F453295

General Info

Members Datasets Scaffolds Average Seq Length
486 215 486 459

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0023640|Ga0373955_0023640_1184_2569
Length 447
Sequence MVEKSELLRVPAFADLPDNQIAWFIDRAEELRVKAGDQYFREGDAADAMFVVLEGQIQVRGELGGETAVFALKPGDVTGVLPFSRMKQFPVGARAVTGARVMRFPASLFPELIQKRIRETTRREQQRDRLASLGKLSAGLAHELNNPASAAKRATSQLRNILKKIRDTSHELGRRDLTPAQKAEIEKLEASFVQSNEVPPDPLTLSDLEGQIDSLLRSHGQTDLWQMAADLARRNVKPEALESLFAILDADTARAALVRIAASVEVATLLNEIESGTSRISELVRAIKEYTYMDQTPLQNVDIVQSLETTLTIMNHKLKHGVVVRRDYERVPLLVNSFGSELNQVWTNIIDNAIDAMGGKGELRLRTYRDDDFVVVEIGDNGPGILPAVRSHIFEPFFTTKGVGEGTGLGLDTVQRIVRKHRGNIEVSSKPGDTRFQIWLPLTEGLT

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 2.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.73
Rhizosphere 94.86
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10030449 3300005328 Bacteria 3078
2 Ga0070683_100022347 3300005329 Bacteria 5652
3 Ga0070680_100135917 3300005336 Bacteria 2059
4 Ga0070682_100010418 3300005337 Bacteria 5275
5 Ga0068868_100017780 3300005338 Bacteria 5302
6 Ga0068868_100067190 3300005338 Bacteria 2853
7 Ga0068868_100117203 3300005338 Bacteria 2169
8 Ga0070660_100013666 3300005339 Bacteria 5834
9 Ga0070691_10007626 3300005341 Bacteria 4960
10 Ga0070661_100014503 3300005344 Bacteria 5552
11 Ga0070661_100022940 3300005344 Bacteria 4471
12 Ga0070668_100006585 3300005347 Bacteria 8605
13 Ga0070671_100051387 3300005355 Bacteria 3428
14 Ga0070673_100143536 3300005364 Bacteria 2016
15 Ga0070659_100010936 3300005366 Bacteria 6698
16 Ga0070667_100076622 3300005367 Bacteria 2855
17 Ga0070709_10001689 3300005434 Bacteria 11985
18 Ga0070709_10027888 3300005434 Bacteria 3362
19 Ga0070709_10030086 3300005434 Bacteria 3255
20 Ga0070709_10048935 3300005434 Bacteria 2640
21 Ga0070714_100015274 3300005435 Bacteria 6177
22 Ga0070714_100016929 3300005435 Bacteria 5896
23 Ga0070714_100196450 3300005435 Bacteria 1843
24 Ga0070713_100004271 3300005436 Bacteria 9561
25 Ga0070713_100004772 3300005436 Bacteria 9175
26 Ga0070713_100006605 3300005436 Bacteria 8061
27 Ga0070713_100012711 3300005436 Bacteria 6185
28 Ga0070713_100047542 3300005436 Bacteria 3528
29 Ga0070713_100116042 3300005436 Bacteria 2341
30 Ga0070710_10012216 3300005437 Bacteria 4258
31 Ga0070710_10019531 3300005437 Unclassified 3503
32 Ga0070710_10089339 3300005437 Bacteria 1814
33 Ga0070711_100004715 3300005439 Bacteria 8072
34 Ga0070711_100009118 3300005439 Bacteria 6096
35 Ga0070711_100041731 3300005439 Unclassified 3100
36 Ga0070711_100146012 3300005439 Bacteria 1779
37 Ga0070705_100092219 3300005440 Bacteria 1890
38 Ga0070708_100000925 3300005445 Bacteria 22216
39 Ga0070708_100001334 3300005445 Bacteria 18845
40 Ga0070708_100001870 3300005445 Bacteria 16151
41 Ga0070708_100010380 3300005445 Bacteria 7546
42 Ga0070708_100042929 3300005445 Bacteria 3972
43 Ga0070708_100078243 3300005445 Bacteria 2989
44 Ga0070708_100195911 3300005445 Bacteria 1890
45 Ga0070662_100002615 3300005457 Bacteria 11109
46 Ga0070662_100022380 3300005457 Bacteria 4327
47 Ga0070662_100033081 3300005457 Bacteria 3639
48 Ga0070681_10004555 3300005458 Bacteria 13221
49 Ga0070681_10028520 3300005458 Bacteria 5612
50 Ga0070681_10124869 3300005458 Bacteria 2506
51 Ga0068867_100014007 3300005459 Bacteria 5678
52 Ga0068867_100116800 3300005459 Bacteria 2057
53 Ga0068867_100209643 3300005459 Bacteria 1564
54 Ga0070706_100000447 3300005467 Bacteria 49339
55 Ga0070706_100003164 3300005467 Bacteria 16264
56 Ga0070706_100010583 3300005467 Bacteria 8558
57 Ga0070706_100062223 3300005467 Bacteria 3448
58 Ga0070707_100000799 3300005468 Bacteria 31045
59 Ga0070707_100002488 3300005468 Bacteria 17551
60 Ga0070707_100010468 3300005468 Bacteria 8638
61 Ga0070707_100011860 3300005468 Bacteria 8136
62 Ga0070707_100022000 3300005468 Bacteria 6028
63 Ga0070707_100139135 3300005468 Bacteria 2362
64 Ga0070707_100172211 3300005468 Bacteria 2109
65 Ga0070698_100001031 3300005471 Bacteria 30624
66 Ga0070698_100001802 3300005471 Bacteria 23850
67 Ga0070698_100054516 3300005471 Bacteria 4058
68 Ga0070698_100138723 3300005471 Bacteria 2384
69 Ga0070699_100000360 3300005518 Bacteria 44403
70 Ga0070699_100006341 3300005518 Bacteria 10314
71 Ga0070699_100006743 3300005518 Bacteria 9986
72 Ga0070699_100010395 3300005518 Bacteria 8052
73 Ga0070699_100098327 3300005518 Bacteria 2564
74 Ga0070699_100103603 3300005518 Bacteria 2495
75 Ga0070679_100045891 3300005530 Bacteria 4354
76 Ga0070679_100135703 3300005530 Bacteria 2442
77 Ga0070684_100022509 3300005535 Bacteria 5257
78 Ga0070697_100000045 3300005536 Bacteria 92181
79 Ga0070697_100000435 3300005536 Bacteria 31985
80 Ga0070697_100005216 3300005536 Bacteria 9982
81 Ga0070697_100009779 3300005536 Bacteria 7481
82 Ga0070697_100029813 3300005536 Bacteria 4378
83 Ga0070697_100054756 3300005536 Bacteria 3242
84 Ga0070697_100153296 3300005536 Bacteria 1943
85 Ga0068853_100044615 3300005539 Bacteria 3795
86 Ga0070695_100028429 3300005545 Bacteria 3469
87 Ga0070665_100069131 3300005548 Bacteria 3539
88 Ga0068855_100003041 3300005563 Bacteria 20545
89 Ga0068855_100121173 3300005563 Bacteria 2993
90 Ga0070664_100002870 3300005564 Bacteria 13959
91 Ga0070664_100048767 3300005564 Bacteria 3579
92 Ga0070664_100104328 3300005564 Bacteria 2468
93 Ga0068857_100000041 3300005577 Bacteria 70173
94 Ga0068854_100004461 3300005578 Bacteria 8826
95 Ga0068854_100005101 3300005578 Bacteria 8271
96 Ga0068856_100004609 3300005614 Bacteria 13702
97 Ga0068856_100012784 3300005614 Bacteria 8126
98 Ga0068856_100026125 3300005614 Bacteria 5693
99 Ga0068856_100035395 3300005614 Bacteria 4893
100 Ga0068856_100042355 3300005614 Bacteria 4478
101 Ga0068856_100044851 3300005614 Bacteria 4351
102 Ga0068859_100004671 3300005617 Bacteria 13948
103 Ga0068859_100006322 3300005617 Bacteria 12012
104 Ga0068864_100001347 3300005618 Bacteria 20427
105 Ga0068864_100062876 3300005618 Bacteria 3217
106 Ga0068864_100181613 3300005618 Bacteria 1924
107 Ga0068861_100013076 3300005719 Bacteria 5804
108 Ga0068851_10044844 3300005834 Bacteria 2234
109 Ga0068863_100130138 3300005841 Unclassified 2403
110 Ga0068863_100339791 3300005841 Bacteria 1461
111 Ga0068858_100033812 3300005842 Bacteria 4742
112 Ga0068858_100071251 3300005842 Bacteria 3223
113 Ga0068860_100014414 3300005843 Bacteria 7744
114 Ga0068862_100051938 3300005844 Bacteria 3507
115 Ga0070717_10003200 3300006028 Bacteria 11700
116 Ga0070717_10009825 3300006028 Bacteria 7205
117 Ga0070717_10018181 3300006028 Bacteria 5485
118 Ga0070717_10023963 3300006028 Bacteria 4842
119 Ga0070717_10037918 3300006028 Bacteria 3915
120 Ga0070717_10092662 3300006028 Bacteria 2553
121 Ga0070717_10181930 3300006028 Bacteria 1833
122 Ga0070715_10005968 3300006163 Bacteria 4108
123 Ga0070716_100015742 3300006173 Bacteria 3891
124 Ga0070716_100020395 3300006173 Bacteria 3479
125 Ga0070716_100022067 3300006173 Bacteria 3361
126 Ga0070716_100034250 3300006173 Bacteria 2783
127 Ga0070716_100069874 3300006173 Bacteria 2060
128 Ga0070716_100071329 3300006173 Unclassified 2042
129 Ga0070712_100000370 3300006175 Bacteria 25384
130 Ga0070712_100001018 3300006175 Bacteria 16902
131 Ga0070712_100001309 3300006175 Bacteria 15064
132 Ga0070712_100008154 3300006175 Bacteria 6578
133 Ga0070712_100033499 3300006175 Bacteria 3477
134 Ga0070712_100088630 3300006175 Unclassified 2261
135 Ga0097621_100001702 3300006237 Bacteria 15036
136 Ga0097621_100057064 3300006237 Bacteria 3192
137 Ga0097621_100109668 3300006237 Bacteria 2331
138 Ga0097621_100217018 3300006237 Unclassified 1665
139 Ga0068871_100000567 3300006358 Bacteria 25299
140 Ga0068871_100094219 3300006358 Bacteria 2499
141 Ga0068871_100141585 3300006358 Bacteria 2045
142 Ga0068871_100248038 3300006358 Unclassified 1550
143 Ga0075431_100036619 3300006847 Bacteria 5053
144 Ga0075433_10000750 3300006852 Bacteria 22261
145 Ga0075433_10065459 3300006852 Bacteria 3188
146 Ga0075434_100000235 3300006871 Bacteria 38289
147 Ga0075434_100019125 3300006871 Bacteria 6622
148 Ga0075434_100032840 3300006871 Bacteria 5119
149 Ga0075434_100041036 3300006871 Unclassified 4583
150 Ga0075434_100141249 3300006871 Bacteria 2428
151 Ga0075434_100266012 3300006871 Bacteria 1734
152 Ga0068865_100006463 3300006881 Bacteria 7151
153 Ga0075436_100001682 3300006914 Bacteria 15120
154 Ga0075436_100008991 3300006914 Bacteria 6835
155 Ga0075436_100014517 3300006914 Bacteria 5397
156 Ga0097620_100004671 3300006931 Bacteria 13948
157 Ga0097620_100006322 3300006931 Bacteria 12012
158 Ga0075435_100000913 3300007076 Bacteria 18604
159 Ga0075435_100034333 3300007076 Bacteria 4018
160 Ga0075435_100199168 3300007076 Bacteria 1697
161 Ga0099795_10028592 3300007788 Unclassified 1898
162 Ga0099795_10045537 3300007788 Bacteria 1578
163 Ga0105240_10017819 3300009093 Bacteria 9557
164 Ga0105240_10022968 3300009093 Bacteria 8261
165 Ga0105240_10041408 3300009093 Bacteria 5879
166 Ga0105240_10135838 3300009093 Bacteria 2945
167 Ga0105245_10007693 3300009098 Bacteria 9438
168 Ga0105245_10039381 3300009098 Bacteria 4207
169 Ga0105247_10019668 3300009101 Bacteria 4054
170 Ga0114129_10068915 3300009147 Bacteria 4931
171 Ga0114129_10338061 3300009147 Bacteria 1998
172 Ga0105241_10004435 3300009174 Bacteria 10379
173 Ga0105241_10011600 3300009174 Bacteria 6461
174 Ga0105241_10043833 3300009174 Bacteria 3388
175 Ga0105242_10064905 3300009176 Bacteria 3010
176 Ga0105248_10028476 3300009177 Bacteria 6224
177 Ga0105248_10125604 3300009177 Bacteria 2894
178 Ga0105248_10382075 3300009177 Bacteria 1586
179 Ga0105237_10092154 3300009545 Bacteria 3020
180 Ga0105238_10263676 3300009551 Bacteria 1703
181 Ga0105249_10008547 3300009553 Bacteria 8927
182 Ga0105239_10006179 3300010375 Bacteria 13938
183 Ga0105239_10053451 3300010375 Bacteria 4431
184 Ga0105239_10072098 3300010375 Bacteria 3796
185 Ga0105239_10205064 3300010375 Bacteria 2209
186 Ga0105239_10256535 3300010375 Bacteria 1965
187 Ga0157373_10001908 3300013100 Bacteria 15811
188 Ga0157373_10054660 3300013100 Bacteria 2837
189 Ga0157371_10025437 3300013102 Bacteria 4314
190 Ga0157371_10159264 3300013102 Unclassified 1612
191 Ga0157370_10045203 3300013104 Bacteria 4226
192 Ga0157369_10010720 3300013105 Bacteria 10431
193 Ga0157369_10040512 3300013105 Bacteria 5084
194 Ga0157374_10001430 3300013296 Bacteria 20184
195 Ga0157374_10003385 3300013296 Bacteria 13400
196 Ga0157374_10060427 3300013296 Bacteria 3547
197 Ga0157374_10067755 3300013296 Bacteria 3356
198 Ga0157378_10001642 3300013297 Bacteria 20217
199 Ga0157378_10003467 3300013297 Bacteria 13995
200 Ga0157378_10049818 3300013297 Bacteria 3727
201 Ga0157378_10173487 3300013297 Unclassified 2024
202 Ga0157378_10210191 3300013297 Bacteria 1845
203 Ga0163162_10005925 3300013306 Bacteria 11827
204 Ga0163162_10009993 3300013306 Bacteria 9229
205 Ga0157372_10001165 3300013307 Bacteria 28486
206 Ga0157372_10001690 3300013307 Bacteria 23867
207 Ga0157372_10013051 3300013307 Bacteria 8862
208 Ga0157372_10017142 3300013307 Bacteria 7777
209 Ga0157372_10046371 3300013307 Bacteria 4825
210 Ga0157372_10120941 3300013307 Bacteria 3007
211 Ga0157375_10004422 3300013308 Bacteria 12205
212 Ga0157375_10009833 3300013308 Bacteria 8411
213 Ga0157375_10030909 3300013308 Bacteria 5055
214 Ga0163163_10009560 3300014325 Bacteria 8663
215 Ga0163163_10068185 3300014325 Bacteria 3539
216 Ga0163163_10099762 3300014325 Bacteria 2925
217 Ga0163163_10226484 3300014325 Bacteria 1919
218 Ga0182008_10030138 3300014497 Bacteria 2736
219 Ga0157377_10141847 3300014745 Unclassified 1477
220 Ga0157377_10165124 3300014745 Bacteria 1380
221 Ga0157379_10028482 3300014968 Bacteria 4967
222 Ga0157379_10038331 3300014968 Bacteria 4277
223 Ga0157376_10056574 3300014969 Unclassified 3277
224 Ga0157376_10163196 3300014969 Bacteria 2022
225 Ga0182005_1020947 3300015265 Bacteria 1796
226 Ga0224712_10012165 3300022467 Bacteria 2698
227 Ga0224572_1000138 3300024225 Bacteria 6173
228 Ga0224572_1001045 3300024225 Bacteria 3855
229 Ga0228598_1000939 3300024227 Bacteria 6336
230 Ga0228598_1003185 3300024227 Bacteria 3540
231 Ga0207692_10005821 3300025898 Bacteria 4967
232 Ga0207692_10052885 3300025898 Bacteria 2066
233 Ga0207642_10012720 3300025899 Bacteria 3048
234 Ga0207710_10025552 3300025900 Bacteria 2548
235 Ga0207680_10046705 3300025903 Bacteria 2561
236 Ga0207680_10105337 3300025903 Bacteria 1819
237 Ga0207647_10029697 3300025904 Bacteria 3533
238 Ga0207685_10005255 3300025905 Bacteria 3397
239 Ga0207685_10009212 3300025905 Unclassified 2857
240 Ga0207699_10002027 3300025906 Bacteria 9562
241 Ga0207699_10021313 3300025906 Bacteria 3491
242 Ga0207645_10005103 3300025907 Bacteria 9606
243 Ga0207684_10000822 3300025910 Bacteria 35780
244 Ga0207684_10000963 3300025910 Bacteria 32275
245 Ga0207684_10004018 3300025910 Bacteria 14061
246 Ga0207684_10020898 3300025910 Bacteria 5590
247 Ga0207684_10036445 3300025910 Unclassified 4175
248 Ga0207654_10010181 3300025911 Bacteria 4786
249 Ga0207654_10068783 3300025911 Bacteria 2096
250 Ga0207707_10063314 3300025912 Bacteria 3219
251 Ga0207707_10074727 3300025912 Bacteria 2956
252 Ga0207707_10086818 3300025912 Bacteria 2734
253 Ga0207707_10115189 3300025912 Unclassified 2349
254 Ga0207695_10002608 3300025913 Bacteria 26414
255 Ga0207695_10003769 3300025913 Bacteria 21043
256 Ga0207695_10010837 3300025913 Bacteria 11105
257 Ga0207695_10020113 3300025913 Bacteria 7657
258 Ga0207695_10051270 3300025913 Bacteria 4334
259 Ga0207671_10007596 3300025914 Bacteria 9380
260 Ga0207693_10000039 3300025915 Bacteria 108357
261 Ga0207693_10000192 3300025915 Bacteria 55694
262 Ga0207693_10001863 3300025915 Bacteria 18462
263 Ga0207693_10006146 3300025915 Bacteria 9958
264 Ga0207693_10025874 3300025915 Bacteria 4647
265 Ga0207693_10026963 3300025915 Bacteria 4544
266 Ga0207693_10027949 3300025915 Bacteria 4459
267 Ga0207663_10001621 3300025916 Bacteria 10592
268 Ga0207663_10031778 3300025916 Unclassified 3127
269 Ga0207663_10038300 3300025916 Bacteria 2897
270 Ga0207663_10130216 3300025916 Unclassified 1737
271 Ga0207657_10003489 3300025919 Bacteria 16783
272 Ga0207657_10010815 3300025919 Bacteria 9080
273 Ga0207649_10008052 3300025920 Bacteria 5739
274 Ga0207646_10001522 3300025922 Bacteria 28372
275 Ga0207646_10001567 3300025922 Bacteria 27996
276 Ga0207646_10004750 3300025922 Bacteria 14624
277 Ga0207646_10024387 3300025922 Bacteria 5540
278 Ga0207646_10168915 3300025922 Unclassified 1975
279 Ga0207687_10000811 3300025927 Bacteria 21109
280 Ga0207687_10009038 3300025927 Bacteria 6513
281 Ga0207700_10000369 3300025928 Bacteria 26303
282 Ga0207700_10001504 3300025928 Bacteria 13194
283 Ga0207700_10059769 3300025928 Bacteria 2884
284 Ga0207700_10074165 3300025928 Bacteria 2631
285 Ga0207700_10093749 3300025928 Bacteria 2377
286 Ga0207700_10158055 3300025928 Bacteria 1880
287 Ga0207664_10011529 3300025929 Bacteria 6290
288 Ga0207664_10039003 3300025929 Unclassified 3685
289 Ga0207664_10063710 3300025929 Unclassified 2947
290 Ga0207664_10129876 3300025929 Bacteria 2120
291 Ga0207664_10156843 3300025929 Bacteria 1938
292 Ga0207706_10001256 3300025933 Bacteria 25535
293 Ga0207706_10014226 3300025933 Bacteria 7213
294 Ga0207706_10062190 3300025933 Bacteria 3288
295 Ga0207670_10135136 3300025936 Unclassified 1812
296 Ga0207704_10047230 3300025938 Bacteria 2572
297 Ga0207665_10002564 3300025939 Bacteria 12203
298 Ga0207665_10014700 3300025939 Bacteria 5151
299 Ga0207665_10032138 3300025939 Bacteria 3475
300 Ga0207665_10038732 3300025939 Bacteria 3176
301 Ga0207665_10059952 3300025939 Bacteria 2576
302 Ga0207665_10062477 3300025939 Unclassified 2527
303 Ga0207711_10002950 3300025941 Bacteria 14880
304 Ga0207689_10000896 3300025942 Bacteria 28598
305 Ga0207689_10032520 3300025942 Bacteria 4339
306 Ga0207661_10045758 3300025944 Bacteria 3466
307 Ga0207661_10051612 3300025944 Bacteria 3282
308 Ga0207679_10003079 3300025945 Bacteria 10326
309 Ga0207679_10034029 3300025945 Bacteria 3592
310 Ga0207667_10022917 3300025949 Bacteria 6884
311 Ga0207667_10040902 3300025949 Bacteria 4933
312 Ga0207640_10011298 3300025981 Bacteria 5051
313 Ga0207703_10015265 3300026035 Bacteria 5993
314 Ga0207703_10020817 3300026035 Bacteria 5132
315 Ga0207639_10005523 3300026041 Bacteria 8545
316 Ga0207639_10060189 3300026041 Bacteria 2929
317 Ga0207678_10000212 3300026067 Bacteria 51660
318 Ga0207702_10003393 3300026078 Bacteria 14587
319 Ga0207702_10018802 3300026078 Bacteria 5715
320 Ga0207702_10043416 3300026078 Bacteria 3774
321 Ga0207648_10019033 3300026089 Bacteria 6200
322 Ga0207648_10055618 3300026089 Bacteria 3454
323 Ga0207648_10207769 3300026089 Bacteria 1737
324 Ga0207676_10000846 3300026095 Bacteria 23761
325 Ga0207676_10109433 3300026095 Bacteria 2309
326 Ga0207676_10159210 3300026095 Bacteria 1954
327 Ga0207674_10000309 3300026116 Bacteria 62067
328 Ga0207674_10012321 3300026116 Bacteria 9560
329 Ga0265356_1000383 3300028017 Bacteria 8040
330 Ga0268266_10119757 3300028379 Bacteria 2341
331 Ga0268265_10009566 3300028380 Bacteria 6546
332 Ga0268264_10051193 3300028381 Bacteria 3440
333 Ga0265338_10000762 3300028800 Bacteria 54962
334 Ga0265338_10024840 3300028800 Bacteria 6106
335 Ga0265338_10143739 3300028800 Bacteria 1864
336 Ga0265762_1000094 3300030760 Bacteria 12442
337 Ga0265762_1007247 3300030760 Bacteria 1976
338 Ga0265760_10000018 3300031090 Bacteria 84268
339 Ga0265760_10001339 3300031090 Bacteria 7234
340 Ga0265760_10001579 3300031090 Bacteria 6715
341 Ga0265760_10003107 3300031090 Bacteria 4847
342 Ga0265760_10003726 3300031090 Bacteria 4411
343 Ga0265325_10009171 3300031241 Bacteria 5794
344 Ga0265331_10021446 3300031250 Unclassified 3306
345 Ga0265313_10058050 3300031595 Unclassified 1825
346 Ga0265314_10003261 3300031711 Bacteria 15873
347 Ga0265314_10014107 3300031711 Bacteria 6415
348 Ga0316212_1001764 3300033547 Bacteria 3001
349 Ga0373930_0011580 3300034816 Bacteria 1594
350 Ga0373923_0006656 3300035111 Bacteria 4012
351 Ga0373936_0004393 3300035113 Bacteria 5332
352 Ga0373945_0020379 3300035116 Bacteria 2269
353 Ga0373945_0026925 3300035116 Bacteria 2005
354 Ga0373955_0023640 3300035172 Bacteria 3133
355 Ga0373955_0027750 3300035172 Bacteria 2930
356 Ga0373961_0024088 3300035241 Bacteria 1644
357 Ga0373924_0000709 3300035410 Bacteria 10383
358 Ga0373935_0007810 3300035692 Bacteria 6412
359 Ga0373935_0010965 3300035692 Bacteria 5443
360 Ga0373935_0035148 3300035692 Bacteria 3127
361 Ga0373935_0106937 3300035692 Bacteria 1852
362 Ga0373927_0004374 3300035695 Bacteria 9907
363 Ga0373927_0008866 3300035695 Bacteria 6757
364 Ga0373927_0059389 3300035695 Bacteria 2473
365 Ga0373947_0007216 3300035725 Bacteria 6440
366 Ga0373947_0018273 3300035725 Unclassified 4035
367 Ga0373947_0022248 3300035725 Bacteria 3674
368 Ga0373947_0062122 3300035725 Bacteria 2272
369 Ga0373937_0000008 3300036401 Bacteria 170075
370 Ga0373937_0023185 3300036401 Bacteria 5588
371 Ga0373937_0148568 3300036401 Bacteria 2195
372 Ga0373925_0011692 3300037068 Bacteria 6348
373 Ga0373925_0025436 3300037068 Bacteria 4324
374 Ga0373925_0090637 3300037068 Bacteria 2337
375 Ga0373925_0250216 3300037068 Bacteria 1421
376 Ga0395898_0192325 3300037466 Bacteria 1949
377 Ga0395905_0036375 3300037471 Unclassified 4624
378 Ga0436364_0044933 3300037853 Bacteria 2813
379 Ga0451577_0033471 3300042876 Bacteria 4633
380 Ga0453683_0002415 3300044673 Bacteria 14529
381 Ga0453683_0024969 3300044673 Bacteria 3798
382 Ga0453684_0015294 3300044712 Bacteria 12163
383 Ga0466959_0023486 3300045049 Bacteria 4562
384 Ga0451576_0021228 3300045051 Bacteria 7059
385 Ga0466967_0006006 3300045976 Bacteria 8532
386 Ga0466967_0209327 3300045976 Bacteria 1849
387 Ga0495592_0029559 3300046454 Bacteria 4149
388 Ga0495629_0030155 3300046459 Bacteria 3846
389 Ga0495651_0028192 3300046462 Bacteria 4376
390 Ga0495653_0021378 3300046463 Bacteria 5242
391 Ga0495580_0000007 3300046472 Bacteria 103420
392 Ga0495580_0000206 3300046472 Bacteria 45509
393 Ga0495580_0000535 3300046472 Bacteria 32125
394 Ga0495580_0004993 3300046472 Bacteria 11071
395 Ga0495580_0017777 3300046472 Bacteria 5305
396 Ga0495580_0021303 3300046472 Bacteria 4783
397 Ga0495580_0029144 3300046472 Bacteria 4007
398 Ga0495582_0017875 3300046473 Bacteria 3876
399 Ga0495639_0024505 3300046475 Bacteria 2657
400 Ga0495608_0013709 3300046511 Bacteria 5622
401 Ga0495628_0039110 3300046516 Bacteria 3795
402 Ga0495630_0021078 3300046517 Bacteria 4811
403 Ga0495652_0019697 3300046529 Bacteria 6005
404 Ga0495652_0035212 3300046529 Bacteria 4358
405 Ga0495665_0001023 3300046531 Bacteria 14811
406 Ga0495665_0010345 3300046531 Bacteria 5049
407 Ga0495665_0012754 3300046531 Bacteria 4547
408 Ga0495665_0029289 3300046531 Bacteria 2950
409 Ga0495586_0001965 3300046535 Bacteria 11209
410 Ga0495586_0079370 3300046535 Bacteria 1802
411 Ga0495587_0014837 3300046536 Bacteria 4875
412 Ga0495645_0030623 3300046543 Bacteria 3920
413 Ga0495645_0039616 3300046543 Bacteria 3437
414 Ga0495667_0028556 3300046559 Bacteria 3757
415 Ga0495635_0004715 3300046663 Bacteria 9473
416 Ga0495599_0024514 3300046678 Bacteria 3772
417 Ga0495623_0005529 3300046679 Bacteria 8255
418 Ga0495646_0001190 3300046680 Bacteria 15244
419 Ga0495658_0047580 3300046683 Bacteria 2416
420 Ga0495669_0085902 3300046684 Unclassified 1448
421 Ga0495613_0025444 3300046689 Bacteria 4410
422 Ga0495624_0007726 3300046690 Bacteria 7544
423 Ga0495604_0012002 3300047317 Bacteria 6887
424 Ga0495604_0039647 3300047317 Bacteria 3701
425 Ga0495674_0006637 3300047319 Bacteria 11087
426 Ga0495674_0016413 3300047319 Bacteria 6905
427 Ga0495676_0085765 3300047321 Bacteria 2372
428 Ga0495675_0005453 3300047444 Bacteria 7756
429 Ga0495675_0010070 3300047444 Bacteria 5898
430 Ga0495684_0007233 3300047471 Bacteria 8616
431 Ga0495593_0000778 3300047673 Bacteria 18540
432 Ga0495602_0000026 3300048088 Bacteria 148063
433 Ga0495602_0017192 3300048088 Bacteria 7252
434 Ga0495602_0057983 3300048088 Bacteria 3393
435 Ga0495602_0098580 3300048088 Unclassified 2404
436 Ga0496100_0141883 3300048903 Bacteria 1704
437 Ga0496101_0021459 3300048904 Bacteria 4438
438 Ga0496102_0000703 3300048905 Bacteria 33239
439 Ga0496102_0014974 3300048905 Bacteria 6749
440 Ga0496102_0061450 3300048905 Bacteria 3438
441 Ga0496102_0372076 3300048905 Unclassified 1345
442 Ga0496103_0001601 3300048906 Bacteria 14874
443 Ga0496103_0049921 3300048906 Bacteria 2587
444 Ga0496104_0049630 3300048907 Bacteria 3957
445 Ga0496106_0034364 3300048909 Bacteria 3786
446 Ga0496106_0047853 3300048909 Bacteria 3219
447 Ga0496107_0016391 3300048910 Bacteria 5202
448 Ga0496109_0018004 3300048912 Bacteria 6202
449 Ga0496110_0040099 3300048913 Bacteria 4081
450 Ga0496110_0084511 3300048913 Bacteria 2833
451 Ga0496112_0004387 3300048915 Bacteria 11940
452 Ga0496112_0093634 3300048915 Bacteria 2975
453 Ga0496112_0182183 3300048915 Bacteria 2064
454 Ga0496112_0275651 3300048915 Bacteria 1630
455 Ga0496113_0001778 3300048916 Bacteria 12231
456 Ga0496115_0005828 3300048918 Bacteria 8976
457 Ga0496115_0006416 3300048918 Bacteria 8617
458 Ga0496115_0163251 3300048918 Bacteria 1842
459 nmdc:mga05p37_148710_c1 3300050507 Bacteria 2867
460 nmdc:mga05p37_2479_c1 3300050507 Bacteria 21476
461 nmdc:mga05p37_252247_c1 3300050507 Bacteria 2116
462 nmdc:mga09592_44394_c1 3300050508 Bacteria 3741
463 nmdc:mga06r32_146546_c1 3300050510 Bacteria 2338
464 nmdc:mga0n895_128980_c1 3300050512 Bacteria 2553
465 nmdc:mga0n895_20509_c1 3300050512 Bacteria 6166
466 nmdc:mga0n895_233512_c1 3300050512 Bacteria 1867
467 nmdc:mga0n895_243581_c1 3300050512 Bacteria 1825
468 nmdc:mga0n895_25637_c1 3300050512 Bacteria 5574
469 nmdc:mga0n895_29037_c1 3300050512 Bacteria 5269
470 nmdc:mga0n895_291972_c1 3300050512 Bacteria 1653
471 nmdc:mga0n895_37023_c1 3300050512 Unclassified 4716
472 nmdc:mga0n895_863_c1 3300050512 Bacteria 21786
473 nmdc:mga0rr50_14136_c1 3300050513 Bacteria 5225
474 nmdc:mga0rr50_1891_c1 3300050513 Bacteria 11621
475 nmdc:mga0rr50_9943_c1 3300050513 Bacteria 6013
476 nmdc:mga08x19_10113_c1 3300050514 Bacteria 5659
477 nmdc:mga08x19_18022_c1 3300050514 Bacteria 4326
478 nmdc:mga08x19_7118_c1 3300050514 Bacteria 6642
479 nmdc:mga08x19_78604_c1 3300050514 Bacteria 2162
480 nmdc:mga0a205_16792_c1 3300050515 Bacteria 6855
481 nmdc:mga0a205_449_c1 3300050515 Bacteria 31835
482 Ga0495601_0002421 3300053077 Bacteria 10595
483 Ga0495612_0001592 3300053078 Bacteria 9362
484 Ga0495619_0033329 3300053085 Bacteria 3345
485 Ga0587083_0003539 3300059505 Bacteria 2083
486 Ga0587079_003606 3300059647 Bacteria 2030

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_10165124 Ga0157377_101651242 375
2 3300034816 Ga0373930_0011580 Ga0373930_0011580_449_1579 376
3 3300035172 Ga0373955_0027750 Ga0373955_0027750_12_1142 376
4 3300035241 Ga0373961_0024088 Ga0373961_0024088_491_1621 376
5 3300046683 Ga0495658_0047580 Ga0495658_0047580_1275_2405 376
6 3300046684 Ga0495669_0085902 Ga0495669_0085902_95_1234 376
7 3300050512 nmdc:mga0n895_233512_c1 nmdc:mga0n895_233512_c1_690_1853 376
8 3300037466 Ga0395898_0192325 Ga0395898_0192325_13_1266 399
9 3300037068 Ga0373925_0250216 Ga0373925_0250216_38_1276 412
10 3300048903 Ga0496100_0141883 Ga0496100_0141883_11_1249 412
11 3300048905 Ga0496102_0372076 Ga0496102_0372076_14_1255 413
12 3300048909 Ga0496106_0047853 Ga0496106_0047853_63_1304 413
13 3300048915 Ga0496112_0275651 Ga0496112_0275651_19_1263 413
14 3300013102 Ga0157371_10159264 Ga0157371_101592642 442
15 3300005445 Ga0070708_100042929 Ga0070708_1000429292 444
16 3300035172 Ga0373955_0023640 Ga0373955_0023640_1184_2569 447
17 3300036401 Ga0373937_0000008 Ga0373937_0000008_45567_46952 447
18 3300046529 Ga0495652_0019697 Ga0495652_0019697_4250_5635 447
19 3300047317 Ga0495604_0039647 Ga0495604_0039647_107_1492 447
20 3300047444 Ga0495675_0005453 Ga0495675_0005453_3164_4549 447
21 3300048088 Ga0495602_0000026 Ga0495602_0000026_23537_24922 447
22 3300059505 Ga0587083_0003539 Ga0587083_0003539_152_1549 447
23 3300059647 Ga0587079_003606 Ga0587079_003606_581_1978 447
24 3300048088 Ga0495602_0098580 Ga0495602_0098580_970_2352 448
25 3300005336 Ga0070680_100135917 Ga0070680_1001359172 449
26 3300022467 Ga0224712_10012165 Ga0224712_100121652 449
27 3300025899 Ga0207642_10012720 Ga0207642_100127202 452
28 3300046531 Ga0495665_0029289 Ga0495665_0029289_1033_2451 452
29 3300005439 Ga0070711_100146012 Ga0070711_1001460121 454
30 3300006028 Ga0070717_10018181 Ga0070717_100181814 454
31 3300024227 Ga0228598_1000939 Ga0228598_10009394 454
32 3300031250 Ga0265331_10021446 Ga0265331_100214462 454
33 3300031595 Ga0265313_10058050 Ga0265313_100580502 454
34 3300046472 Ga0495580_0021303 Ga0495580_0021303_2959_4344 454
35 3300010375 Ga0105239_10072098 Ga0105239_100720984 455
36 3300036401 Ga0373937_0023185 Ga0373937_0023185_4117_5505 456
37 3300009147 Ga0114129_10338061 Ga0114129_103380611 457
38 3300037853 Ga0436364_0044933 Ga0436364_0044933_435_1808 457
39 3300009147 Ga0114129_10068915 Ga0114129_100689152 458
40 3300050507 nmdc:mga05p37_2479_c1 nmdc:mga05p37_2479_c1_13318_14694 458
41 3300050512 nmdc:mga0n895_25637_c1 nmdc:mga0n895_25637_c1_3841_5217 458
42 3300005434 Ga0070709_10030086 Ga0070709_100300862 459
43 3300005436 Ga0070713_100116042 Ga0070713_1001160422 459
44 3300006358 Ga0068871_100094219 Ga0068871_1000942191 459
45 3300009093 Ga0105240_10017819 Ga0105240_100178196 459
46 3300013307 Ga0157372_10001690 Ga0157372_1000169011 459
47 3300013308 Ga0157375_10030909 Ga0157375_100309092 459
48 3300025913 Ga0207695_10010837 Ga0207695_100108373 459
49 3300025928 Ga0207700_10074165 Ga0207700_100741652 459
50 3300005364 Ga0070673_100143536 Ga0070673_1001435362 460
51 3300005434 Ga0070709_10048935 Ga0070709_100489352 460
52 3300005435 Ga0070714_100015274 Ga0070714_1000152743 460
53 3300005436 Ga0070713_100004772 Ga0070713_1000047725 460
54 3300005439 Ga0070711_100004715 Ga0070711_1000047155 460
55 3300005459 Ga0068867_100209643 Ga0068867_1002096431 460
56 3300005530 Ga0070679_100135703 Ga0070679_1001357032 460
57 3300006028 Ga0070717_10003200 Ga0070717_100032002 460
58 3300006163 Ga0070715_10005968 Ga0070715_100059684 460
59 3300006175 Ga0070712_100001018 Ga0070712_1000010186 460
60 3300006175 Ga0070712_100033499 Ga0070712_1000334993 460
61 3300006237 Ga0097621_100001702 Ga0097621_1000017029 460
62 3300006358 Ga0068871_100000567 Ga0068871_10000056717 460
63 3300009098 Ga0105245_10007693 Ga0105245_100076936 460
64 3300009177 Ga0105248_10125604 Ga0105248_101256042 460
65 3300009177 Ga0105248_10382075 Ga0105248_103820752 460
66 3300010375 Ga0105239_10205064 Ga0105239_102050642 460
67 3300013296 Ga0157374_10067755 Ga0157374_100677552 460
68 3300013297 Ga0157378_10003467 Ga0157378_1000346710 460
69 3300014325 Ga0163163_10009560 Ga0163163_100095608 460
70 3300014969 Ga0157376_10163196 Ga0157376_101631962 460
71 3300025898 Ga0207692_10052885 Ga0207692_100528852 460
72 3300025905 Ga0207685_10005255 Ga0207685_100052551 460
73 3300025906 Ga0207699_10021313 Ga0207699_100213133 460
74 3300025912 Ga0207707_10115189 Ga0207707_101151892 460
75 3300025913 Ga0207695_10002608 Ga0207695_1000260818 460
76 3300025915 Ga0207693_10001863 Ga0207693_100018636 460
77 3300025915 Ga0207693_10026963 Ga0207693_100269635 460
78 3300025916 Ga0207663_10001621 Ga0207663_100016212 460
79 3300025927 Ga0207687_10009038 Ga0207687_100090383 460
80 3300025928 Ga0207700_10001504 Ga0207700_100015047 460
81 3300025928 Ga0207700_10093749 Ga0207700_100937492 460
82 3300025929 Ga0207664_10011529 Ga0207664_100115293 460
83 3300025929 Ga0207664_10039003 Ga0207664_100390034 460
84 3300026035 Ga0207703_10020817 Ga0207703_100208172 460
85 3300026089 Ga0207648_10207769 Ga0207648_102077692 460
86 3300026095 Ga0207676_10109433 Ga0207676_101094332 460
87 3300035113 Ga0373936_0004393 Ga0373936_0004393_1922_3307 460
88 3300035116 Ga0373945_0020379 Ga0373945_0020379_592_1977 460
89 3300035725 Ga0373947_0062122 Ga0373947_0062122_852_2237 460
90 3300037068 Ga0373925_0090637 Ga0373925_0090637_72_1457 460
91 3300046459 Ga0495629_0030155 Ga0495629_0030155_2343_3728 460
92 3300046472 Ga0495580_0000007 Ga0495580_0000007_31069_32454 460
93 3300046472 Ga0495580_0000535 Ga0495580_0000535_24679_26064 460
94 3300046543 Ga0495645_0030623 Ga0495645_0030623_1525_2910 460
95 3300047319 Ga0495674_0006637 Ga0495674_0006637_2068_3453 460
96 3300048912 Ga0496109_0018004 Ga0496109_0018004_2094_3476 460
97 3300048915 Ga0496112_0093634 Ga0496112_0093634_787_2169 460
98 3300048918 Ga0496115_0005828 Ga0496115_0005828_7440_8825 460
99 3300048918 Ga0496115_0006416 Ga0496115_0006416_6281_7663 460
100 3300005328 Ga0070676_10030449 Ga0070676_100304492 461
101 3300005329 Ga0070683_100022347 Ga0070683_1000223473 461
102 3300005337 Ga0070682_100010418 Ga0070682_1000104183 461
103 3300005338 Ga0068868_100017780 Ga0068868_1000177804 461
104 3300005338 Ga0068868_100067190 Ga0068868_1000671901 461
105 3300005338 Ga0068868_100117203 Ga0068868_1001172032 461
106 3300005339 Ga0070660_100013666 Ga0070660_1000136663 461
107 3300005341 Ga0070691_10007626 Ga0070691_100076262 461
108 3300005344 Ga0070661_100014503 Ga0070661_1000145031 461
109 3300005344 Ga0070661_100022940 Ga0070661_1000229403 461
110 3300005347 Ga0070668_100006585 Ga0070668_1000065852 461
111 3300005355 Ga0070671_100051387 Ga0070671_1000513872 461
112 3300005366 Ga0070659_100010936 Ga0070659_1000109365 461
113 3300005367 Ga0070667_100076622 Ga0070667_1000766222 461
114 3300005434 Ga0070709_10001689 Ga0070709_100016899 461
115 3300005434 Ga0070709_10027888 Ga0070709_100278882 461
116 3300005435 Ga0070714_100016929 Ga0070714_1000169292 461
117 3300005435 Ga0070714_100196450 Ga0070714_1001964502 461
118 3300005436 Ga0070713_100004271 Ga0070713_1000042716 461
119 3300005436 Ga0070713_100006605 Ga0070713_1000066055 461
120 3300005436 Ga0070713_100012711 Ga0070713_1000127116 461
121 3300005436 Ga0070713_100047542 Ga0070713_1000475423 461
122 3300005437 Ga0070710_10012216 Ga0070710_100122161 461
123 3300005437 Ga0070710_10019531 Ga0070710_100195312 461
124 3300005437 Ga0070710_10089339 Ga0070710_100893391 461
125 3300005439 Ga0070711_100009118 Ga0070711_1000091183 461
126 3300005439 Ga0070711_100041731 Ga0070711_1000417312 461
127 3300005440 Ga0070705_100092219 Ga0070705_1000922192 461
128 3300005445 Ga0070708_100000925 Ga0070708_1000009258 461
129 3300005445 Ga0070708_100001334 Ga0070708_10000133412 461
130 3300005445 Ga0070708_100001870 Ga0070708_1000018708 461
131 3300005445 Ga0070708_100010380 Ga0070708_1000103805 461
132 3300005445 Ga0070708_100078243 Ga0070708_1000782432 461
133 3300005445 Ga0070708_100195911 Ga0070708_1001959112 461
134 3300005457 Ga0070662_100002615 Ga0070662_1000026157 461
135 3300005457 Ga0070662_100022380 Ga0070662_1000223802 461
136 3300005457 Ga0070662_100033081 Ga0070662_1000330812 461
137 3300005458 Ga0070681_10004555 Ga0070681_100045559 461
138 3300005458 Ga0070681_10028520 Ga0070681_100285204 461
139 3300005458 Ga0070681_10124869 Ga0070681_101248692 461
140 3300005459 Ga0068867_100014007 Ga0068867_1000140072 461
141 3300005459 Ga0068867_100116800 Ga0068867_1001168002 461
142 3300005467 Ga0070706_100000447 Ga0070706_10000044728 461
143 3300005467 Ga0070706_100003164 Ga0070706_10000316410 461
144 3300005467 Ga0070706_100010583 Ga0070706_1000105833 461
145 3300005467 Ga0070706_100062223 Ga0070706_1000622233 461
146 3300005468 Ga0070707_100000799 Ga0070707_10000079927 461
147 3300005468 Ga0070707_100002488 Ga0070707_10000248811 461
148 3300005468 Ga0070707_100010468 Ga0070707_1000104685 461
149 3300005468 Ga0070707_100011860 Ga0070707_1000118605 461
150 3300005468 Ga0070707_100022000 Ga0070707_1000220005 461
151 3300005468 Ga0070707_100139135 Ga0070707_1001391352 461
152 3300005468 Ga0070707_100172211 Ga0070707_1001722112 461
153 3300005471 Ga0070698_100001031 Ga0070698_10000103120 461
154 3300005471 Ga0070698_100001802 Ga0070698_10000180217 461
155 3300005471 Ga0070698_100054516 Ga0070698_1000545167 461
156 3300005471 Ga0070698_100138723 Ga0070698_1001387232 461
157 3300005518 Ga0070699_100000360 Ga0070699_10000036020 461
158 3300005518 Ga0070699_100006341 Ga0070699_1000063416 461
159 3300005518 Ga0070699_100006743 Ga0070699_10000674310 461
160 3300005518 Ga0070699_100010395 Ga0070699_1000103955 461
161 3300005518 Ga0070699_100098327 Ga0070699_1000983272 461
162 3300005518 Ga0070699_100103603 Ga0070699_1001036032 461
163 3300005530 Ga0070679_100045891 Ga0070679_1000458913 461
164 3300005535 Ga0070684_100022509 Ga0070684_1000225094 461
165 3300005536 Ga0070697_100000045 Ga0070697_10000004573 461
166 3300005536 Ga0070697_100000435 Ga0070697_1000004356 461
167 3300005536 Ga0070697_100005216 Ga0070697_1000052165 461
168 3300005536 Ga0070697_100009779 Ga0070697_1000097795 461
169 3300005536 Ga0070697_100029813 Ga0070697_1000298133 461
170 3300005536 Ga0070697_100054756 Ga0070697_1000547562 461
171 3300005536 Ga0070697_100153296 Ga0070697_1001532961 461
172 3300005539 Ga0068853_100044615 Ga0068853_1000446152 461
173 3300005545 Ga0070695_100028429 Ga0070695_1000284292 461
174 3300005548 Ga0070665_100069131 Ga0070665_1000691312 461
175 3300005563 Ga0068855_100003041 Ga0068855_10000304114 461
176 3300005563 Ga0068855_100121173 Ga0068855_1001211732 461
177 3300005564 Ga0070664_100002870 Ga0070664_1000028708 461
178 3300005564 Ga0070664_100048767 Ga0070664_1000487672 461
179 3300005564 Ga0070664_100104328 Ga0070664_1001043282 461
180 3300005577 Ga0068857_100000041 Ga0068857_10000004157 461
181 3300005578 Ga0068854_100004461 Ga0068854_1000044615 461
182 3300005578 Ga0068854_100005101 Ga0068854_1000051016 461
183 3300005614 Ga0068856_100004609 Ga0068856_1000046098 461
184 3300005614 Ga0068856_100012784 Ga0068856_1000127842 461
185 3300005614 Ga0068856_100026125 Ga0068856_1000261252 461
186 3300005614 Ga0068856_100035395 Ga0068856_1000353954 461
187 3300005614 Ga0068856_100042355 Ga0068856_1000423551 461
188 3300005614 Ga0068856_100044851 Ga0068856_1000448512 461
189 3300005617 Ga0068859_100004671 Ga0068859_1000046717 461
190 3300005617 Ga0068859_100006322 Ga0068859_1000063227 461
191 3300005618 Ga0068864_100001347 Ga0068864_10000134714 461
192 3300005618 Ga0068864_100062876 Ga0068864_1000628763 461
193 3300005618 Ga0068864_100181613 Ga0068864_1001816132 461
194 3300005719 Ga0068861_100013076 Ga0068861_1000130766 461
195 3300005834 Ga0068851_10044844 Ga0068851_100448442 461
196 3300005841 Ga0068863_100130138 Ga0068863_1001301382 461
197 3300005841 Ga0068863_100339791 Ga0068863_1003397911 461
198 3300005842 Ga0068858_100033812 Ga0068858_1000338122 461
199 3300005842 Ga0068858_100071251 Ga0068858_1000712512 461
200 3300005843 Ga0068860_100014414 Ga0068860_1000144146 461
201 3300005844 Ga0068862_100051938 Ga0068862_1000519382 461
202 3300006028 Ga0070717_10009825 Ga0070717_100098255 461
203 3300006028 Ga0070717_10023963 Ga0070717_100239633 461
204 3300006028 Ga0070717_10037918 Ga0070717_100379182 461
205 3300006028 Ga0070717_10092662 Ga0070717_100926622 461
206 3300006028 Ga0070717_10181930 Ga0070717_101819301 461
207 3300006173 Ga0070716_100015742 Ga0070716_1000157422 461
208 3300006173 Ga0070716_100020395 Ga0070716_1000203952 461
209 3300006173 Ga0070716_100022067 Ga0070716_1000220672 461
210 3300006173 Ga0070716_100034250 Ga0070716_1000342502 461
211 3300006173 Ga0070716_100069874 Ga0070716_1000698742 461
212 3300006173 Ga0070716_100071329 Ga0070716_1000713292 461
213 3300006175 Ga0070712_100000370 Ga0070712_10000037011 461
214 3300006175 Ga0070712_100001309 Ga0070712_10000130910 461
215 3300006175 Ga0070712_100008154 Ga0070712_1000081545 461
216 3300006175 Ga0070712_100088630 Ga0070712_1000886301 461
217 3300006237 Ga0097621_100057064 Ga0097621_1000570644 461
218 3300006237 Ga0097621_100109668 Ga0097621_1001096682 461
219 3300006237 Ga0097621_100217018 Ga0097621_1002170181 461
220 3300006358 Ga0068871_100141585 Ga0068871_1001415852 461
221 3300006358 Ga0068871_100248038 Ga0068871_1002480381 461
222 3300006847 Ga0075431_100036619 Ga0075431_1000366194 461
223 3300006852 Ga0075433_10000750 Ga0075433_1000075013 461
224 3300006852 Ga0075433_10065459 Ga0075433_100654592 461
225 3300006871 Ga0075434_100000235 Ga0075434_10000023536 461
226 3300006871 Ga0075434_100019125 Ga0075434_1000191256 461
227 3300006871 Ga0075434_100032840 Ga0075434_1000328403 461
228 3300006871 Ga0075434_100041036 Ga0075434_1000410362 461
229 3300006871 Ga0075434_100141249 Ga0075434_1001412492 461
230 3300006871 Ga0075434_100266012 Ga0075434_1002660122 461
231 3300006881 Ga0068865_100006463 Ga0068865_1000064634 461
232 3300006914 Ga0075436_100001682 Ga0075436_1000016829 461
233 3300006914 Ga0075436_100008991 Ga0075436_1000089915 461
234 3300006914 Ga0075436_100014517 Ga0075436_1000145172 461
235 3300006931 Ga0097620_100004671 Ga0097620_1000046715 461
236 3300006931 Ga0097620_100006322 Ga0097620_1000063227 461
237 3300007076 Ga0075435_100000913 Ga0075435_10000091314 461
238 3300007076 Ga0075435_100034333 Ga0075435_1000343333 461
239 3300007076 Ga0075435_100199168 Ga0075435_1001991681 461
240 3300007788 Ga0099795_10028592 Ga0099795_100285921 461
241 3300007788 Ga0099795_10045537 Ga0099795_100455372 461
242 3300009093 Ga0105240_10022968 Ga0105240_100229685 461
243 3300009093 Ga0105240_10041408 Ga0105240_100414083 461
244 3300009093 Ga0105240_10135838 Ga0105240_101358381 461
245 3300009098 Ga0105245_10039381 Ga0105245_100393812 461
246 3300009101 Ga0105247_10019668 Ga0105247_100196682 461
247 3300009174 Ga0105241_10004435 Ga0105241_100044359 461
248 3300009174 Ga0105241_10011600 Ga0105241_100116005 461
249 3300009174 Ga0105241_10043833 Ga0105241_100438332 461
250 3300009176 Ga0105242_10064905 Ga0105242_100649052 461
251 3300009177 Ga0105248_10028476 Ga0105248_100284762 461
252 3300009545 Ga0105237_10092154 Ga0105237_100921542 461
253 3300009551 Ga0105238_10263676 Ga0105238_102636761 461
254 3300009553 Ga0105249_10008547 Ga0105249_100085472 461
255 3300010375 Ga0105239_10006179 Ga0105239_100061792 461
256 3300010375 Ga0105239_10053451 Ga0105239_100534512 461
257 3300010375 Ga0105239_10256535 Ga0105239_102565352 461
258 3300013100 Ga0157373_10001908 Ga0157373_100019082 461
259 3300013100 Ga0157373_10054660 Ga0157373_100546602 461
260 3300013102 Ga0157371_10025437 Ga0157371_100254372 461
261 3300013104 Ga0157370_10045203 Ga0157370_100452032 461
262 3300013105 Ga0157369_10010720 Ga0157369_100107205 461
263 3300013105 Ga0157369_10040512 Ga0157369_100405123 461
264 3300013296 Ga0157374_10001430 Ga0157374_1000143013 461
265 3300013296 Ga0157374_10003385 Ga0157374_100033857 461
266 3300013296 Ga0157374_10060427 Ga0157374_100604272 461
267 3300013297 Ga0157378_10001642 Ga0157378_100016423 461
268 3300013297 Ga0157378_10049818 Ga0157378_100498183 461
269 3300013297 Ga0157378_10173487 Ga0157378_101734872 461
270 3300013297 Ga0157378_10210191 Ga0157378_102101912 461
271 3300013306 Ga0163162_10005925 Ga0163162_100059252 461
272 3300013306 Ga0163162_10009993 Ga0163162_100099933 461
273 3300013307 Ga0157372_10001165 Ga0157372_100011657 461
274 3300013307 Ga0157372_10013051 Ga0157372_100130514 461
275 3300013307 Ga0157372_10017142 Ga0157372_100171425 461
276 3300013307 Ga0157372_10046371 Ga0157372_100463714 461
277 3300013307 Ga0157372_10120941 Ga0157372_101209412 461
278 3300013308 Ga0157375_10004422 Ga0157375_100044224 461
279 3300013308 Ga0157375_10009833 Ga0157375_100098336 461
280 3300014325 Ga0163163_10068185 Ga0163163_100681852 461
281 3300014325 Ga0163163_10099762 Ga0163163_100997622 461
282 3300014325 Ga0163163_10226484 Ga0163163_102264842 461
283 3300014497 Ga0182008_10030138 Ga0182008_100301382 461
284 3300014745 Ga0157377_10141847 Ga0157377_101418471 461
285 3300014968 Ga0157379_10028482 Ga0157379_100284822 461
286 3300014968 Ga0157379_10038331 Ga0157379_100383312 461
287 3300014969 Ga0157376_10056574 Ga0157376_100565742 461
288 3300015265 Ga0182005_1020947 Ga0182005_10209472 461
289 3300024225 Ga0224572_1000138 Ga0224572_10001384 461
290 3300024225 Ga0224572_1001045 Ga0224572_10010453 461
291 3300024227 Ga0228598_1003185 Ga0228598_10031853 461
292 3300025898 Ga0207692_10005821 Ga0207692_100058212 461
293 3300025900 Ga0207710_10025552 Ga0207710_100255522 461
294 3300025903 Ga0207680_10046705 Ga0207680_100467052 461
295 3300025903 Ga0207680_10105337 Ga0207680_101053372 461
296 3300025904 Ga0207647_10029697 Ga0207647_100296972 461
297 3300025905 Ga0207685_10009212 Ga0207685_100092122 461
298 3300025906 Ga0207699_10002027 Ga0207699_100020276 461
299 3300025907 Ga0207645_10005103 Ga0207645_100051036 461
300 3300025910 Ga0207684_10000822 Ga0207684_1000082220 461
301 3300025910 Ga0207684_10000963 Ga0207684_1000096328 461
302 3300025910 Ga0207684_10004018 Ga0207684_100040183 461
303 3300025910 Ga0207684_10020898 Ga0207684_100208982 461
304 3300025910 Ga0207684_10036445 Ga0207684_100364454 461
305 3300025911 Ga0207654_10010181 Ga0207654_100101812 461
306 3300025911 Ga0207654_10068783 Ga0207654_100687832 461
307 3300025912 Ga0207707_10063314 Ga0207707_100633144 461
308 3300025912 Ga0207707_10074727 Ga0207707_100747272 461
309 3300025912 Ga0207707_10086818 Ga0207707_100868182 461
310 3300025913 Ga0207695_10003769 Ga0207695_100037698 461
311 3300025913 Ga0207695_10020113 Ga0207695_100201137 461
312 3300025913 Ga0207695_10051270 Ga0207695_100512704 461
313 3300025914 Ga0207671_10007596 Ga0207671_100075968 461
314 3300025915 Ga0207693_10000039 Ga0207693_1000003958 461
315 3300025915 Ga0207693_10000192 Ga0207693_1000019245 461
316 3300025915 Ga0207693_10006146 Ga0207693_100061462 461
317 3300025915 Ga0207693_10025874 Ga0207693_100258744 461
318 3300025915 Ga0207693_10027949 Ga0207693_100279492 461
319 3300025916 Ga0207663_10031778 Ga0207663_100317782 461
320 3300025916 Ga0207663_10038300 Ga0207663_100383001 461
321 3300025916 Ga0207663_10130216 Ga0207663_101302162 461
322 3300025919 Ga0207657_10003489 Ga0207657_1000348915 461
323 3300025919 Ga0207657_10010815 Ga0207657_100108157 461
324 3300025920 Ga0207649_10008052 Ga0207649_100080523 461
325 3300025922 Ga0207646_10001522 Ga0207646_1000152217 461
326 3300025922 Ga0207646_10001567 Ga0207646_100015672 461
327 3300025922 Ga0207646_10004750 Ga0207646_100047504 461
328 3300025922 Ga0207646_10024387 Ga0207646_100243873 461
329 3300025922 Ga0207646_10168915 Ga0207646_101689152 461
330 3300025927 Ga0207687_10000811 Ga0207687_1000081110 461
331 3300025928 Ga0207700_10000369 Ga0207700_100003699 461
332 3300025928 Ga0207700_10059769 Ga0207700_100597692 461
333 3300025928 Ga0207700_10158055 Ga0207700_101580552 461
334 3300025929 Ga0207664_10063710 Ga0207664_100637103 461
335 3300025929 Ga0207664_10129876 Ga0207664_101298762 461
336 3300025929 Ga0207664_10156843 Ga0207664_101568432 461
337 3300025933 Ga0207706_10001256 Ga0207706_100012568 461
338 3300025933 Ga0207706_10014226 Ga0207706_100142262 461
339 3300025933 Ga0207706_10062190 Ga0207706_100621902 461
340 3300025936 Ga0207670_10135136 Ga0207670_101351362 461
341 3300025938 Ga0207704_10047230 Ga0207704_100472302 461
342 3300025939 Ga0207665_10002564 Ga0207665_100025644 461
343 3300025939 Ga0207665_10014700 Ga0207665_100147002 461
344 3300025939 Ga0207665_10032138 Ga0207665_100321383 461
345 3300025939 Ga0207665_10038732 Ga0207665_100387322 461
346 3300025939 Ga0207665_10059952 Ga0207665_100599522 461
347 3300025939 Ga0207665_10062477 Ga0207665_100624772 461
348 3300025941 Ga0207711_10002950 Ga0207711_100029507 461
349 3300025942 Ga0207689_10000896 Ga0207689_100008963 461
350 3300025942 Ga0207689_10032520 Ga0207689_100325203 461
351 3300025944 Ga0207661_10045758 Ga0207661_100457582 461
352 3300025944 Ga0207661_10051612 Ga0207661_100516122 461
353 3300025945 Ga0207679_10003079 Ga0207679_100030793 461
354 3300025945 Ga0207679_10034029 Ga0207679_100340292 461
355 3300025949 Ga0207667_10022917 Ga0207667_100229177 461
356 3300025949 Ga0207667_10040902 Ga0207667_100409022 461
357 3300025981 Ga0207640_10011298 Ga0207640_100112982 461
358 3300026035 Ga0207703_10015265 Ga0207703_100152652 461
359 3300026041 Ga0207639_10005523 Ga0207639_100055238 461
360 3300026041 Ga0207639_10060189 Ga0207639_100601894 461
361 3300026067 Ga0207678_10000212 Ga0207678_1000021211 461
362 3300026078 Ga0207702_10003393 Ga0207702_1000339312 461
363 3300026078 Ga0207702_10018802 Ga0207702_100188024 461
364 3300026078 Ga0207702_10043416 Ga0207702_100434163 461
365 3300026089 Ga0207648_10019033 Ga0207648_100190333 461
366 3300026089 Ga0207648_10055618 Ga0207648_100556182 461
367 3300026095 Ga0207676_10000846 Ga0207676_1000084614 461
368 3300026095 Ga0207676_10159210 Ga0207676_101592102 461
369 3300026116 Ga0207674_10000309 Ga0207674_100003094 461
370 3300026116 Ga0207674_10012321 Ga0207674_100123216 461
371 3300028017 Ga0265356_1000383 Ga0265356_10003835 461
372 3300028379 Ga0268266_10119757 Ga0268266_101197572 461
373 3300028380 Ga0268265_10009566 Ga0268265_100095664 461
374 3300028381 Ga0268264_10051193 Ga0268264_100511934 461
375 3300028800 Ga0265338_10000762 Ga0265338_1000076218 461
376 3300028800 Ga0265338_10024840 Ga0265338_100248405 461
377 3300028800 Ga0265338_10143739 Ga0265338_101437391 461
378 3300030760 Ga0265762_1000094 Ga0265762_10000944 461
379 3300030760 Ga0265762_1007247 Ga0265762_10072472 461
380 3300031090 Ga0265760_10000018 Ga0265760_1000001816 461
381 3300031090 Ga0265760_10001339 Ga0265760_100013396 461
382 3300031090 Ga0265760_10001579 Ga0265760_100015794 461
383 3300031090 Ga0265760_10003107 Ga0265760_100031075 461
384 3300031090 Ga0265760_10003726 Ga0265760_100037263 461
385 3300031241 Ga0265325_10009171 Ga0265325_100091715 461
386 3300031711 Ga0265314_10003261 Ga0265314_100032612 461
387 3300031711 Ga0265314_10014107 Ga0265314_100141073 461
388 3300033547 Ga0316212_1001764 Ga0316212_10017642 461
389 3300035111 Ga0373923_0006656 Ga0373923_0006656_1704_3092 461
390 3300035116 Ga0373945_0026925 Ga0373945_0026925_452_1840 461
391 3300035410 Ga0373924_0000709 Ga0373924_0000709_3368_4756 461
392 3300035692 Ga0373935_0007810 Ga0373935_0007810_465_1853 461
393 3300035692 Ga0373935_0010965 Ga0373935_0010965_1976_3373 461
394 3300035692 Ga0373935_0035148 Ga0373935_0035148_1254_2642 461
395 3300035692 Ga0373935_0106937 Ga0373935_0106937_289_1677 461
396 3300035695 Ga0373927_0004374 Ga0373927_0004374_3261_4658 461
397 3300035695 Ga0373927_0008866 Ga0373927_0008866_2920_4305 461
398 3300035695 Ga0373927_0059389 Ga0373927_0059389_234_1619 461
399 3300035725 Ga0373947_0007216 Ga0373947_0007216_2973_4370 461
400 3300035725 Ga0373947_0018273 Ga0373947_0018273_1482_2867 461
401 3300035725 Ga0373947_0022248 Ga0373947_0022248_1778_3166 461
402 3300036401 Ga0373937_0148568 Ga0373937_0148568_629_2014 461
403 3300037068 Ga0373925_0011692 Ga0373925_0011692_1328_2713 461
404 3300037068 Ga0373925_0025436 Ga0373925_0025436_1710_3107 461
405 3300037471 Ga0395905_0036375 Ga0395905_0036375_1502_2887 461
406 3300042876 Ga0451577_0033471 Ga0451577_0033471_2265_3650 461
407 3300044673 Ga0453683_0002415 Ga0453683_0002415_3526_4911 461
408 3300044673 Ga0453683_0024969 Ga0453683_0024969_1129_2514 461
409 3300044712 Ga0453684_0015294 Ga0453684_0015294_6891_8276 461
410 3300045049 Ga0466959_0023486 Ga0466959_0023486_1801_3192 461
411 3300045051 Ga0451576_0021228 Ga0451576_0021228_2236_3621 461
412 3300045976 Ga0466967_0006006 Ga0466967_0006006_5717_7102 461
413 3300045976 Ga0466967_0209327 Ga0466967_0209327_145_1536 461
414 3300046454 Ga0495592_0029559 Ga0495592_0029559_1371_2768 461
415 3300046462 Ga0495651_0028192 Ga0495651_0028192_86_1471 461
416 3300046463 Ga0495653_0021378 Ga0495653_0021378_1751_3148 461
417 3300046472 Ga0495580_0000206 Ga0495580_0000206_21467_22852 461
418 3300046472 Ga0495580_0004993 Ga0495580_0004993_6105_7502 461
419 3300046472 Ga0495580_0017777 Ga0495580_0017777_3884_5269 461
420 3300046472 Ga0495580_0029144 Ga0495580_0029144_1379_2764 461
421 3300046473 Ga0495582_0017875 Ga0495582_0017875_954_2339 461
422 3300046475 Ga0495639_0024505 Ga0495639_0024505_645_2030 461
423 3300046511 Ga0495608_0013709 Ga0495608_0013709_977_2374 461
424 3300046516 Ga0495628_0039110 Ga0495628_0039110_2060_3448 461
425 3300046517 Ga0495630_0021078 Ga0495630_0021078_2268_3665 461
426 3300046529 Ga0495652_0035212 Ga0495652_0035212_1319_2716 461
427 3300046531 Ga0495665_0001023 Ga0495665_0001023_7283_8680 461
428 3300046531 Ga0495665_0010345 Ga0495665_0010345_302_1687 461
429 3300046531 Ga0495665_0012754 Ga0495665_0012754_718_2103 461
430 3300046535 Ga0495586_0001965 Ga0495586_0001965_4033_5430 461
431 3300046535 Ga0495586_0079370 Ga0495586_0079370_123_1508 461
432 3300046536 Ga0495587_0014837 Ga0495587_0014837_1376_2773 461
433 3300046543 Ga0495645_0039616 Ga0495645_0039616_582_1979 461
434 3300046559 Ga0495667_0028556 Ga0495667_0028556_1451_2848 461
435 3300046663 Ga0495635_0004715 Ga0495635_0004715_4698_6095 461
436 3300046678 Ga0495599_0024514 Ga0495599_0024514_543_1940 461
437 3300046679 Ga0495623_0005529 Ga0495623_0005529_2235_3632 461
438 3300046680 Ga0495646_0001190 Ga0495646_0001190_1723_3120 461
439 3300046689 Ga0495613_0025444 Ga0495613_0025444_2537_3922 461
440 3300046690 Ga0495624_0007726 Ga0495624_0007726_4603_6000 461
441 3300047317 Ga0495604_0012002 Ga0495604_0012002_5060_6457 461
442 3300047319 Ga0495674_0016413 Ga0495674_0016413_3489_4886 461
443 3300047321 Ga0495676_0085765 Ga0495676_0085765_352_1749 461
444 3300047444 Ga0495675_0010070 Ga0495675_0010070_2300_3697 461
445 3300047471 Ga0495684_0007233 Ga0495684_0007233_1483_2880 461
446 3300047673 Ga0495593_0000778 Ga0495593_0000778_4556_5953 461
447 3300048088 Ga0495602_0017192 Ga0495602_0017192_544_1941 461
448 3300048088 Ga0495602_0057983 Ga0495602_0057983_1712_3097 461
449 3300048904 Ga0496101_0021459 Ga0496101_0021459_2105_3490 461
450 3300048905 Ga0496102_0000703 Ga0496102_0000703_31737_33122 461
451 3300048905 Ga0496102_0014974 Ga0496102_0014974_487_1872 461
452 3300048905 Ga0496102_0061450 Ga0496102_0061450_352_1737 461
453 3300048906 Ga0496103_0001601 Ga0496103_0001601_395_1780 461
454 3300048906 Ga0496103_0049921 Ga0496103_0049921_698_2083 461
455 3300048907 Ga0496104_0049630 Ga0496104_0049630_1226_2614 461
456 3300048909 Ga0496106_0034364 Ga0496106_0034364_2127_3512 461
457 3300048910 Ga0496107_0016391 Ga0496107_0016391_2062_3447 461
458 3300048913 Ga0496110_0040099 Ga0496110_0040099_1829_3217 461
459 3300048913 Ga0496110_0084511 Ga0496110_0084511_699_2084 461
460 3300048915 Ga0496112_0004387 Ga0496112_0004387_2196_3584 461
461 3300048915 Ga0496112_0182183 Ga0496112_0182183_427_1812 461
462 3300048916 Ga0496113_0001778 Ga0496113_0001778_2701_4089 461
463 3300048918 Ga0496115_0163251 Ga0496115_0163251_157_1542 461
464 3300050507 nmdc:mga05p37_148710_c1 nmdc:mga05p37_148710_c1_1220_2635 461
465 3300050507 nmdc:mga05p37_252247_c1 nmdc:mga05p37_252247_c1_530_1948 461
466 3300050508 nmdc:mga09592_44394_c1 nmdc:mga09592_44394_c1_166_1581 461
467 3300050510 nmdc:mga06r32_146546_c1 nmdc:mga06r32_146546_c1_77_1492 461
468 3300050512 nmdc:mga0n895_128980_c1 nmdc:mga0n895_128980_c1_334_1719 461
469 3300050512 nmdc:mga0n895_20509_c1 nmdc:mga0n895_20509_c1_2269_3654 461
470 3300050512 nmdc:mga0n895_243581_c1 nmdc:mga0n895_243581_c1_212_1627 461
471 3300050512 nmdc:mga0n895_29037_c1 nmdc:mga0n895_29037_c1_3202_4593 461
472 3300050512 nmdc:mga0n895_291972_c1 nmdc:mga0n895_291972_c1_133_1518 461
473 3300050512 nmdc:mga0n895_37023_c1 nmdc:mga0n895_37023_c1_2954_4339 461
474 3300050512 nmdc:mga0n895_863_c1 nmdc:mga0n895_863_c1_11163_12548 461
475 3300050513 nmdc:mga0rr50_14136_c1 nmdc:mga0rr50_14136_c1_1209_2594 461
476 3300050513 nmdc:mga0rr50_1891_c1 nmdc:mga0rr50_1891_c1_5116_6501 461
477 3300050513 nmdc:mga0rr50_9943_c1 nmdc:mga0rr50_9943_c1_3627_5012 461
478 3300050514 nmdc:mga08x19_10113_c1 nmdc:mga08x19_10113_c1_1833_3227 461
479 3300050514 nmdc:mga08x19_18022_c1 nmdc:mga08x19_18022_c1_2536_3930 461
480 3300050514 nmdc:mga08x19_7118_c1 nmdc:mga08x19_7118_c1_921_2306 461
481 3300050514 nmdc:mga08x19_78604_c1 nmdc:mga08x19_78604_c1_650_2065 461
482 3300050515 nmdc:mga0a205_16792_c1 nmdc:mga0a205_16792_c1_3050_4435 461
483 3300050515 nmdc:mga0a205_449_c1 nmdc:mga0a205_449_c1_9876_11261 461
484 3300053077 Ga0495601_0002421 Ga0495601_0002421_6797_8182 461
485 3300053078 Ga0495612_0001592 Ga0495612_0001592_3265_4662 461
486 3300053085 Ga0495619_0033329 Ga0495619_0033329_1903_3288 461

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

30

116

0.96

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

339

444

0.89

PF14501

HATPase_c_5

GHKL domain

340

441

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a0z-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.9141 310 456
5idm-assembly2.cif.gz_B bifunctional histidine kinase ccka (domain, ca) in complex with c-di-gmp and amppnp/mg2+ 0.9096 313 461
3a0w-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.9096 310 456
3a0w-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.907 310 456
8dwz-assembly1.cif.gz_A ca domain of vansa histidine kinase, 7 kev data 0.9068 313 457
ID Description Score Start End Superfamily
af_Q06067_453_606_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9207 310 456 3.30.565.10
3d36A01 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9152 312 458 3.30.565.10
af_Q2FXN7_398_551_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9081 310 456 3.30.565.10
3a0wB00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.907 310 456 3.30.565.10
5idjA02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9065 310 458 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A139X3M5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9223 359 459 GO:0016772
AF-A0A5S9M6R6-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9181 327 457 GO:0000160
GO:0005524
GO:0016301
AF-A0A7C1W4A4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9093 310 460 GO:0000155
GO:0005886
GO:0009927
AF-A0A645FQC2-F1-model_v4 Sensor kinase CckA 0.8995 364 460 GO:0016301
AF-A0A845U751-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8892 310 460 GO:0000155

Feature Viewer

pLDDT pTM Quality
84.27 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map