Ga0207657_10010815 | 3300025919 | Bacteria | 9080 |
| 273 | Ga0207649_10008052 | 3300025920 | Bacteria | 5739 |
| 274 | Ga0207646_10001522 | 3300025922 | Bacteria | 28372 |
| 275 | Ga0207646_10001567 | 3300025922 | Bacteria | 27996 |
| 276 | Ga0207646_10004750 | 3300025922 | Bacteria | 14624 |
| 277 | Ga0207646_10024387 | 3300025922 | Bacteria | 5540 |
| 278 | Ga0207646_10168915 | 3300025922 | Unclassified | 1975 |
| 279 | Ga0207687_10000811 | 3300025927 | Bacteria | 21109 |
| 280 | Ga0207687_10009038 | 3300025927 | Bacteria | 6513 |
| 281 | Ga0207700_10000369 | 3300025928 | Bacteria | 26303 |
| 282 | Ga0207700_10001504 | 3300025928 | Bacteria | 13194 |
| 283 | Ga0207700_10059769 | 3300025928 | Bacteria | 2884 |
| 284 | Ga0207700_10074165 | 3300025928 | Bacteria | 2631 |
| 285 | Ga0207700_10093749 | 3300025928 | Bacteria | 2377 |
| 286 | Ga0207700_10158055 | 3300025928 | Bacteria | 1880 |
| 287 | Ga0207664_10011529 | 3300025929 | Bacteria | 6290 |
| 288 | Ga0207664_10039003 | 3300025929 | Unclassified | 3685 |
| 289 | Ga0207664_10063710 | 3300025929 | Unclassified | 2947 |
| 290 | Ga0207664_10129876 | 3300025929 | Bacteria | 2120 |
| 291 | Ga0207664_10156843 | 3300025929 | Bacteria | 1938 |
| 292 | Ga0207706_10001256 | 3300025933 | Bacteria | 25535 |
| 293 | Ga0207706_10014226 | 3300025933 | Bacteria | 7213 |
| 294 | Ga0207706_10062190 | 3300025933 | Bacteria | 3288 |
| 295 | Ga0207670_10135136 | 3300025936 | Unclassified | 1812 |
| 296 | Ga0207704_10047230 | 3300025938 | Bacteria | 2572 |
| 297 | Ga0207665_10002564 | 3300025939 | Bacteria | 12203 |
| 298 | Ga0207665_10014700 | 3300025939 | Bacteria | 5151 |
| 299 | Ga0207665_10032138 | 3300025939 | Bacteria | 3475 |
| 300 | Ga0207665_10038732 | 3300025939 | Bacteria | 3176 |
| 301 | Ga0207665_10059952 | 3300025939 | Bacteria | 2576 |
| 302 | Ga0207665_10062477 | 3300025939 | Unclassified | 2527 |
| 303 | Ga0207711_10002950 | 3300025941 | Bacteria | 14880 |
| 304 | Ga0207689_10000896 | 3300025942 | Bacteria | 28598 |
| 305 | Ga0207689_10032520 | 3300025942 | Bacteria | 4339 |
| 306 | Ga0207661_10045758 | 3300025944 | Bacteria | 3466 |
| 307 | Ga0207661_10051612 | 3300025944 | Bacteria | 3282 |
| 308 | Ga0207679_10003079 | 3300025945 | Bacteria | 10326 |
| 309 | Ga0207679_10034029 | 3300025945 | Bacteria | 3592 |
| 310 | Ga0207667_10022917 | 3300025949 | Bacteria | 6884 |
| 311 | Ga0207667_10040902 | 3300025949 | Bacteria | 4933 |
| 312 | Ga0207640_10011298 | 3300025981 | Bacteria | 5051 |
| 313 | Ga0207703_10015265 | 3300026035 | Bacteria | 5993 |
| 314 | Ga0207703_10020817 | 3300026035 | Bacteria | 5132 |
| 315 | Ga0207639_10005523 | 3300026041 | Bacteria | 8545 |
| 316 | Ga0207639_10060189 | 3300026041 | Bacteria | 2929 |
| 317 | Ga0207678_10000212 | 3300026067 | Bacteria | 51660 |
| 318 | Ga0207702_10003393 | 3300026078 | Bacteria | 14587 |
| 319 | Ga0207702_10018802 | 3300026078 | Bacteria | 5715 |
| 320 | Ga0207702_10043416 | 3300026078 | Bacteria | 3774 |
| 321 | Ga0207648_10019033 | 3300026089 | Bacteria | 6200 |
| 322 | Ga0207648_10055618 | 3300026089 | Bacteria | 3454 |
| 323 | Ga0207648_10207769 | 3300026089 | Bacteria | 1737 |
| 324 | Ga0207676_10000846 | 3300026095 | Bacteria | 23761 |
| 325 | Ga0207676_10109433 | 3300026095 | Bacteria | 2309 |
| 326 | Ga0207676_10159210 | 3300026095 | Bacteria | 1954 |
| 327 | Ga0207674_10000309 | 3300026116 | Bacteria | 62067 |
| 328 | Ga0207674_10012321 | 3300026116 | Bacteria | 9560 |
| 329 | Ga0265356_1000383 | 3300028017 | Bacteria | 8040 |
| 330 | Ga0268266_10119757 | 3300028379 | Bacteria | 2341 |
| 331 | Ga0268265_10009566 | 3300028380 | Bacteria | 6546 |
| 332 | Ga0268264_10051193 | 3300028381 | Bacteria | 3440 |
| 333 | Ga0265338_10000762 | 3300028800 | Bacteria | 54962 |
| 334 | Ga0265338_10024840 | 3300028800 | Bacteria | 6106 |
| 335 | Ga0265338_10143739 | 3300028800 | Bacteria | 1864 |
| 336 | Ga0265762_1000094 | 3300030760 | Bacteria | 12442 |
| 337 | Ga0265762_1007247 | 3300030760 | Bacteria | 1976 |
| 338 | Ga0265760_10000018 | 3300031090 | Bacteria | 84268 |
| 339 | Ga0265760_10001339 | 3300031090 | Bacteria | 7234 |
| 340 | Ga0265760_10001579 | 3300031090 | Bacteria | 6715 |
| 341 | Ga0265760_10003107 | 3300031090 | Bacteria | 4847 |
| 342 | Ga0265760_10003726 | 3300031090 | Bacteria | 4411 |
| 343 | Ga0265325_10009171 | 3300031241 | Bacteria | 5794 |
| 344 | Ga0265331_10021446 | 3300031250 | Unclassified | 3306 |
| 345 | Ga0265313_10058050 | 3300031595 | Unclassified | 1825 |
| 346 | Ga0265314_10003261 | 3300031711 | Bacteria | 15873 |
| 347 | Ga0265314_10014107 | 3300031711 | Bacteria | 6415 |
| 348 | Ga0316212_1001764 | 3300033547 | Bacteria | 3001 |
| 349 | Ga0373930_0011580 | 3300034816 | Bacteria | 1594 |
| 350 | Ga0373923_0006656 | 3300035111 | Bacteria | 4012 |
| 351 | Ga0373936_0004393 | 3300035113 | Bacteria | 5332 |
| 352 | Ga0373945_0020379 | 3300035116 | Bacteria | 2269 |
| 353 | Ga0373945_0026925 | 3300035116 | Bacteria | 2005 |
| 354 | Ga0373955_0023640 | 3300035172 | Bacteria | 3133 |
| 355 | Ga0373955_0027750 | 3300035172 | Bacteria | 2930 |
| 356 | Ga0373961_0024088 | 3300035241 | Bacteria | 1644 |
| 357 | Ga0373924_0000709 | 3300035410 | Bacteria | 10383 |
| 358 | Ga0373935_0007810 | 3300035692 | Bacteria | 6412 |
| 359 | Ga0373935_0010965 | 3300035692 | Bacteria | 5443 |
| 360 | Ga0373935_0035148 | 3300035692 | Bacteria | 3127 |
| 361 | Ga0373935_0106937 | 3300035692 | Bacteria | 1852 |
| 362 | Ga0373927_0004374 | 3300035695 | Bacteria | 9907 |
| 363 | Ga0373927_0008866 | 3300035695 | Bacteria | 6757 |
| 364 | Ga0373927_0059389 | 3300035695 | Bacteria | 2473 |
| 365 | Ga0373947_0007216 | 3300035725 | Bacteria | 6440 |
| 366 | Ga0373947_0018273 | 3300035725 | Unclassified | 4035 |
| 367 | Ga0373947_0022248 | 3300035725 | Bacteria | 3674 |
| 368 | Ga0373947_0062122 | 3300035725 | Bacteria | 2272 |
| 369 | Ga0373937_0000008 | 3300036401 | Bacteria | 170075 |
| 370 | Ga0373937_0023185 | 3300036401 | Bacteria | 5588 |
| 371 | Ga0373937_0148568 | 3300036401 | Bacteria | 2195 |
| 372 | Ga0373925_0011692 | 3300037068 | Bacteria | 6348 |
| 373 | Ga0373925_0025436 | 3300037068 | Bacteria | 4324 |
| 374 | Ga0373925_0090637 | 3300037068 | Bacteria | 2337 |
| 375 | Ga0373925_0250216 | 3300037068 | Bacteria | 1421 |
| 376 | Ga0395898_0192325 | 3300037466 | Bacteria | 1949 |
| 377 | Ga0395905_0036375 | 3300037471 | Unclassified | 4624 |
| 378 | Ga0436364_0044933 | 3300037853 | Bacteria | 2813 |
| 379 | Ga0451577_0033471 | 3300042876 | Bacteria | 4633 |
| 380 | Ga0453683_0002415 | 3300044673 | Bacteria | 14529 |
| 381 | Ga0453683_0024969 | 3300044673 | Bacteria | 3798 |
| 382 | Ga0453684_0015294 | 3300044712 | Bacteria | 12163 |
| 383 | Ga0466959_0023486 | 3300045049 | Bacteria | 4562 |
| 384 | Ga0451576_0021228 | 3300045051 | Bacteria | 7059 |
| 385 | Ga0466967_0006006 | 3300045976 | Bacteria | 8532 |
| 386 | Ga0466967_0209327 | 3300045976 | Bacteria | 1849 |
| 387 | Ga0495592_0029559 | 3300046454 | Bacteria | 4149 |
| 388 | Ga0495629_0030155 | 3300046459 | Bacteria | 3846 |
| 389 | Ga0495651_0028192 | 3300046462 | Bacteria | 4376 |
| 390 | Ga0495653_0021378 | 3300046463 | Bacteria | 5242 |
| 391 | Ga0495580_0000007 | 3300046472 | Bacteria | 103420 |
| 392 | Ga0495580_0000206 | 3300046472 | Bacteria | 45509 |
| 393 | Ga0495580_0000535 | 3300046472 | Bacteria | 32125 |
| 394 | Ga0495580_0004993 | 3300046472 | Bacteria | 11071 |
| 395 | Ga0495580_0017777 | 3300046472 | Bacteria | 5305 |
| 396 | Ga0495580_0021303 | 3300046472 | Bacteria | 4783 |
| 397 | Ga0495580_0029144 | 3300046472 | Bacteria | 4007 |
| 398 | Ga0495582_0017875 | 3300046473 | Bacteria | 3876 |
| 399 | Ga0495639_0024505 | 3300046475 | Bacteria | 2657 |
| 400 | Ga0495608_0013709 | 3300046511 | Bacteria | 5622 |
| 401 | Ga0495628_0039110 | 3300046516 | Bacteria | 3795 |
| 402 | Ga0495630_0021078 | 3300046517 | Bacteria | 4811 |
| 403 | Ga0495652_0019697 | 3300046529 | Bacteria | 6005 |
| 404 | Ga0495652_0035212 | 3300046529 | Bacteria | 4358 |
| 405 | Ga0495665_0001023 | 3300046531 | Bacteria | 14811 |
| 406 | Ga0495665_0010345 | 3300046531 | Bacteria | 5049 |
| 407 | Ga0495665_0012754 | 3300046531 | Bacteria | 4547 |
| 408 | Ga0495665_0029289 | 3300046531 | Bacteria | 2950 |
| 409 | Ga0495586_0001965 | 3300046535 | Bacteria | 11209 |
| 410 | Ga0495586_0079370 | 3300046535 | Bacteria | 1802 |
| 411 | Ga0495587_0014837 | 3300046536 | Bacteria | 4875 |
| 412 | Ga0495645_0030623 | 3300046543 | Bacteria | 3920 |
| 413 | Ga0495645_0039616 | 3300046543 | Bacteria | 3437 |
| 414 | Ga0495667_0028556 | 3300046559 | Bacteria | 3757 |
| 415 | Ga0495635_0004715 | 3300046663 | Bacteria | 9473 |
| 416 | Ga0495599_0024514 | 3300046678 | Bacteria | 3772 |
| 417 | Ga0495623_0005529 | 3300046679 | Bacteria | 8255 |
| 418 | Ga0495646_0001190 | 3300046680 | Bacteria | 15244 |
| 419 | Ga0495658_0047580 | 3300046683 | Bacteria | 2416 |
| 420 | Ga0495669_0085902 | 3300046684 | Unclassified | 1448 |
| 421 | Ga0495613_0025444 | 3300046689 | Bacteria | 4410 |
| 422 | Ga0495624_0007726 | 3300046690 | Bacteria | 7544 |
| 423 | Ga0495604_0012002 | 3300047317 | Bacteria | 6887 |
| 424 | Ga0495604_0039647 | 3300047317 | Bacteria | 3701 |
| 425 | Ga0495674_0006637 | 3300047319 | Bacteria | 11087 |
| 426 | Ga0495674_0016413 | 3300047319 | Bacteria | 6905 |
| 427 | Ga0495676_0085765 | 3300047321 | Bacteria | 2372 |
| 428 | Ga0495675_0005453 | 3300047444 | Bacteria | 7756 |
| 429 | Ga0495675_0010070 | 3300047444 | Bacteria | 5898 |
| 430 | Ga0495684_0007233 | 3300047471 | Bacteria | 8616 |
| 431 | Ga0495593_0000778 | 3300047673 | Bacteria | 18540 |
| 432 | Ga0495602_0000026 | 3300048088 | Bacteria | 148063 |
| 433 | Ga0495602_0017192 | 3300048088 | Bacteria | 7252 |
| 434 | Ga0495602_0057983 | 3300048088 | Bacteria | 3393 |
| 435 | Ga0495602_0098580 | 3300048088 | Unclassified | 2404 |
| 436 | Ga0496100_0141883 | 3300048903 | Bacteria | 1704 |
| 437 | Ga0496101_0021459 | 3300048904 | Bacteria | 4438 |
| 438 | Ga0496102_0000703 | 3300048905 | Bacteria | 33239 |
| 439 | Ga0496102_0014974 | 3300048905 | Bacteria | 6749 |
| 440 | Ga0496102_0061450 | 3300048905 | Bacteria | 3438 |
| 441 | Ga0496102_0372076 | 3300048905 | Unclassified | 1345 |
| 442 | Ga0496103_0001601 | 3300048906 | Bacteria | 14874 |
| 443 | Ga0496103_0049921 | 3300048906 | Bacteria | 2587 |
| 444 | Ga0496104_0049630 | 3300048907 | Bacteria | 3957 |
| 445 | Ga0496106_0034364 | 3300048909 | Bacteria | 3786 |
| 446 | Ga0496106_0047853 | 3300048909 | Bacteria | 3219 |
| 447 | Ga0496107_0016391 | 3300048910 | Bacteria | 5202 |
| 448 | Ga0496109_0018004 | 3300048912 | Bacteria | 6202 |
| 449 | Ga0496110_0040099 | 3300048913 | Bacteria | 4081 |
| 450 | Ga0496110_0084511 | 3300048913 | Bacteria | 2833 |
| 451 | Ga0496112_0004387 | 3300048915 | Bacteria | 11940 |
| 452 | Ga0496112_0093634 | 3300048915 | Bacteria | 2975 |
| 453 | Ga0496112_0182183 | 3300048915 | Bacteria | 2064 |
| 454 | Ga0496112_0275651 | 3300048915 | Bacteria | 1630 |
| 455 | Ga0496113_0001778 | 3300048916 | Bacteria | 12231 |
| 456 | Ga0496115_0005828 | 3300048918 | Bacteria | 8976 |
| 457 | Ga0496115_0006416 | 3300048918 | Bacteria | 8617 |
| 458 | Ga0496115_0163251 | 3300048918 | Bacteria | 1842 |
| 459 | nmdc:mga05p37_148710_c1 | 3300050507 | Bacteria | 2867 |
| 460 | nmdc:mga05p37_2479_c1 | 3300050507 | Bacteria | 21476 |
| 461 | nmdc:mga05p37_252247_c1 | 3300050507 | Bacteria | 2116 |
| 462 | nmdc:mga09592_44394_c1 | 3300050508 | Bacteria | 3741 |
| 463 | nmdc:mga06r32_146546_c1 | 3300050510 | Bacteria | 2338 |
| 464 | nmdc:mga0n895_128980_c1 | 3300050512 | Bacteria | 2553 |
| 465 | nmdc:mga0n895_20509_c1 | 3300050512 | Bacteria | 6166 |
| 466 | nmdc:mga0n895_233512_c1 | 3300050512 | Bacteria | 1867 |
| 467 | nmdc:mga0n895_243581_c1 | 3300050512 | Bacteria | 1825 |
| 468 | nmdc:mga0n895_25637_c1 | 3300050512 | Bacteria | 5574 |
| 469 | nmdc:mga0n895_29037_c1 | 3300050512 | Bacteria | 5269 |
| 470 | nmdc:mga0n895_291972_c1 | 3300050512 | Bacteria | 1653 |
| 471 | nmdc:mga0n895_37023_c1 | 3300050512 | Unclassified | 4716 |
| 472 | nmdc:mga0n895_863_c1 | 3300050512 | Bacteria | 21786 |
| 473 | nmdc:mga0rr50_14136_c1 | 3300050513 | Bacteria | 5225 |
| 474 | nmdc:mga0rr50_1891_c1 | 3300050513 | Bacteria | 11621 |
| 475 | nmdc:mga0rr50_9943_c1 | 3300050513 | Bacteria | 6013 |
| 476 | nmdc:mga08x19_10113_c1 | 3300050514 | Bacteria | 5659 |
| 477 | nmdc:mga08x19_18022_c1 | 3300050514 | Bacteria | 4326 |
| 478 | nmdc:mga08x19_7118_c1 | 3300050514 | Bacteria | 6642 |
| 479 | nmdc:mga08x19_78604_c1 | 3300050514 | Bacteria | 2162 |
| 480 | nmdc:mga0a205_16792_c1 | 3300050515 | Bacteria | 6855 |
| 481 | nmdc:mga0a205_449_c1 | 3300050515 | Bacteria | 31835 |
| 482 | Ga0495601_0002421 | 3300053077 | Bacteria | 10595 |
| 483 | Ga0495612_0001592 | 3300053078 | Bacteria | 9362 |
| 484 | Ga0495619_0033329 | 3300053085 | Bacteria | 3345 |
| 485 | Ga0587083_0003539 | 3300059505 | Bacteria | 2083 |
| 486 | Ga0587079_003606 | 3300059647 | Bacteria | 2030 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014745 | Ga0157377_10165124 | Ga0157377_101651242 | 375 |
| 2 | 3300034816 | Ga0373930_0011580 | Ga0373930_0011580_449_1579 | 376 |
| 3 | 3300035172 | Ga0373955_0027750 | Ga0373955_0027750_12_1142 | 376 |
| 4 | 3300035241 | Ga0373961_0024088 | Ga0373961_0024088_491_1621 | 376 |
| 5 | 3300046683 | Ga0495658_0047580 | Ga0495658_0047580_1275_2405 | 376 |
| 6 | 3300046684 | Ga0495669_0085902 | Ga0495669_0085902_95_1234 | 376 |
| 7 | 3300050512 | nmdc:mga0n895_233512_c1 | nmdc:mga0n895_233512_c1_690_1853 | 376 |
| 8 | 3300037466 | Ga0395898_0192325 | Ga0395898_0192325_13_1266 | 399 |
| 9 | 3300037068 | Ga0373925_0250216 | Ga0373925_0250216_38_1276 | 412 |
| 10 | 3300048903 | Ga0496100_0141883 | Ga0496100_0141883_11_1249 | 412 |
| 11 | 3300048905 | Ga0496102_0372076 | Ga0496102_0372076_14_1255 | 413 |
| 12 | 3300048909 | Ga0496106_0047853 | Ga0496106_0047853_63_1304 | 413 |
| 13 | 3300048915 | Ga0496112_0275651 | Ga0496112_0275651_19_1263 | 413 |
| 14 | 3300013102 | Ga0157371_10159264 | Ga0157371_101592642 | 442 |
| 15 | 3300005445 | Ga0070708_100042929 | Ga0070708_1000429292 | 444 |
| 16 | 3300035172 | Ga0373955_0023640 | Ga0373955_0023640_1184_2569 | 447 |
| 17 | 3300036401 | Ga0373937_0000008 | Ga0373937_0000008_45567_46952 | 447 |
| 18 | 3300046529 | Ga0495652_0019697 | Ga0495652_0019697_4250_5635 | 447 |
| 19 | 3300047317 | Ga0495604_0039647 | Ga0495604_0039647_107_1492 | 447 |
| 20 | 3300047444 | Ga0495675_0005453 | Ga0495675_0005453_3164_4549 | 447 |
| 21 | 3300048088 | Ga0495602_0000026 | Ga0495602_0000026_23537_24922 | 447 |
| 22 | 3300059505 | Ga0587083_0003539 | Ga0587083_0003539_152_1549 | 447 |
| 23 | 3300059647 | Ga0587079_003606 | Ga0587079_003606_581_1978 | 447 |
| 24 | 3300048088 | Ga0495602_0098580 | Ga0495602_0098580_970_2352 | 448 |
| 25 | 3300005336 | Ga0070680_100135917 | Ga0070680_1001359172 | 449 |
| 26 | 3300022467 | Ga0224712_10012165 | Ga0224712_100121652 | 449 |
| 27 | 3300025899 | Ga0207642_10012720 | Ga0207642_100127202 | 452 |
| 28 | 3300046531 | Ga0495665_0029289 | Ga0495665_0029289_1033_2451 | 452 |
| 29 | 3300005439 | Ga0070711_100146012 | Ga0070711_1001460121 | 454 |
| 30 | 3300006028 | Ga0070717_10018181 | Ga0070717_100181814 | 454 |
| 31 | 3300024227 | Ga0228598_1000939 | Ga0228598_10009394 | 454 |
| 32 | 3300031250 | Ga0265331_10021446 | Ga0265331_100214462 | 454 |
| 33 | 3300031595 | Ga0265313_10058050 | Ga0265313_100580502 | 454 |
| 34 | 3300046472 | Ga0495580_0021303 | Ga0495580_0021303_2959_4344 | 454 |
| 35 | 3300010375 | Ga0105239_10072098 | Ga0105239_100720984 | 455 |
| 36 | 3300036401 | Ga0373937_0023185 | Ga0373937_0023185_4117_5505 | 456 |
| 37 | 3300009147 | Ga0114129_10338061 | Ga0114129_103380611 | 457 |
| 38 | 3300037853 | Ga0436364_0044933 | Ga0436364_0044933_435_1808 | 457 |
| 39 | 3300009147 | Ga0114129_10068915 | Ga0114129_100689152 | 458 |
| 40 | 3300050507 | nmdc:mga05p37_2479_c1 | nmdc:mga05p37_2479_c1_13318_14694 | 458 |
| 41 | 3300050512 | nmdc:mga0n895_25637_c1 | nmdc:mga0n895_25637_c1_3841_5217 | 458 |
| 42 | 3300005434 | Ga0070709_10030086 | Ga0070709_100300862 | 459 |
| 43 | 3300005436 | Ga0070713_100116042 | Ga0070713_1001160422 | 459 |
| 44 | 3300006358 | Ga0068871_100094219 | Ga0068871_1000942191 | 459 |
| 45 | 3300009093 | Ga0105240_10017819 | Ga0105240_100178196 | 459 |
| 46 | 3300013307 | Ga0157372_10001690 | Ga0157372_1000169011 | 459 |
| 47 | 3300013308 | Ga0157375_10030909 | Ga0157375_100309092 | 459 |
| 48 | 3300025913 | Ga0207695_10010837 | Ga0207695_100108373 | 459 |
| 49 | 3300025928 | Ga0207700_10074165 | Ga0207700_100741652 | 459 |
| 50 | 3300005364 | Ga0070673_100143536 | Ga0070673_1001435362 | 460 |
| 51 | 3300005434 | Ga0070709_10048935 | Ga0070709_100489352 | 460 |
| 52 | 3300005435 | Ga0070714_100015274 | Ga0070714_1000152743 | 460 |
| 53 | 3300005436 | Ga0070713_100004772 | Ga0070713_1000047725 | 460 |
| 54 | 3300005439 | Ga0070711_100004715 | Ga0070711_1000047155 | 460 |
| 55 | 3300005459 | Ga0068867_100209643 | Ga0068867_1002096431 | 460 |
| 56 | 3300005530 | Ga0070679_100135703 | Ga0070679_1001357032 | 460 |
| 57 | 3300006028 | Ga0070717_10003200 | Ga0070717_100032002 | 460 |
| 58 | 3300006163 | Ga0070715_10005968 | Ga0070715_100059684 | 460 |
| 59 | 3300006175 | Ga0070712_100001018 | Ga0070712_1000010186 | 460 |
| 60 | 3300006175 | Ga0070712_100033499 | Ga0070712_1000334993 | 460 |
| 61 | 3300006237 | Ga0097621_100001702 | Ga0097621_1000017029 | 460 |
| 62 | 3300006358 | Ga0068871_100000567 | Ga0068871_10000056717 | 460 |
| 63 | 3300009098 | Ga0105245_10007693 | Ga0105245_100076936 | 460 |
| 64 | 3300009177 | Ga0105248_10125604 | Ga0105248_101256042 | 460 |
| 65 | 3300009177 | Ga0105248_10382075 | Ga0105248_103820752 | 460 |
| 66 | 3300010375 | Ga0105239_10205064 | Ga0105239_102050642 | 460 |
| 67 | 3300013296 | Ga0157374_10067755 | Ga0157374_100677552 | 460 |
| 68 | 3300013297 | Ga0157378_10003467 | Ga0157378_1000346710 | 460 |
| 69 | 3300014325 | Ga0163163_10009560 | Ga0163163_100095608 | 460 |
| 70 | 3300014969 | Ga0157376_10163196 | Ga0157376_101631962 | 460 |
| 71 | 3300025898 | Ga0207692_10052885 | Ga0207692_100528852 | 460 |
| 72 | 3300025905 | Ga0207685_10005255 | Ga0207685_100052551 | 460 |
| 73 | 3300025906 | Ga0207699_10021313 | Ga0207699_100213133 | 460 |
| 74 | 3300025912 | Ga0207707_10115189 | Ga0207707_101151892 | 460 |
| 75 | 3300025913 | Ga0207695_10002608 | Ga0207695_1000260818 | 460 |
| 76 | 3300025915 | Ga0207693_10001863 | Ga0207693_100018636 | 460 |
| 77 | 3300025915 | Ga0207693_10026963 | Ga0207693_100269635 | 460 |
| 78 | 3300025916 | Ga0207663_10001621 | Ga0207663_100016212 | 460 |
| 79 | 3300025927 | Ga0207687_10009038 | Ga0207687_100090383 | 460 |
| 80 | 3300025928 | Ga0207700_10001504 | Ga0207700_100015047 | 460 |
| 81 | 3300025928 | Ga0207700_10093749 | Ga0207700_100937492 | 460 |
| 82 | 3300025929 | Ga0207664_10011529 | Ga0207664_100115293 | 460 |
| 83 | 3300025929 | Ga0207664_10039003 | Ga0207664_100390034 | 460 |
| 84 | 3300026035 | Ga0207703_10020817 | Ga0207703_100208172 | 460 |
| 85 | 3300026089 | Ga0207648_10207769 | Ga0207648_102077692 | 460 |
| 86 | 3300026095 | Ga0207676_10109433 | Ga0207676_101094332 | 460 |
| 87 | 3300035113 | Ga0373936_0004393 | Ga0373936_0004393_1922_3307 | 460 |
| 88 | 3300035116 | Ga0373945_0020379 | Ga0373945_0020379_592_1977 | 460 |
| 89 | 3300035725 | Ga0373947_0062122 | Ga0373947_0062122_852_2237 | 460 |
| 90 | 3300037068 | Ga0373925_0090637 | Ga0373925_0090637_72_1457 | 460 |
| 91 | 3300046459 | Ga0495629_0030155 | Ga0495629_0030155_2343_3728 | 460 |
| 92 | 3300046472 | Ga0495580_0000007 | Ga0495580_0000007_31069_32454 | 460 |
| 93 | 3300046472 | Ga0495580_0000535 | Ga0495580_0000535_24679_26064 | 460 |
| 94 | 3300046543 | Ga0495645_0030623 | Ga0495645_0030623_1525_2910 | 460 |
| 95 | 3300047319 | Ga0495674_0006637 | Ga0495674_0006637_2068_3453 | 460 |
| 96 | 3300048912 | Ga0496109_0018004 | Ga0496109_0018004_2094_3476 | 460 |
| 97 | 3300048915 | Ga0496112_0093634 | Ga0496112_0093634_787_2169 | 460 |
| 98 | 3300048918 | Ga0496115_0005828 | Ga0496115_0005828_7440_8825 | 460 |
| 99 | 3300048918 | Ga0496115_0006416 | Ga0496115_0006416_6281_7663 | 460 |
| 100 | 3300005328 | Ga0070676_10030449 | Ga0070676_100304492 | 461 |
| 101 | 3300005329 | Ga0070683_100022347 | Ga0070683_1000223473 | 461 |
| 102 | 3300005337 | Ga0070682_100010418 | Ga0070682_1000104183 | 461 |
| 103 | 3300005338 | Ga0068868_100017780 | Ga0068868_1000177804 | 461 |
| 104 | 3300005338 | Ga0068868_100067190 | Ga0068868_1000671901 | 461 |
| 105 | 3300005338 | Ga0068868_100117203 | Ga0068868_1001172032 | 461 |
| 106 | 3300005339 | Ga0070660_100013666 | Ga0070660_1000136663 | 461 |
| 107 | 3300005341 | Ga0070691_10007626 | Ga0070691_100076262 | 461 |
| 108 | 3300005344 | Ga0070661_100014503 | Ga0070661_1000145031 | 461 |
| 109 | 3300005344 | Ga0070661_100022940 | Ga0070661_1000229403 | 461 |
| 110 | 3300005347 | Ga0070668_100006585 | Ga0070668_1000065852 | 461 |
| 111 | 3300005355 | Ga0070671_100051387 | Ga0070671_1000513872 | 461 |
| 112 | 3300005366 | Ga0070659_100010936 | Ga0070659_1000109365 | 461 |
| 113 | 3300005367 | Ga0070667_100076622 | Ga0070667_1000766222 | 461 |
| 114 | 3300005434 | Ga0070709_10001689 | Ga0070709_100016899 | 461 |
| 115 | 3300005434 | Ga0070709_10027888 | Ga0070709_100278882 | 461 |
| 116 | 3300005435 | Ga0070714_100016929 | Ga0070714_1000169292 | 461 |
| 117 | 3300005435 | Ga0070714_100196450 | Ga0070714_1001964502 | 461 |
| 118 | 3300005436 | Ga0070713_100004271 | Ga0070713_1000042716 | 461 |
| 119 | 3300005436 | Ga0070713_100006605 | Ga0070713_1000066055 | 461 |
| 120 | 3300005436 | Ga0070713_100012711 | Ga0070713_1000127116 | 461 |
| 121 | 3300005436 | Ga0070713_100047542 | Ga0070713_1000475423 | 461 |
| 122 | 3300005437 | Ga0070710_10012216 | Ga0070710_100122161 | 461 |
| 123 | 3300005437 | Ga0070710_10019531 | Ga0070710_100195312 | 461 |
| 124 | 3300005437 | Ga0070710_10089339 | Ga0070710_100893391 | 461 |
| 125 | 3300005439 | Ga0070711_100009118 | Ga0070711_1000091183 | 461 |
| 126 | 3300005439 | Ga0070711_100041731 | Ga0070711_1000417312 | 461 |
| 127 | 3300005440 | Ga0070705_100092219 | Ga0070705_1000922192 | 461 |
| 128 | 3300005445 | Ga0070708_100000925 | Ga0070708_1000009258 | 461 |
| 129 | 3300005445 | Ga0070708_100001334 | Ga0070708_10000133412 | 461 |
| 130 | 3300005445 | Ga0070708_100001870 | Ga0070708_1000018708 | 461 |
| 131 | 3300005445 | Ga0070708_100010380 | Ga0070708_1000103805 | 461 |
| 132 | 3300005445 | Ga0070708_100078243 | Ga0070708_1000782432 | 461 |
| 133 | 3300005445 | Ga0070708_100195911 | Ga0070708_1001959112 | 461 |
| 134 | 3300005457 | Ga0070662_100002615 | Ga0070662_1000026157 | 461 |
| 135 | 3300005457 | Ga0070662_100022380 | Ga0070662_1000223802 | 461 |
| 136 | 3300005457 | Ga0070662_100033081 | Ga0070662_1000330812 | 461 |
| 137 | 3300005458 | Ga0070681_10004555 | Ga0070681_100045559 | 461 |
| 138 | 3300005458 | Ga0070681_10028520 | Ga0070681_100285204 | 461 |
| 139 | 3300005458 | Ga0070681_10124869 | Ga0070681_101248692 | 461 |
| 140 | 3300005459 | Ga0068867_100014007 | Ga0068867_1000140072 | 461 |
| 141 | 3300005459 | Ga0068867_100116800 | Ga0068867_1001168002 | 461 |
| 142 | 3300005467 | Ga0070706_100000447 | Ga0070706_10000044728 | 461 |
| 143 | 3300005467 | Ga0070706_100003164 | Ga0070706_10000316410 | 461 |
| 144 | 3300005467 | Ga0070706_100010583 | Ga0070706_1000105833 | 461 |
| 145 | 3300005467 | Ga0070706_100062223 | Ga0070706_1000622233 | 461 |
| 146 | 3300005468 | Ga0070707_100000799 | Ga0070707_10000079927 | 461 |
| 147 | 3300005468 | Ga0070707_100002488 | Ga0070707_10000248811 | 461 |
| 148 | 3300005468 | Ga0070707_100010468 | Ga0070707_1000104685 | 461 |
| 149 | 3300005468 | Ga0070707_100011860 | Ga0070707_1000118605 | 461 |
| 150 | 3300005468 | Ga0070707_100022000 | Ga0070707_1000220005 | 461 |
| 151 | 3300005468 | Ga0070707_100139135 | Ga0070707_1001391352 | 461 |
| 152 | 3300005468 | Ga0070707_100172211 | Ga0070707_1001722112 | 461 |
| 153 | 3300005471 | Ga0070698_100001031 | Ga0070698_10000103120 | 461 |
| 154 | 3300005471 | Ga0070698_100001802 | Ga0070698_10000180217 | 461 |
| 155 | 3300005471 | Ga0070698_100054516 | Ga0070698_1000545167 | 461 |
| 156 | 3300005471 | Ga0070698_100138723 | Ga0070698_1001387232 | 461 |
| 157 | 3300005518 | Ga0070699_100000360 | Ga0070699_10000036020 | 461 |
| 158 | 3300005518 | Ga0070699_100006341 | Ga0070699_1000063416 | 461 |
| 159 | 3300005518 | Ga0070699_100006743 | Ga0070699_10000674310 | 461 |
| 160 | 3300005518 | Ga0070699_100010395 | Ga0070699_1000103955 | 461 |
| 161 | 3300005518 | Ga0070699_100098327 | Ga0070699_1000983272 | 461 |
| 162 | 3300005518 | Ga0070699_100103603 | Ga0070699_1001036032 | 461 |
| 163 | 3300005530 | Ga0070679_100045891 | Ga0070679_1000458913 | 461 |
| 164 | 3300005535 | Ga0070684_100022509 | Ga0070684_1000225094 | 461 |
| 165 | 3300005536 | Ga0070697_100000045 | Ga0070697_10000004573 | 461 |
| 166 | 3300005536 | Ga0070697_100000435 | Ga0070697_1000004356 | 461 |
| 167 | 3300005536 | Ga0070697_100005216 | Ga0070697_1000052165 | 461 |
| 168 | 3300005536 | Ga0070697_100009779 | Ga0070697_1000097795 | 461 |
| 169 | 3300005536 | Ga0070697_100029813 | Ga0070697_1000298133 | 461 |
| 170 | 3300005536 | Ga0070697_100054756 | Ga0070697_1000547562 | 461 |
| 171 | 3300005536 | Ga0070697_100153296 | Ga0070697_1001532961 | 461 |
| 172 | 3300005539 | Ga0068853_100044615 | Ga0068853_1000446152 | 461 |
| 173 | 3300005545 | Ga0070695_100028429 | Ga0070695_1000284292 | 461 |
| 174 | 3300005548 | Ga0070665_100069131 | Ga0070665_1000691312 | 461 |
| 175 | 3300005563 | Ga0068855_100003041 | Ga0068855_10000304114 | 461 |
| 176 | 3300005563 | Ga0068855_100121173 | Ga0068855_1001211732 | 461 |
| 177 | 3300005564 | Ga0070664_100002870 | Ga0070664_1000028708 | 461 |
| 178 | 3300005564 | Ga0070664_100048767 | Ga0070664_1000487672 | 461 |
| 179 | 3300005564 | Ga0070664_100104328 | Ga0070664_1001043282 | 461 |
| 180 | 3300005577 | Ga0068857_100000041 | Ga0068857_10000004157 | 461 |
| 181 | 3300005578 | Ga0068854_100004461 | Ga0068854_1000044615 | 461 |
| 182 | 3300005578 | Ga0068854_100005101 | Ga0068854_1000051016 | 461 |
| 183 | 3300005614 | Ga0068856_100004609 | Ga0068856_1000046098 | 461 |
| 184 | 3300005614 | Ga0068856_100012784 | Ga0068856_1000127842 | 461 |
| 185 | 3300005614 | Ga0068856_100026125 | Ga0068856_1000261252 | 461 |
| 186 | 3300005614 | Ga0068856_100035395 | Ga0068856_1000353954 | 461 |
| 187 | 3300005614 | Ga0068856_100042355 | Ga0068856_1000423551 | 461 |
| 188 | 3300005614 | Ga0068856_100044851 | Ga0068856_1000448512 | 461 |
| 189 | 3300005617 | Ga0068859_100004671 | Ga0068859_1000046717 | 461 |
| 190 | 3300005617 | Ga0068859_100006322 | Ga0068859_1000063227 | 461 |
| 191 | 3300005618 | Ga0068864_100001347 | Ga0068864_10000134714 | 461 |
| 192 | 3300005618 | Ga0068864_100062876 | Ga0068864_1000628763 | 461 |
| 193 | 3300005618 | Ga0068864_100181613 | Ga0068864_1001816132 | 461 |
| 194 | 3300005719 | Ga0068861_100013076 | Ga0068861_1000130766 | 461 |
| 195 | 3300005834 | Ga0068851_10044844 | Ga0068851_100448442 | 461 |
| 196 | 3300005841 | Ga0068863_100130138 | Ga0068863_1001301382 | 461 |
| 197 | 3300005841 | Ga0068863_100339791 | Ga0068863_1003397911 | 461 |
| 198 | 3300005842 | Ga0068858_100033812 | Ga0068858_1000338122 | 461 |
| 199 | 3300005842 | Ga0068858_100071251 | Ga0068858_1000712512 | 461 |
| 200 | 3300005843 | Ga0068860_100014414 | Ga0068860_1000144146 | 461 |
| 201 | 3300005844 | Ga0068862_100051938 | Ga0068862_1000519382 | 461 |
| 202 | 3300006028 | Ga0070717_10009825 | Ga0070717_100098255 | 461 |
| 203 | 3300006028 | Ga0070717_10023963 | Ga0070717_100239633 | 461 |
| 204 | 3300006028 | Ga0070717_10037918 | Ga0070717_100379182 | 461 |
| 205 | 3300006028 | Ga0070717_10092662 | Ga0070717_100926622 | 461 |
| 206 | 3300006028 | Ga0070717_10181930 | Ga0070717_101819301 | 461 |
| 207 | 3300006173 | Ga0070716_100015742 | Ga0070716_1000157422 | 461 |
| 208 | 3300006173 | Ga0070716_100020395 | Ga0070716_1000203952 | 461 |
| 209 | 3300006173 | Ga0070716_100022067 | Ga0070716_1000220672 | 461 |
| 210 | 3300006173 | Ga0070716_100034250 | Ga0070716_1000342502 | 461 |
| 211 | 3300006173 | Ga0070716_100069874 | Ga0070716_1000698742 | 461 |
| 212 | 3300006173 | Ga0070716_100071329 | Ga0070716_1000713292 | 461 |
| 213 | 3300006175 | Ga0070712_100000370 | Ga0070712_10000037011 | 461 |
| 214 | 3300006175 | Ga0070712_100001309 | Ga0070712_10000130910 | 461 |
| 215 | 3300006175 | Ga0070712_100008154 | Ga0070712_1000081545 | 461 |
| 216 | 3300006175 | Ga0070712_100088630 | Ga0070712_1000886301 | 461 |
| 217 | 3300006237 | Ga0097621_100057064 | Ga0097621_1000570644 | 461 |
| 218 | 3300006237 | Ga0097621_100109668 | Ga0097621_1001096682 | 461 |
| 219 | 3300006237 | Ga0097621_100217018 | Ga0097621_1002170181 | 461 |
| 220 | 3300006358 | Ga0068871_100141585 | Ga0068871_1001415852 | 461 |
| 221 | 3300006358 | Ga0068871_100248038 | Ga0068871_1002480381 | 461 |
| 222 | 3300006847 | Ga0075431_100036619 | Ga0075431_1000366194 | 461 |
| 223 | 3300006852 | Ga0075433_10000750 | Ga0075433_1000075013 | 461 |
| 224 | 3300006852 | Ga0075433_10065459 | Ga0075433_100654592 | 461 |
| 225 | 3300006871 | Ga0075434_100000235 | Ga0075434_10000023536 | 461 |
| 226 | 3300006871 | Ga0075434_100019125 | Ga0075434_1000191256 | 461 |
| 227 | 3300006871 | Ga0075434_100032840 | Ga0075434_1000328403 | 461 |
| 228 | 3300006871 | Ga0075434_100041036 | Ga0075434_1000410362 | 461 |
| 229 | 3300006871 | Ga0075434_100141249 | Ga0075434_1001412492 | 461 |
| 230 | 3300006871 | Ga0075434_100266012 | Ga0075434_1002660122 | 461 |
| 231 | 3300006881 | Ga0068865_100006463 | Ga0068865_1000064634 | 461 |
| 232 | 3300006914 | Ga0075436_100001682 | Ga0075436_1000016829 | 461 |
| 233 | 3300006914 | Ga0075436_100008991 | Ga0075436_1000089915 | 461 |
| 234 | 3300006914 | Ga0075436_100014517 | Ga0075436_1000145172 | 461 |
| 235 | 3300006931 | Ga0097620_100004671 | Ga0097620_1000046715 | 461 |
| 236 | 3300006931 | Ga0097620_100006322 | Ga0097620_1000063227 | 461 |
| 237 | 3300007076 | Ga0075435_100000913 | Ga0075435_10000091314 | 461 |
| 238 | 3300007076 | Ga0075435_100034333 | Ga0075435_1000343333 | 461 |
| 239 | 3300007076 | Ga0075435_100199168 | Ga0075435_1001991681 | 461 |
| 240 | 3300007788 | Ga0099795_10028592 | Ga0099795_100285921 | 461 |
| 241 | 3300007788 | Ga0099795_10045537 | Ga0099795_100455372 | 461 |
| 242 | 3300009093 | Ga0105240_10022968 | Ga0105240_100229685 | 461 |
| 243 | 3300009093 | Ga0105240_10041408 | Ga0105240_100414083 | 461 |
| 244 | 3300009093 | Ga0105240_10135838 | Ga0105240_101358381 | 461 |
| 245 | 3300009098 | Ga0105245_10039381 | Ga0105245_100393812 | 461 |
| 246 | 3300009101 | Ga0105247_10019668 | Ga0105247_100196682 | 461 |
| 247 | 3300009174 | Ga0105241_10004435 | Ga0105241_100044359 | 461 |
| 248 | 3300009174 | Ga0105241_10011600 | Ga0105241_100116005 | 461 |
| 249 | 3300009174 | Ga0105241_10043833 | Ga0105241_100438332 | 461 |
| 250 | 3300009176 | Ga0105242_10064905 | Ga0105242_100649052 | 461 |
| 251 | 3300009177 | Ga0105248_10028476 | Ga0105248_100284762 | 461 |
| 252 | 3300009545 | Ga0105237_10092154 | Ga0105237_100921542 | 461 |
| 253 | 3300009551 | Ga0105238_10263676 | Ga0105238_102636761 | 461 |
| 254 | 3300009553 | Ga0105249_10008547 | Ga0105249_100085472 | 461 |
| 255 | 3300010375 | Ga0105239_10006179 | Ga0105239_100061792 | 461 |
| 256 | 3300010375 | Ga0105239_10053451 | Ga0105239_100534512 | 461 |
| 257 | 3300010375 | Ga0105239_10256535 | Ga0105239_102565352 | 461 |
| 258 | 3300013100 | Ga0157373_10001908 | Ga0157373_100019082 | 461 |
| 259 | 3300013100 | Ga0157373_10054660 | Ga0157373_100546602 | 461 |
| 260 | 3300013102 | Ga0157371_10025437 | Ga0157371_100254372 | 461 |
| 261 | 3300013104 | Ga0157370_10045203 | Ga0157370_100452032 | 461 |
| 262 | 3300013105 | Ga0157369_10010720 | Ga0157369_100107205 | 461 |
| 263 | 3300013105 | Ga0157369_10040512 | Ga0157369_100405123 | 461 |
| 264 | 3300013296 | Ga0157374_10001430 | Ga0157374_1000143013 | 461 |
| 265 | 3300013296 | Ga0157374_10003385 | Ga0157374_100033857 | 461 |
| 266 | 3300013296 | Ga0157374_10060427 | Ga0157374_100604272 | 461 |
| 267 | 3300013297 | Ga0157378_10001642 | Ga0157378_100016423 | 461 |
| 268 | 3300013297 | Ga0157378_10049818 | Ga0157378_100498183 | 461 |
| 269 | 3300013297 | Ga0157378_10173487 | Ga0157378_101734872 | 461 |
| 270 | 3300013297 | Ga0157378_10210191 | Ga0157378_102101912 | 461 |
| 271 | 3300013306 | Ga0163162_10005925 | Ga0163162_100059252 | 461 |
| 272 | 3300013306 | Ga0163162_10009993 | Ga0163162_100099933 | 461 |
| 273 | 3300013307 | Ga0157372_10001165 | Ga0157372_100011657 | 461 |
| 274 | 3300013307 | Ga0157372_10013051 | Ga0157372_100130514 | 461 |
| 275 | 3300013307 | Ga0157372_10017142 | Ga0157372_100171425 | 461 |
| 276 | 3300013307 | Ga0157372_10046371 | Ga0157372_100463714 | 461 |
| 277 | 3300013307 | Ga0157372_10120941 | Ga0157372_101209412 | 461 |
| 278 | 3300013308 | Ga0157375_10004422 | Ga0157375_100044224 | 461 |
| 279 | 3300013308 | Ga0157375_10009833 | Ga0157375_100098336 | 461 |
| 280 | 3300014325 | Ga0163163_10068185 | Ga0163163_100681852 | 461 |
| 281 | 3300014325 | Ga0163163_10099762 | Ga0163163_100997622 | 461 |
| 282 | 3300014325 | Ga0163163_10226484 | Ga0163163_102264842 | 461 |
| 283 | 3300014497 | Ga0182008_10030138 | Ga0182008_100301382 | 461 |
| 284 | 3300014745 | Ga0157377_10141847 | Ga0157377_101418471 | 461 |
| 285 | 3300014968 | Ga0157379_10028482 | Ga0157379_100284822 | 461 |
| 286 | 3300014968 | Ga0157379_10038331 | Ga0157379_100383312 | 461 |
| 287 | 3300014969 | Ga0157376_10056574 | Ga0157376_100565742 | 461 |
| 288 | 3300015265 | Ga0182005_1020947 | Ga0182005_10209472 | 461 |
| 289 | 3300024225 | Ga0224572_1000138 | Ga0224572_10001384 | 461 |
| 290 | 3300024225 | Ga0224572_1001045 | Ga0224572_10010453 | 461 |
| 291 | 3300024227 | Ga0228598_1003185 | Ga0228598_10031853 | 461 |
| 292 | 3300025898 | Ga0207692_10005821 | Ga0207692_100058212 | 461 |
| 293 | 3300025900 | Ga0207710_10025552 | Ga0207710_100255522 | 461 |
| 294 | 3300025903 | Ga0207680_10046705 | Ga0207680_100467052 | 461 |
| 295 | 3300025903 | Ga0207680_10105337 | Ga0207680_101053372 | 461 |
| 296 | 3300025904 | Ga0207647_10029697 | Ga0207647_100296972 | 461 |
| 297 | 3300025905 | Ga0207685_10009212 | Ga0207685_100092122 | 461 |
| 298 | 3300025906 | Ga0207699_10002027 | Ga0207699_100020276 | 461 |
| 299 | 3300025907 | Ga0207645_10005103 | Ga0207645_100051036 | 461 |
| 300 | 3300025910 | Ga0207684_10000822 | Ga0207684_1000082220 | 461 |
| 301 | 3300025910 | Ga0207684_10000963 | Ga0207684_1000096328 | 461 |
| 302 | 3300025910 | Ga0207684_10004018 | Ga0207684_100040183 | 461 |
| 303 | 3300025910 | Ga0207684_10020898 | Ga0207684_100208982 | 461 |
| 304 | 3300025910 | Ga0207684_10036445 | Ga0207684_100364454 | 461 |
| 305 | 3300025911 | Ga0207654_10010181 | Ga0207654_100101812 | 461 |
| 306 | 3300025911 | Ga0207654_10068783 | Ga0207654_100687832 | 461 |
| 307 | 3300025912 | Ga0207707_10063314 | Ga0207707_100633144 | 461 |
| 308 | 3300025912 | Ga0207707_10074727 | Ga0207707_100747272 | 461 |
| 309 | 3300025912 | Ga0207707_10086818 | Ga0207707_100868182 | 461 |
| 310 | 3300025913 | Ga0207695_10003769 | Ga0207695_100037698 | 461 |
| 311 | 3300025913 | Ga0207695_10020113 | Ga0207695_100201137 | 461 |
| 312 | 3300025913 | Ga0207695_10051270 | Ga0207695_100512704 | 461 |
| 313 | 3300025914 | Ga0207671_10007596 | Ga0207671_100075968 | 461 |
| 314 | 3300025915 | Ga0207693_10000039 | Ga0207693_1000003958 | 461 |
| 315 | 3300025915 | Ga0207693_10000192 | Ga0207693_1000019245 | 461 |
| 316 | 3300025915 | Ga0207693_10006146 | Ga0207693_100061462 | 461 |
| 317 | 3300025915 | Ga0207693_10025874 | Ga0207693_100258744 | 461 |
| 318 | 3300025915 | Ga0207693_10027949 | Ga0207693_100279492 | 461 |
| 319 | 3300025916 | Ga0207663_10031778 | Ga0207663_100317782 | 461 |
| 320 | 3300025916 | Ga0207663_10038300 | Ga0207663_100383001 | 461 |
| 321 | 3300025916 | Ga0207663_10130216 | Ga0207663_101302162 | 461 |
| 322 | 3300025919 | Ga0207657_10003489 | Ga0207657_1000348915 | 461 |
| 323 | 3300025919 | Ga0207657_10010815 | Ga0207657_100108157 | 461 |
| 324 | 3300025920 | Ga0207649_10008052 | Ga0207649_100080523 | 461 |
| 325 | 3300025922 | Ga0207646_10001522 | Ga0207646_1000152217 | 461 |
| 326 | 3300025922 | Ga0207646_10001567 | Ga0207646_100015672 | 461 |
| 327 | 3300025922 | Ga0207646_10004750 | Ga0207646_100047504 | 461 |
| 328 | 3300025922 | Ga0207646_10024387 | Ga0207646_100243873 | 461 |
| 329 | 3300025922 | Ga0207646_10168915 | Ga0207646_101689152 | 461 |
| 330 | 3300025927 | Ga0207687_10000811 | Ga0207687_1000081110 | 461 |
| 331 | 3300025928 | Ga0207700_10000369 | Ga0207700_100003699 | 461 |
| 332 | 3300025928 | Ga0207700_10059769 | Ga0207700_100597692 | 461 |
| 333 | 3300025928 | Ga0207700_10158055 | Ga0207700_101580552 | 461 |
| 334 | 3300025929 | Ga0207664_10063710 | Ga0207664_100637103 | 461 |
| 335 | 3300025929 | Ga0207664_10129876 | Ga0207664_101298762 | 461 |
| 336 | 3300025929 | Ga0207664_10156843 | Ga0207664_101568432 | 461 |
| 337 | 3300025933 | Ga0207706_10001256 | Ga0207706_100012568 | 461 |
| 338 | 3300025933 | Ga0207706_10014226 | Ga0207706_100142262 | 461 |
| 339 | 3300025933 | Ga0207706_10062190 | Ga0207706_100621902 | 461 |
| 340 | 3300025936 | Ga0207670_10135136 | Ga0207670_101351362 | 461 |
| 341 | 3300025938 | Ga0207704_10047230 | Ga0207704_100472302 | 461 |
| 342 | 3300025939 | Ga0207665_10002564 | Ga0207665_100025644 | 461 |
| 343 | 3300025939 | Ga0207665_10014700 | Ga0207665_100147002 | 461 |
| 344 | 3300025939 | Ga0207665_10032138 | Ga0207665_100321383 | 461 |
| 345 | 3300025939 | Ga0207665_10038732 | Ga0207665_100387322 | 461 |
| 346 | 3300025939 | Ga0207665_10059952 | Ga0207665_100599522 | 461 |
| 347 | 3300025939 | Ga0207665_10062477 | Ga0207665_100624772 | 461 |
| 348 | 3300025941 | Ga0207711_10002950 | Ga0207711_100029507 | 461 |
| 349 | 3300025942 | Ga0207689_10000896 | Ga0207689_100008963 | 461 |
| 350 | 3300025942 | Ga0207689_10032520 | Ga0207689_100325203 | 461 |
| 351 | 3300025944 | Ga0207661_10045758 | Ga0207661_100457582 | 461 |
| 352 | 3300025944 | Ga0207661_10051612 | Ga0207661_100516122 | 461 |
| 353 | 3300025945 | Ga0207679_10003079 | Ga0207679_100030793 | 461 |
| 354 | 3300025945 | Ga0207679_10034029 | Ga0207679_100340292 | 461 |
| 355 | 3300025949 | Ga0207667_10022917 | Ga0207667_100229177 | 461 |
| 356 | 3300025949 | Ga0207667_10040902 | Ga0207667_100409022 | 461 |
| 357 | 3300025981 | Ga0207640_10011298 | Ga0207640_100112982 | 461 |
| 358 | 3300026035 | Ga0207703_10015265 | Ga0207703_100152652 | 461 |
| 359 | 3300026041 | Ga0207639_10005523 | Ga0207639_100055238 | 461 |
| 360 | 3300026041 | Ga0207639_10060189 | Ga0207639_100601894 | 461 |
| 361 | 3300026067 | Ga0207678_10000212 | Ga0207678_1000021211 | 461 |
| 362 | 3300026078 | Ga0207702_10003393 | Ga0207702_1000339312 | 461 |
| 363 | 3300026078 | Ga0207702_10018802 | Ga0207702_100188024 | 461 |
| 364 | 3300026078 | Ga0207702_10043416 | Ga0207702_100434163 | 461 |
| 365 | 3300026089 | Ga0207648_10019033 | Ga0207648_100190333 | 461 |
| 366 | 3300026089 | Ga0207648_10055618 | Ga0207648_100556182 | 461 |
| 367 | 3300026095 | Ga0207676_10000846 | Ga0207676_1000084614 | 461 |
| 368 | 3300026095 | Ga0207676_10159210 | Ga0207676_101592102 | 461 |
| 369 | 3300026116 | Ga0207674_10000309 | Ga0207674_100003094 | 461 |
| 370 | 3300026116 | Ga0207674_10012321 | Ga0207674_100123216 | 461 |
| 371 | 3300028017 | Ga0265356_1000383 | Ga0265356_10003835 | 461 |
| 372 | 3300028379 | Ga0268266_10119757 | Ga0268266_101197572 | 461 |
| 373 | 3300028380 | Ga0268265_10009566 | Ga0268265_100095664 | 461 |
| 374 | 3300028381 | Ga0268264_10051193 | Ga0268264_100511934 | 461 |
| 375 | 3300028800 | Ga0265338_10000762 | Ga0265338_1000076218 | 461 |
| 376 | 3300028800 | Ga0265338_10024840 | Ga0265338_100248405 | 461 |
| 377 | 3300028800 | Ga0265338_10143739 | Ga0265338_101437391 | 461 |
| 378 | 3300030760 | Ga0265762_1000094 | Ga0265762_10000944 | 461 |
| 379 | 3300030760 | Ga0265762_1007247 | Ga0265762_10072472 | 461 |
| 380 | 3300031090 | Ga0265760_10000018 | Ga0265760_1000001816 | 461 |
| 381 | 3300031090 | Ga0265760_10001339 | Ga0265760_100013396 | 461 |
| 382 | 3300031090 | Ga0265760_10001579 | Ga0265760_100015794 | 461 |
| 383 | 3300031090 | Ga0265760_10003107 | Ga0265760_100031075 | 461 |
| 384 | 3300031090 | Ga0265760_10003726 | Ga0265760_100037263 | 461 |
| 385 | 3300031241 | Ga0265325_10009171 | Ga0265325_100091715 | 461 |
| 386 | 3300031711 | Ga0265314_10003261 | Ga0265314_100032612 | 461 |
| 387 | 3300031711 | Ga0265314_10014107 | Ga0265314_100141073 | 461 |
| 388 | 3300033547 | Ga0316212_1001764 | Ga0316212_10017642 | 461 |
| 389 | 3300035111 | Ga0373923_0006656 | Ga0373923_0006656_1704_3092 | 461 |
| 390 | 3300035116 | Ga0373945_0026925 | Ga0373945_0026925_452_1840 | 461 |
| 391 | 3300035410 | Ga0373924_0000709 | Ga0373924_0000709_3368_4756 | 461 |
| 392 | 3300035692 | Ga0373935_0007810 | Ga0373935_0007810_465_1853 | 461 |
| 393 | 3300035692 | Ga0373935_0010965 | Ga0373935_0010965_1976_3373 | 461 |
| 394 | 3300035692 | Ga0373935_0035148 | Ga0373935_0035148_1254_2642 | 461 |
| 395 | 3300035692 | Ga0373935_0106937 | Ga0373935_0106937_289_1677 | 461 |
| 396 | 3300035695 | Ga0373927_0004374 | Ga0373927_0004374_3261_4658 | 461 |
| 397 | 3300035695 | Ga0373927_0008866 | Ga0373927_0008866_2920_4305 | 461 |
| 398 | 3300035695 | Ga0373927_0059389 | Ga0373927_0059389_234_1619 | 461 |
| 399 | 3300035725 | Ga0373947_0007216 | Ga0373947_0007216_2973_4370 | 461 |
| 400 | 3300035725 | Ga0373947_0018273 | Ga0373947_0018273_1482_2867 | 461 |
| 401 | 3300035725 | Ga0373947_0022248 | Ga0373947_0022248_1778_3166 | 461 |
| 402 | 3300036401 | Ga0373937_0148568 | Ga0373937_0148568_629_2014 | 461 |
| 403 | 3300037068 | Ga0373925_0011692 | Ga0373925_0011692_1328_2713 | 461 |
| 404 | 3300037068 | Ga0373925_0025436 | Ga0373925_0025436_1710_3107 | 461 |
| 405 | 3300037471 | Ga0395905_0036375 | Ga0395905_0036375_1502_2887 | 461 |
| 406 | 3300042876 | Ga0451577_0033471 | Ga0451577_0033471_2265_3650 | 461 |
| 407 | 3300044673 | Ga0453683_0002415 | Ga0453683_0002415_3526_4911 | 461 |
| 408 | 3300044673 | Ga0453683_0024969 | Ga0453683_0024969_1129_2514 | 461 |
| 409 | 3300044712 | Ga0453684_0015294 | Ga0453684_0015294_6891_8276 | 461 |
| 410 | 3300045049 | Ga0466959_0023486 | Ga0466959_0023486_1801_3192 | 461 |
| 411 | 3300045051 | Ga0451576_0021228 | Ga0451576_0021228_2236_3621 | 461 |
| 412 | 3300045976 | Ga0466967_0006006 | Ga0466967_0006006_5717_7102 | 461 |
| 413 | 3300045976 | Ga0466967_0209327 | Ga0466967_0209327_145_1536 | 461 |
| 414 | 3300046454 | Ga0495592_0029559 | Ga0495592_0029559_1371_2768 | 461 |
| 415 | 3300046462 | Ga0495651_0028192 | Ga0495651_0028192_86_1471 | 461 |
| 416 | 3300046463 | Ga0495653_0021378 | Ga0495653_0021378_1751_3148 | 461 |
| 417 | 3300046472 | Ga0495580_0000206 | Ga0495580_0000206_21467_22852 | 461 |
| 418 | 3300046472 | Ga0495580_0004993 | Ga0495580_0004993_6105_7502 | 461 |
| 419 | 3300046472 | Ga0495580_0017777 | Ga0495580_0017777_3884_5269 | 461 |
| 420 | 3300046472 | Ga0495580_0029144 | Ga0495580_0029144_1379_2764 | 461 |
| 421 | 3300046473 | Ga0495582_0017875 | Ga0495582_0017875_954_2339 | 461 |
| 422 | 3300046475 | Ga0495639_0024505 | Ga0495639_0024505_645_2030 | 461 |
| 423 | 3300046511 | Ga0495608_0013709 | Ga0495608_0013709_977_2374 | 461 |
| 424 | 3300046516 | Ga0495628_0039110 | Ga0495628_0039110_2060_3448 | 461 |
| 425 | 3300046517 | Ga0495630_0021078 | Ga0495630_0021078_2268_3665 | 461 |
| 426 | 3300046529 | Ga0495652_0035212 | Ga0495652_0035212_1319_2716 | 461 |
| 427 | 3300046531 | Ga0495665_0001023 | Ga0495665_0001023_7283_8680 | 461 |
| 428 | 3300046531 | Ga0495665_0010345 | Ga0495665_0010345_302_1687 | 461 |
| 429 | 3300046531 | Ga0495665_0012754 | Ga0495665_0012754_718_2103 | 461 |
| 430 | 3300046535 | Ga0495586_0001965 | Ga0495586_0001965_4033_5430 | 461 |
| 431 | 3300046535 | Ga0495586_0079370 | Ga0495586_0079370_123_1508 | 461 |
| 432 | 3300046536 | Ga0495587_0014837 | Ga0495587_0014837_1376_2773 | 461 |
| 433 | 3300046543 | Ga0495645_0039616 | Ga0495645_0039616_582_1979 | 461 |
| 434 | 3300046559 | Ga0495667_0028556 | Ga0495667_0028556_1451_2848 | 461 |
| 435 | 3300046663 | Ga0495635_0004715 | Ga0495635_0004715_4698_6095 | 461 |
| 436 | 3300046678 | Ga0495599_0024514 | Ga0495599_0024514_543_1940 | 461 |
| 437 | 3300046679 | Ga0495623_0005529 | Ga0495623_0005529_2235_3632 | 461 |
| 438 | 3300046680 | Ga0495646_0001190 | Ga0495646_0001190_1723_3120 | 461 |
| 439 | 3300046689 | Ga0495613_0025444 | Ga0495613_0025444_2537_3922 | 461 |
| 440 | 3300046690 | Ga0495624_0007726 | Ga0495624_0007726_4603_6000 | 461 |
| 441 | 3300047317 | Ga0495604_0012002 | Ga0495604_0012002_5060_6457 | 461 |
| 442 | 3300047319 | Ga0495674_0016413 | Ga0495674_0016413_3489_4886 | 461 |
| 443 | 3300047321 | Ga0495676_0085765 | Ga0495676_0085765_352_1749 | 461 |
| 444 | 3300047444 | Ga0495675_0010070 | Ga0495675_0010070_2300_3697 | 461 |
| 445 | 3300047471 | Ga0495684_0007233 | Ga0495684_0007233_1483_2880 | 461 |
| 446 | 3300047673 | Ga0495593_0000778 | Ga0495593_0000778_4556_5953 | 461 |
| 447 | 3300048088 | Ga0495602_0017192 | Ga0495602_0017192_544_1941 | 461 |
| 448 | 3300048088 | Ga0495602_0057983 | Ga0495602_0057983_1712_3097 | 461 |
| 449 | 3300048904 | Ga0496101_0021459 | Ga0496101_0021459_2105_3490 | 461 |
| 450 | 3300048905 | Ga0496102_0000703 | Ga0496102_0000703_31737_33122 | 461 |
| 451 | 3300048905 | Ga0496102_0014974 | Ga0496102_0014974_487_1872 | 461 |
| 452 | 3300048905 | Ga0496102_0061450 | Ga0496102_0061450_352_1737 | 461 |
| 453 | 3300048906 | Ga0496103_0001601 | Ga0496103_0001601_395_1780 | 461 |
| 454 | 3300048906 | Ga0496103_0049921 | Ga0496103_0049921_698_2083 | 461 |
| 455 | 3300048907 | Ga0496104_0049630 | Ga0496104_0049630_1226_2614 | 461 |
| 456 | 3300048909 | Ga0496106_0034364 | Ga0496106_0034364_2127_3512 | 461 |
| 457 | 3300048910 | Ga0496107_0016391 | Ga0496107_0016391_2062_3447 | 461 |
| 458 | 3300048913 | Ga0496110_0040099 | Ga0496110_0040099_1829_3217 | 461 |
| 459 | 3300048913 | Ga0496110_0084511 | Ga0496110_0084511_699_2084 | 461 |
| 460 | 3300048915 | Ga0496112_0004387 | Ga0496112_0004387_2196_3584 | 461 |
| 461 | 3300048915 | Ga0496112_0182183 | Ga0496112_0182183_427_1812 | 461 |
| 462 | 3300048916 | Ga0496113_0001778 | Ga0496113_0001778_2701_4089 | 461 |
| 463 | 3300048918 | Ga0496115_0163251 | Ga0496115_0163251_157_1542 | 461 |
| 464 | 3300050507 | nmdc:mga05p37_148710_c1 | nmdc:mga05p37_148710_c1_1220_2635 | 461 |
| 465 | 3300050507 | nmdc:mga05p37_252247_c1 | nmdc:mga05p37_252247_c1_530_1948 | 461 |
| 466 | 3300050508 | nmdc:mga09592_44394_c1 | nmdc:mga09592_44394_c1_166_1581 | 461 |
| 467 | 3300050510 | nmdc:mga06r32_146546_c1 | nmdc:mga06r32_146546_c1_77_1492 | 461 |
| 468 | 3300050512 | nmdc:mga0n895_128980_c1 | nmdc:mga0n895_128980_c1_334_1719 | 461 |
| 469 | 3300050512 | nmdc:mga0n895_20509_c1 | nmdc:mga0n895_20509_c1_2269_3654 | 461 |
| 470 | 3300050512 | nmdc:mga0n895_243581_c1 | nmdc:mga0n895_243581_c1_212_1627 | 461 |
| 471 | 3300050512 | nmdc:mga0n895_29037_c1 | nmdc:mga0n895_29037_c1_3202_4593 | 461 |
| 472 | 3300050512 | nmdc:mga0n895_291972_c1 | nmdc:mga0n895_291972_c1_133_1518 | 461 |
| 473 | 3300050512 | nmdc:mga0n895_37023_c1 | nmdc:mga0n895_37023_c1_2954_4339 | 461 |
| 474 | 3300050512 | nmdc:mga0n895_863_c1 | nmdc:mga0n895_863_c1_11163_12548 | 461 |
| 475 | 3300050513 | nmdc:mga0rr50_14136_c1 | nmdc:mga0rr50_14136_c1_1209_2594 | 461 |
| 476 | 3300050513 | nmdc:mga0rr50_1891_c1 | nmdc:mga0rr50_1891_c1_5116_6501 | 461 |
| 477 | 3300050513 | nmdc:mga0rr50_9943_c1 | nmdc:mga0rr50_9943_c1_3627_5012 | 461 |
| 478 | 3300050514 | nmdc:mga08x19_10113_c1 | nmdc:mga08x19_10113_c1_1833_3227 | 461 |
| 479 | 3300050514 | nmdc:mga08x19_18022_c1 | nmdc:mga08x19_18022_c1_2536_3930 | 461 |
| 480 | 3300050514 | nmdc:mga08x19_7118_c1 | nmdc:mga08x19_7118_c1_921_2306 | 461 |
| 481 | 3300050514 | nmdc:mga08x19_78604_c1 | nmdc:mga08x19_78604_c1_650_2065 | 461 |
| 482 | 3300050515 | nmdc:mga0a205_16792_c1 | nmdc:mga0a205_16792_c1_3050_4435 | 461 |
| 483 | 3300050515 | nmdc:mga0a205_449_c1 | nmdc:mga0a205_449_c1_9876_11261 | 461 |
| 484 | 3300053077 | Ga0495601_0002421 | Ga0495601_0002421_6797_8182 | 461 |
| 485 | 3300053078 | Ga0495612_0001592 | Ga0495612_0001592_3265_4662 | 461 |
| 486 | 3300053085 | Ga0495619_0033329 | Ga0495619_0033329_1903_3288 | 461 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a0z-assembly1.cif.gz_A | catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) | 0.9141 | 310 | 456 |
| 5idm-assembly2.cif.gz_B | bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+ | 0.9096 | 313 | 461 |
| 3a0w-assembly1.cif.gz_A | catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) | 0.9096 | 310 | 456 |
| 3a0w-assembly2.cif.gz_B | catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) | 0.907 | 310 | 456 |
| 8dwz-assembly1.cif.gz_A | ca domain of vansa histidine kinase, 7 kev data | 0.9068 | 313 | 457 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q06067_453_606_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9207 | 310 | 456 | 3.30.565.10 |
| 3d36A01 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9152 | 312 | 458 | 3.30.565.10 |
| af_Q2FXN7_398_551_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9081 | 310 | 456 | 3.30.565.10 |
| 3a0wB00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.907 | 310 | 456 | 3.30.565.10 |
| 5idjA02 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9065 | 310 | 458 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A139X3M5-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9223 | 359 | 459 |
GO:0016772
|
| AF-A0A5S9M6R6-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9181 | 327 | 457 |
GO:0000160
GO:0005524 GO:0016301 |
| AF-A0A7C1W4A4-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9093 | 310 | 460 |
GO:0000155
GO:0005886 GO:0009927 |
| AF-A0A645FQC2-F1-model_v4 | Sensor kinase CckA | 0.8995 | 364 | 460 |
GO:0016301
|
| AF-A0A845U751-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.8892 | 310 | 460 |
GO:0000155
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar