F453259

General Info

Members Datasets Scaffolds Average Seq Length
486 265 972 71

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12962771|Ga0105249_129627712
Length 82
Sequence LAGLRNERSEEMSESVYRVTEVIGVSPDSWEAATRNAVETAAGTIRGLRIAEATRFDVTIEDGKVSSYRVRLGISFKYEAGD

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
148 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
152 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
156 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 7.2
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 14.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_12962771 3300009553 Unclassified 545
2 JGI25406J46586_10026101 3300003203 Bacteria 2258
3 Ga0070658_10030761 3300005327 Bacteria 4312
4 Ga0070683_100493462 3300005329 Bacteria 1169
5 Ga0070683_100527110 3300005329 Bacteria 1129
6 Ga0070680_101729845 3300005336 Unclassified 542
7 Ga0070682_100824530 3300005337 Bacteria 756
8 Ga0070660_100080471 3300005339 Bacteria 2556
9 Ga0070661_100335417 3300005344 Bacteria 1183
10 Ga0070692_10253728 3300005345 Bacteria 1054
11 Ga0070668_100380028 3300005347 Bacteria 1202
12 Ga0070669_100882688 3300005353 Bacteria 763
13 Ga0070659_100320059 3300005366 Bacteria 1297
14 Ga0070659_101753330 3300005366 Bacteria 556
15 Ga0070709_10318170 3300005434 Bacteria 1141
16 Ga0070709_10909899 3300005434 Bacteria 696
17 Ga0070714_100020229 3300005435 Bacteria 5433
18 Ga0070714_100545095 3300005435 Bacteria 1110
19 Ga0070714_100583974 3300005435 Bacteria 1072
20 Ga0070714_101332288 3300005435 Bacteria 701
21 Ga0070714_101816213 3300005435 Bacteria 595
22 Ga0070714_102117171 3300005435 Bacteria 548
23 Ga0070713_100290574 3300005436 Bacteria 1502
24 Ga0070713_100475850 3300005436 Bacteria 1176
25 Ga0070713_100963977 3300005436 Bacteria 822
26 Ga0070713_101773159 3300005436 Unclassified 599
27 Ga0070710_10371387 3300005437 Bacteria 952
28 Ga0070711_100142108 3300005439 Bacteria 1801
29 Ga0070711_100385014 3300005439 Bacteria 1135
30 Ga0070711_100992421 3300005439 Bacteria 720
31 Ga0070705_100410868 3300005440 Unclassified 1005
32 Ga0070700_100684220 3300005441 Bacteria 813
33 Ga0070708_100050908 3300005445 Bacteria 3668
34 Ga0070708_100586490 3300005445 Bacteria 1051
35 Ga0070708_101221238 3300005445 Unclassified 703
36 Ga0070708_102254540 3300005445 Unclassified 503
37 Ga0070663_100549678 3300005455 Bacteria 965
38 Ga0070681_11432156 3300005458 Bacteria 615
39 Ga0068867_100442265 3300005459 Bacteria 1106
40 Ga0068867_100665841 3300005459 Bacteria 915
41 Ga0070685_10916194 3300005466 Bacteria 653
42 Ga0070706_100781903 3300005467 Bacteria 884
43 Ga0070706_100789985 3300005467 Bacteria 879
44 Ga0070707_100682303 3300005468 Bacteria 990
45 Ga0070707_102288577 3300005468 Unclassified 508
46 Ga0070698_100111351 3300005471 Bacteria 2702
47 Ga0070698_100301589 3300005471 Bacteria 1533
48 Ga0070698_101147524 3300005471 Unclassified 726
49 Ga0070679_100706968 3300005530 Bacteria 951
50 Ga0070679_101473206 3300005530 Bacteria 627
51 Ga0070684_101593880 3300005535 Unclassified 616
52 Ga0070672_101050368 3300005543 Bacteria 723
53 Ga0070696_100310119 3300005546 Bacteria 1211
54 Ga0070696_100558718 3300005546 Bacteria 918
55 Ga0070696_101523341 3300005546 Bacteria 573
56 Ga0070704_101358186 3300005549 Bacteria 651
57 Ga0070664_100586598 3300005564 Bacteria 1033
58 Ga0068854_101750717 3300005578 Bacteria 569
59 Ga0068856_101629301 3300005614 Unclassified 658
60 Ga0070702_100090792 3300005615 Bacteria 1852
61 Ga0068852_101413019 3300005616 Bacteria 718
62 Ga0068864_101005967 3300005618 Bacteria 827
63 Ga0068870_10245133 3300005840 Bacteria 1108
64 Ga0068858_100239030 3300005842 Bacteria 1723
65 Ga0068862_102638012 3300005844 Bacteria 514
66 Ga0081455_10943114 3300005937 Bacteria 535
67 Ga0081538_10020009 3300005981 Bacteria 4948
68 Ga0081538_10072906 3300005981 Bacteria 1880
69 Ga0081538_10157620 3300005981 Bacteria 1015
70 Ga0081539_10013226 3300005985 Bacteria 6242
71 Ga0070717_11055168 3300006028 Bacteria 740
72 Ga0070717_11975071 3300006028 Bacteria 526
73 Ga0075365_10113155 3300006038 Unclassified 1867
74 Ga0075365_10895310 3300006038 Unclassified 626
75 Ga0070716_100063952 3300006173 Bacteria 2138
76 Ga0070716_100301903 3300006173 Bacteria 1114
77 Ga0070712_100021239 3300006175 Bacteria 4261
78 Ga0070712_100716590 3300006175 Bacteria 854
79 Ga0075362_10603729 3300006177 Bacteria 567
80 Ga0075428_100295328 3300006844 Bacteria 1742
81 Ga0075428_101957933 3300006844 Bacteria 608
82 Ga0075433_10999048 3300006852 Bacteria 729
83 Ga0075433_11821981 3300006852 Unclassified 523
84 Ga0075434_100235677 3300006871 Bacteria 1850
85 Ga0075434_100657169 3300006871 Bacteria 1066
86 Ga0075429_100667481 3300006880 Bacteria 911
87 Ga0068865_101293743 3300006881 Bacteria 648
88 Ga0111539_10178544 3300009094 Bacteria 2480
89 Ga0111539_10715225 3300009094 Bacteria 1166
90 Ga0111539_13138094 3300009094 Bacteria 533
91 Ga0105245_12887429 3300009098 Unclassified 533
92 Ga0105245_13072207 3300009098 Bacteria 517
93 Ga0114129_10065451 3300009147 Bacteria 5073
94 Ga0114129_10844314 3300009147 Bacteria 1165
95 Ga0114129_11277109 3300009147 Bacteria 911
96 Ga0114129_12104144 3300009147 Bacteria 681
97 Ga0105243_12036746 3300009148 Unclassified 609
98 Ga0105243_12292522 3300009148 Unclassified 577
99 Ga0105243_12553740 3300009148 Bacteria 550
100 Ga0105242_10086130 3300009176 Bacteria 2636
101 Ga0105248_11620257 3300009177 Bacteria 733
102 Ga0105237_12005791 3300009545 Bacteria 587
103 Ga0105238_10825289 3300009551 Bacteria 943
104 Ga0105238_12628506 3300009551 Bacteria 540
105 Ga0105249_10452338 3300009553 Bacteria 1323
106 Ga0105239_11130793 3300010375 Bacteria 902
107 Ga0105246_12411143 3300011119 Bacteria 516
108 Ga0157373_10948842 3300013100 Unclassified 640
109 Ga0157371_10850279 3300013102 Bacteria 690
110 Ga0157371_10967784 3300013102 Bacteria 648
111 Ga0157369_10357719 3300013105 Bacteria 1516
112 Ga0157369_10409257 3300013105 Bacteria 1407
113 Ga0157378_11435518 3300013297 Bacteria 734
114 Ga0163162_10289848 3300013306 Unclassified 1769
115 Ga0157372_11788636 3300013307 Bacteria 707
116 Ga0157372_12128677 3300013307 Bacteria 645
117 Ga0157375_10782622 3300013308 Bacteria 1104
118 Ga0157375_11207150 3300013308 Bacteria 887
119 Ga0163163_12509458 3300014325 Bacteria 573
120 Ga0163163_12575511 3300014325 Bacteria 566
121 Ga0157380_13072535 3300014326 Bacteria 532
122 Ga0206354_10789524 3300020081 Bacteria 916
123 Ga0206353_11739424 3300020082 Bacteria 565
124 Ga0207692_10220878 3300025898 Bacteria 1123
125 Ga0207642_10268502 3300025899 Bacteria 976
126 Ga0207642_10639076 3300025899 Bacteria 666
127 Ga0207680_11325968 3300025903 Bacteria 511
128 Ga0207685_10367205 3300025905 Bacteria 730
129 Ga0207699_11007089 3300025906 Unclassified 616
130 Ga0207705_10069982 3300025909 Bacteria 2542
131 Ga0207705_10987588 3300025909 Bacteria 651
132 Ga0207684_10992423 3300025910 Unclassified 703
133 Ga0207684_11147780 3300025910 Bacteria 645
134 Ga0207684_11570947 3300025910 Unclassified 533
135 Ga0207707_11219031 3300025912 Bacteria 608
136 Ga0207693_10044177 3300025915 Bacteria 3502
137 Ga0207693_10080149 3300025915 Bacteria 2556
138 Ga0207693_10134090 3300025915 Bacteria 1947
139 Ga0207693_10186609 3300025915 Bacteria 1632
140 Ga0207693_10396232 3300025915 Bacteria 1079
141 Ga0207693_10782126 3300025915 Bacteria 736
142 Ga0207663_10184851 3300025916 Bacteria 1491
143 Ga0207663_10229502 3300025916 Bacteria 1355
144 Ga0207663_10264333 3300025916 Bacteria 1272
145 Ga0207663_10687249 3300025916 Bacteria 809
146 Ga0207663_11205446 3300025916 Unclassified 609
147 Ga0207663_11534002 3300025916 Bacteria 536
148 Ga0207657_10004128 3300025919 Bacteria 15425
149 Ga0207649_10375704 3300025920 Bacteria 1058
150 Ga0207646_10840792 3300025922 Bacteria 816
151 Ga0207687_11482484 3300025927 Bacteria 583
152 Ga0207700_10248632 3300025928 Bacteria 1518
153 Ga0207700_10870482 3300025928 Bacteria 806
154 Ga0207700_11127908 3300025928 Bacteria 701
155 Ga0207700_11548718 3300025928 Bacteria 587
156 Ga0207664_10093672 3300025929 Bacteria 2467
157 Ga0207664_10366123 3300025929 Bacteria 1278
158 Ga0207664_10507269 3300025929 Bacteria 1080
159 Ga0207664_11508492 3300025929 Bacteria 594
160 Ga0207664_11653966 3300025929 Bacteria 562
161 Ga0207664_11705250 3300025929 Bacteria 552
162 Ga0207644_10037663 3300025931 Bacteria 3404
163 Ga0207644_11280707 3300025931 Bacteria 616
164 Ga0207690_11506994 3300025932 Bacteria 562
165 Ga0207686_10702511 3300025934 Bacteria 804
166 Ga0207669_10914406 3300025937 Bacteria 734
167 Ga0207704_10087835 3300025938 Bacteria 2032
168 Ga0207704_11758311 3300025938 Unclassified 533
169 Ga0207665_10035492 3300025939 Bacteria 3310
170 Ga0207665_10087647 3300025939 Bacteria 2152
171 Ga0207665_10091074 3300025939 Bacteria 2114
172 Ga0207665_11536897 3300025939 Bacteria 528
173 Ga0207691_10496844 3300025940 Bacteria 1036
174 Ga0207711_11101962 3300025941 Bacteria 735
175 Ga0207661_10283978 3300025944 Bacteria 1480
176 Ga0207679_11891465 3300025945 Bacteria 544
177 Ga0207667_10659871 3300025949 Bacteria 1051
178 Ga0207712_10313907 3300025961 Bacteria 1291
179 Ga0207668_10141730 3300025972 Bacteria 1850
180 Ga0207640_11460697 3300025981 Bacteria 614
181 Ga0207677_12260220 3300026023 Bacteria 506
182 Ga0207703_10374016 3300026035 Unclassified 1317
183 Ga0207639_11399622 3300026041 Bacteria 656
184 Ga0207708_10188806 3300026075 Bacteria 1639
185 Ga0207648_10103679 3300026089 Bacteria 2494
186 Ga0207675_100685479 3300026118 Bacteria 1033
187 Ga0207675_101254756 3300026118 Bacteria 761
188 Ga0207675_101728987 3300026118 Bacteria 645
189 Ga0207683_11463785 3300026121 Bacteria 631
190 Ga0207428_10638684 3300027907 Bacteria 765
191 Ga0268264_10374688 3300028381 Unclassified 1361
192 Ga0265338_10071131 3300028800 Bacteria 2978
193 Ga0265327_10089308 3300031251 Bacteria 1505
194 Ga0265342_10305952 3300031712 Bacteria 836
195 Ga0307405_10204724 3300031731 Bacteria 1436
196 Ga0307405_11621970 3300031731 Unclassified 571
197 Ga0307413_11306101 3300031824 Unclassified 635
198 Ga0307413_11540466 3300031824 Bacteria 589
199 Ga0307406_10355679 3300031901 Bacteria 1146
200 Ga0307409_101493564 3300031995 Bacteria 703
201 Ga0307409_101658701 3300031995 Bacteria 668
202 Ga0307416_100350424 3300032002 Bacteria 1494
203 Ga0307416_100752495 3300032002 Bacteria 1067
204 Ga0307416_100832122 3300032002 Bacteria 1020
205 Ga0307416_102091659 3300032002 Bacteria 668
206 Ga0307411_10792485 3300032005 Bacteria 834
207 Ga0307411_11176377 3300032005 Unclassified 694
208 Ga0307415_102072036 3300032126 Bacteria 555
209 Ga0373934_0175566 3300035086 Bacteria 880
210 Ga0373944_0313026 3300035089 Bacteria 591
211 Ga0373953_0332360 3300035117 Unclassified 665
212 Ga0373956_0092328 3300035119 Bacteria 1397
213 Ga0373943_0037776 3300035170 Bacteria 2319
214 Ga0373943_0051394 3300035170 Bacteria 2029
215 Ga0373961_0321983 3300035241 Bacteria 577
216 Ga0373924_0147869 3300035410 Bacteria 1027
217 Ga0373935_0385149 3300035692 Unclassified 1005
218 Ga0373935_1114515 3300035692 Bacteria 587
219 Ga0373947_0218427 3300035725 Bacteria 1252
220 Ga0373947_0719152 3300035725 Bacteria 681
221 Ga0373947_0937362 3300035725 Bacteria 591
222 Ga0373937_0013176 3300036401 Bacteria 7281
223 Ga0373937_0047352 3300036401 Bacteria 3934
224 Ga0373937_0845247 3300036401 Bacteria 864
225 Ga0373937_1568278 3300036401 Bacteria 606
226 Ga0373925_0014939 3300037068 Bacteria 5613
227 Ga0373925_0746501 3300037068 Bacteria 807
228 Ga0373925_1248875 3300037068 Bacteria 610
229 Ga0395899_0702915 3300037312 Bacteria 634
230 Ga0395900_0202436 3300037418 Bacteria 2008
231 Ga0395900_1481511 3300037418 Bacteria 591
232 Ga0395900_1812714 3300037418 Unclassified 521
233 Ga0395898_0022620 3300037466 Archaea 6366
234 Ga0395898_0291159 3300037466 Bacteria 1558
235 Ga0395898_0833147 3300037466 Bacteria 862
236 Ga0395905_0717906 3300037471 Bacteria 902
237 Ga0395905_0824845 3300037471 Bacteria 830
238 Ga0395905_1304474 3300037471 Unclassified 630
239 Ga0395901_0121487 3300038443 Bacteria 2745
240 Ga0395901_0179451 3300038443 Bacteria 2221
241 Ga0395901_0564788 3300038443 Bacteria 1152
242 Ga0395901_0876902 3300038443 Bacteria 881
243 Ga0395901_1063105 3300038443 Bacteria 782
244 Ga0395901_1164602 3300038443 Unclassified 738
245 Ga0436365_1624459 3300039437 Bacteria 722
246 Ga0436363_0933685 3300039450 Unclassified 736
247 Ga0439439_0000098 3300041406 Bacteria 11492
248 Ga0439461_0050642 3300041410 Bacteria 920
249 Ga0439431_0053113 3300041997 Bacteria 1054
250 Ga0439433_0001521 3300041999 Bacteria 4795
251 Ga0439442_055426 3300042002 Bacteria 838
252 Ga0439454_056180 3300042011 Bacteria 674
253 Ga0439457_098118 3300042014 Bacteria 681
254 Ga0439462_0059738 3300042015 Bacteria 1031
255 Ga0450912_013242 3300042116 Unclassified 736
256 Ga0450904_032268 3300042139 Unclassified 550
257 Ga0439446_0213903 3300042156 Bacteria 654
258 Ga0439434_0014063 3300042435 Unclassified 2380
259 Ga0439459_0062634 3300042438 Bacteria 844
260 Ga0450916_035595 3300042530 Bacteria 740
261 Ga0466963_0074831 3300044694 Bacteria 2285
262 Ga0466963_0114532 3300044694 Bacteria 1852
263 Ga0466963_1250138 3300044694 Bacteria 521
264 Ga0466964_0027455 3300044706 Bacteria 2236
265 Ga0466971_0344135 3300044719 Bacteria 721
266 Ga0466968_0148835 3300044735 Bacteria 1075
267 Ga0466958_0314244 3300045836 Bacteria 1006
268 Ga0466958_0336791 3300045836 Bacteria 970
269 Ga0466958_0429750 3300045836 Bacteria 854
270 Ga0466967_0009001 3300045976 Bacteria 7376
271 Ga0466967_1485295 3300045976 Bacteria 675
272 Ga0466967_2340811 3300045976 Unclassified 530
273 Ga0466967_2499416 3300045976 Unclassified 511
274 Ga0495592_0306467 3300046454 Bacteria 1031
275 Ga0495603_0058452 3300046455 Bacteria 2280
276 Ga0495603_0062800 3300046455 Bacteria 2192
277 Ga0495629_0044788 3300046459 Bacteria 3105
278 Ga0495629_0072768 3300046459 Bacteria 2400
279 Ga0495629_0541611 3300046459 Unclassified 782
280 Ga0495641_0018458 3300046461 Bacteria 3599
281 Ga0495641_0056111 3300046461 Bacteria 1786
282 Ga0495641_0154144 3300046461 Bacteria 1027
283 Ga0495641_0156919 3300046461 Bacteria 1017
284 Ga0495641_0472872 3300046461 Bacteria 571
285 Ga0495651_0024384 3300046462 Bacteria 4707
286 Ga0495651_0727257 3300046462 Unclassified 617
287 Ga0495653_0073306 3300046463 Unclassified 2555
288 Ga0495580_0583523 3300046472 Bacteria 740
289 Ga0495582_0051548 3300046473 Bacteria 2269
290 Ga0495582_0259220 3300046473 Unclassified 997
291 Ga0495582_0909833 3300046473 Unclassified 509
292 Ga0495664_0457785 3300046477 Bacteria 764
293 Ga0495584_0623778 3300046491 Bacteria 550
294 Ga0495608_0015683 3300046511 Bacteria 5247
295 Ga0495618_0070826 3300046514 Bacteria 2218
296 Ga0495628_0257673 3300046516 Bacteria 1301
297 Ga0495628_0546371 3300046516 Bacteria 832
298 Ga0495628_0653103 3300046516 Bacteria 747
299 Ga0495630_0831741 3300046517 Bacteria 704
300 Ga0495630_0868292 3300046517 Bacteria 688
301 Ga0495630_1033355 3300046517 Unclassified 624
302 Ga0495630_1428678 3300046517 Bacteria 520
303 Ga0495644_0308557 3300046523 Unclassified 620
304 Ga0495663_0306449 3300046525 Unclassified 573
305 Ga0495666_0215114 3300046526 Bacteria 881
306 Ga0495666_0268710 3300046526 Bacteria 775
307 Ga0495642_0251399 3300046528 Bacteria 773
308 Ga0495642_0298833 3300046528 Unclassified 705
309 Ga0495652_0201839 3300046529 Bacteria 1508
310 Ga0495652_0340891 3300046529 Bacteria 1077
311 Ga0495652_0479744 3300046529 Bacteria 866
312 Ga0495665_0111604 3300046531 Bacteria 1434
313 Ga0495665_0679848 3300046531 Bacteria 511
314 Ga0495640_0644683 3300046533 Bacteria 638
315 Ga0495587_0093734 3300046536 Bacteria 1734
316 Ga0495587_0708672 3300046536 Bacteria 551
317 Ga0495645_0484098 3300046543 Bacteria 776
318 Ga0495667_0055547 3300046559 Bacteria 2604
319 Ga0495667_0311385 3300046559 Bacteria 997
320 Ga0495667_0330017 3300046559 Bacteria 965
321 Ga0495634_0019619 3300046642 Bacteria 4803
322 Ga0495634_0462127 3300046642 Unclassified 747
323 Ga0495634_0498004 3300046642 Bacteria 714
324 Ga0495634_0713550 3300046642 Unclassified 576
325 Ga0495635_0100946 3300046663 Bacteria 1972
326 Ga0495635_0504926 3300046663 Bacteria 796
327 Ga0495635_0617761 3300046663 Bacteria 707
328 Ga0495659_0217750 3300046664 Unclassified 788
329 Ga0495657_0046021 3300046675 Unclassified 2957
330 Ga0495599_0905061 3300046678 Unclassified 500
331 Ga0495647_0038803 3300046681 Bacteria 1802
332 Ga0495658_0044484 3300046683 Bacteria 2488
333 Ga0495658_0095467 3300046683 Bacteria 1767
334 Ga0495658_0661070 3300046683 Bacteria 669
335 Ga0495658_0842441 3300046683 Unclassified 587
336 Ga0495613_0500614 3300046689 Unclassified 818
337 Ga0495613_0533706 3300046689 Bacteria 787
338 Ga0495589_0388268 3300046794 Unclassified 641
339 Ga0495600_0055314 3300046809 Bacteria 2592
340 Ga0495581_0070181 3300047315 Bacteria 2026
341 Ga0495581_0233927 3300047315 Bacteria 1075
342 Ga0495604_0457318 3300047317 Bacteria 833
343 Ga0495636_0400206 3300047318 Bacteria 654
344 Ga0495674_0035833 3300047319 Bacteria 4473
345 Ga0495674_0384046 3300047319 Bacteria 1136
346 Ga0495676_0061423 3300047321 Bacteria 2939
347 Ga0495676_0247619 3300047321 Bacteria 1217
348 Ga0495676_0480615 3300047321 Bacteria 817
349 Ga0495680_0003032 3300047322 Bacteria 16754
350 Ga0495680_0008636 3300047322 Bacteria 9249
351 Ga0495680_0622945 3300047322 Bacteria 720
352 Ga0495675_0134651 3300047444 Bacteria 1534
353 Ga0495684_0063976 3300047471 Bacteria 2796
354 Ga0495593_0029233 3300047673 Bacteria 3023
355 Ga0495602_0157065 3300048088 Bacteria 1780
356 Ga0495614_0293482 3300048089 Bacteria 750
357 Ga0496100_0448179 3300048903 Bacteria 989
358 Ga0496100_0767978 3300048903 Bacteria 754
359 Ga0496100_0933876 3300048903 Bacteria 682
360 Ga0496100_0956476 3300048903 Bacteria 673
361 Ga0496100_1496947 3300048903 Bacteria 533
362 Ga0496101_0334461 3300048904 Bacteria 1189
363 Ga0496102_0566364 3300048905 Bacteria 1059
364 Ga0496104_0015937 3300048907 Bacteria 6821
365 Ga0496104_0098489 3300048907 Bacteria 2799
366 Ga0496104_1466769 3300048907 Unclassified 585
367 Ga0496105_0017408 3300048908 Bacteria 5761
368 Ga0496105_0076660 3300048908 Bacteria 2761
369 Ga0496105_0145331 3300048908 Bacteria 1950
370 Ga0496105_0287244 3300048908 Bacteria 1325
371 Ga0496107_0936117 3300048910 Bacteria 631
372 Ga0496107_1213451 3300048910 Bacteria 542
373 Ga0496108_0604188 3300048911 Bacteria 956
374 Ga0496108_1040071 3300048911 Unclassified 698
375 Ga0496109_0535218 3300048912 Bacteria 1105
376 Ga0496109_0888714 3300048912 Bacteria 829
377 Ga0496109_1780799 3300048912 Bacteria 549
378 Ga0496110_1781062 3300048913 Bacteria 526
379 Ga0496111_0268472 3300048914 Bacteria 1266
380 Ga0496112_0089179 3300048915 Bacteria 3052
381 Ga0496112_0116900 3300048915 Bacteria 2637
382 Ga0496112_0208858 3300048915 Unclassified 1910
383 Ga0496112_0370637 3300048915 Bacteria 1373
384 Ga0496112_1769782 3300048915 Unclassified 530
385 Ga0496113_0480519 3300048916 Unclassified 998
386 Ga0496113_0514463 3300048916 Bacteria 961
387 Ga0496113_0683759 3300048916 Bacteria 820
388 Ga0496114_0156226 3300048917 Bacteria 1981
389 Ga0496115_0360467 3300048918 Bacteria 1185
390 Ga0496115_0545125 3300048918 Bacteria 928
391 Ga0496115_0895742 3300048918 Bacteria 684
392 Ga0501031_0014811 3300049568 Bacteria 5068
393 Ga0501031_0099646 3300049568 Bacteria 1896
394 Ga0501032_0007415 3300049569 Bacteria 8011
395 Ga0501032_0281512 3300049569 Unclassified 1077
396 Ga0501033_0001444 3300049570 Bacteria 21089
397 Ga0501033_0344870 3300049570 Bacteria 1044
398 Ga0501033_0359724 3300049570 Bacteria 1019
399 Ga0501034_0106195 3300049571 Bacteria 2801
400 Ga0501034_0942962 3300049571 Bacteria 749
401 Ga0501036_0025877 3300049572 Bacteria 4951
402 Ga0501036_0409690 3300049572 Bacteria 1131
403 Ga0501037_0003438 3300049573 Bacteria 11511
404 Ga0501038_0002635 3300049574 Bacteria 16779
405 Ga0501038_0227940 3300049574 Bacteria 1484
406 Ga0501038_0287010 3300049574 Bacteria 1294
407 Ga0501039_0116386 3300049575 Bacteria 2092
408 Ga0501039_0285969 3300049575 Bacteria 1296
409 Ga0501039_0690776 3300049575 Bacteria 798
410 Ga0501040_0085622 3300049576 Bacteria 2187
411 Ga0501040_0125184 3300049576 Bacteria 1805
412 Ga0501040_0133793 3300049576 Bacteria 1744
413 Ga0501041_0024099 3300049577 Bacteria 3651
414 Ga0501041_0121066 3300049577 Bacteria 1626
415 Ga0501042_0038870 3300049578 Bacteria 3379
416 Ga0501042_0043933 3300049578 Bacteria 3183
417 Ga0501043_0008035 3300049579 Bacteria 8330
418 Ga0501046_0023416 3300049580 Bacteria 5081
419 Ga0501046_1186018 3300049580 Bacteria 525
420 Ga0501048_0057582 3300049582 Bacteria 2756
421 Ga0501048_0167088 3300049582 Bacteria 1558
422 Ga0501068_0045285 3300049584 Bacteria 2650
423 Ga0501069_0018010 3300049585 Bacteria 3809
424 Ga0501070_0020141 3300049586 Bacteria 5595
425 Ga0501071_0025977 3300049587 Bacteria 4106
426 Ga0501071_0334174 3300049587 Bacteria 1152
427 Ga0501071_0601470 3300049587 Bacteria 845
428 Ga0501072_0019620 3300049588 Bacteria 5228
429 Ga0501072_0250842 3300049588 Bacteria 1409
430 Ga0501072_0418690 3300049588 Bacteria 1062
431 Ga0501073_0002406 3300049589 Bacteria 14006
432 Ga0501074_0001798 3300049590 Bacteria 14679
433 Ga0501074_0580006 3300049590 Bacteria 794
434 Ga0501075_0115853 3300049591 Bacteria 2037
435 Ga0501075_0501027 3300049591 Bacteria 926
436 Ga0501075_0949358 3300049591 Unclassified 653
437 Ga0501076_0026684 3300049592 Bacteria 4476
438 Ga0501076_0108885 3300049592 Bacteria 2238
439 Ga0501077_0013651 3300049593 Bacteria 5091
440 Ga0501077_0023485 3300049593 Bacteria 3910
441 Ga0501079_0041359 3300049741 Bacteria 3557
442 Ga0501079_0053271 3300049741 Bacteria 3121
443 Ga0501079_0193181 3300049741 Bacteria 1589
444 Ga0501080_0028363 3300049742 Bacteria 5207
445 Ga0501080_0828959 3300049742 Bacteria 810
446 Ga0501081_0024357 3300049743 Bacteria 4063
447 Ga0501081_0313029 3300049743 Bacteria 1153
448 Ga0501081_0896365 3300049743 Bacteria 669
449 Ga0501083_0019484 3300049744 Bacteria 4726
450 Ga0501035_0040402 3300049822 Bacteria 4215
451 Ga0501044_0840426 3300049823 Unclassified 795
452 Ga0501045_0068709 3300049824 Bacteria 2603
453 Ga0501045_0087869 3300049824 Bacteria 2295
454 Ga0501045_0823286 3300049824 Bacteria 683
455 Ga0501045_0849657 3300049824 Unclassified 671
456 Ga0501045_1339610 3300049824 Bacteria 520
457 nmdc:mga0yw44_173150_c1 3300050492 Bacteria 1001
458 nmdc:mga0yw44_418333_c1 3300050492 Unclassified 907
459 nmdc:mga05p37_1628893_c1 3300050507 Unclassified 634
460 nmdc:mga05p37_224820_c1 3300050507 Bacteria 2264
461 nmdc:mga05p37_966839_c1 3300050507 Bacteria 909
462 nmdc:mga08y16_178168_c1 3300050511 Bacteria 2208
463 nmdc:mga0n895_1615154_c1 3300050512 Unclassified 612
464 nmdc:mga0n895_451220_c1 3300050512 Bacteria 1298
465 nmdc:mga0rr50_469956_c1 3300050513 Bacteria 1067
466 Ga0495601_0296921 3300053077 Bacteria 1053
467 Ga0495601_0695304 3300053077 Bacteria 649
468 Ga0495612_0585053 3300053078 Bacteria 515
469 Ga0495595_0004156 3300053084 Bacteria 5813
470 Ga0495595_0279231 3300053084 Bacteria 838
471 Ga0495595_0385368 3300053084 Bacteria 709
472 Ga0495619_0133852 3300053085 Bacteria 1704
473 Ga0495619_0355496 3300053085 Bacteria 1013
474 Ga0495619_0363244 3300053085 Bacteria 1001
475 Ga0501084_0050572 3300054114 Bacteria 3478
476 Ga0501084_0197286 3300054114 Bacteria 1698
477 Ga0501084_0205138 3300054114 Bacteria 1663
478 Ga0501082_0081808 3300060353 Bacteria 2786
479 Ga0501082_0266192 3300060353 Bacteria 1492
480 Ga0501082_1454877 3300060353 Bacteria 598
481 Ga0466962_0366726 3300061719 Bacteria 718
482 Ga0466962_0666836 3300061719 Unclassified 532
483 Ga0530510_0025178 3300061734 Bacteria 4254
484 Ga0530510_0031473 3300061734 Bacteria 3814
485 Ga0530510_0644605 3300061734 Bacteria 806
486 Ga0530510_1285415 3300061734 Bacteria 561
487 Ga0105249_12962771
488 JGI25406J46586_10026101
489 Ga0070658_10030761
490 Ga0070683_100493462
491 Ga0070683_100527110
492 Ga0070680_101729845
493 Ga0070682_100824530
494 Ga0070660_100080471
495 Ga0070661_100335417
496 Ga0070692_10253728
497 Ga0070668_100380028
498 Ga0070669_100882688
499 Ga0070659_100320059
500 Ga0070659_101753330
501 Ga0070709_10318170
502 Ga0070709_10909899
503 Ga0070714_100020229
504 Ga0070714_100545095
505 Ga0070714_100583974
506 Ga0070714_101332288
507 Ga0070714_101816213
508 Ga0070714_102117171
509 Ga0070713_100290574
510 Ga0070713_100475850
511 Ga0070713_100963977
512 Ga0070713_101773159
513 Ga0070710_10371387
514 Ga0070711_100142108
515 Ga0070711_100385014
516 Ga0070711_100992421
517 Ga0070705_100410868
518 Ga0070700_100684220
519 Ga0070708_100050908
520 Ga0070708_100586490
521 Ga0070708_101221238
522 Ga0070708_102254540
523 Ga0070663_100549678
524 Ga0070681_11432156
525 Ga0068867_100442265
526 Ga0068867_100665841
527 Ga0070685_10916194
528 Ga0070706_100781903
529 Ga0070706_100789985
530 Ga0070707_100682303
531 Ga0070707_102288577
532 Ga0070698_100111351
533 Ga0070698_100301589
534 Ga0070698_101147524
535 Ga0070679_100706968
536 Ga0070679_101473206
537 Ga0070684_101593880
538 Ga0070672_101050368
539 Ga0070696_100310119
540 Ga0070696_100558718
541 Ga0070696_101523341
542 Ga0070704_101358186
543 Ga0070664_100586598
544 Ga0068854_101750717
545 Ga0068856_101629301
546 Ga0070702_100090792
547 Ga0068852_101413019
548 Ga0068864_101005967
549 Ga0068870_10245133
550 Ga0068858_100239030
551 Ga0068862_102638012
552 Ga0081455_10943114
553 Ga0081538_10020009
554 Ga0081538_10072906
555 Ga0081538_10157620
556 Ga0081539_10013226
557 Ga0070717_11055168
558 Ga0070717_11975071
559 Ga0075365_10113155
560 Ga0075365_10895310
561 Ga0070716_100063952
562 Ga0070716_100301903
563 Ga0070712_100021239
564 Ga0070712_100716590
565 Ga0075362_10603729
566 Ga0075428_100295328
567 Ga0075428_101957933
568 Ga0075433_10999048
569 Ga0075433_11821981
570 Ga0075434_100235677
571 Ga0075434_100657169
572 Ga0075429_100667481
573 Ga0068865_101293743
574 Ga0111539_10178544
575 Ga0111539_10715225
576 Ga0111539_13138094
577 Ga0105245_12887429
578 Ga0105245_13072207
579 Ga0114129_10065451
580 Ga0114129_10844314
581 Ga0114129_11277109
582 Ga0114129_12104144
583 Ga0105243_12036746
584 Ga0105243_12292522
585 Ga0105243_12553740
586 Ga0105242_10086130
587 Ga0105248_11620257
588 Ga0105237_12005791
589 Ga0105238_10825289
590 Ga0105238_12628506
591 Ga0105249_10452338
592 Ga0105239_11130793
593 Ga0105246_12411143
594 Ga0157373_10948842
595 Ga0157371_10850279
596 Ga0157371_10967784
597 Ga0157369_10357719
598 Ga0157369_10409257
599 Ga0157378_11435518
600 Ga0163162_10289848
601 Ga0157372_11788636
602 Ga0157372_12128677
603 Ga0157375_10782622
604 Ga0157375_11207150
605 Ga0163163_12509458
606 Ga0163163_12575511
607 Ga0157380_13072535
608 Ga0206354_10789524
609 Ga0206353_11739424
610 Ga0207692_10220878
611 Ga0207642_10268502
612 Ga0207642_10639076
613 Ga0207680_11325968
614 Ga0207685_10367205
615 Ga0207699_11007089
616 Ga0207705_10069982
617 Ga0207705_10987588
618 Ga0207684_10992423
619 Ga0207684_11147780
620 Ga0207684_11570947
621 Ga0207707_11219031
622 Ga0207693_10044177
623 Ga0207693_10080149
624 Ga0207693_10134090
625 Ga0207693_10186609
626 Ga0207693_10396232
627 Ga0207693_10782126
628 Ga0207663_10184851
629 Ga0207663_10229502
630 Ga0207663_10264333
631 Ga0207663_10687249
632 Ga0207663_11205446
633 Ga0207663_11534002
634 Ga0207657_10004128
635 Ga0207649_10375704
636 Ga0207646_10840792
637 Ga0207687_11482484
638 Ga0207700_10248632
639 Ga0207700_10870482
640 Ga0207700_11127908
641 Ga0207700_11548718
642 Ga0207664_10093672
643 Ga0207664_10366123
644 Ga0207664_10507269
645 Ga0207664_11508492
646 Ga0207664_11653966
647 Ga0207664_11705250
648 Ga0207644_10037663
649 Ga0207644_11280707
650 Ga0207690_11506994
651 Ga0207686_10702511
652 Ga0207669_10914406
653 Ga0207704_10087835
654 Ga0207704_11758311
655 Ga0207665_10035492
656 Ga0207665_10087647
657 Ga0207665_10091074
658 Ga0207665_11536897
659 Ga0207691_10496844
660 Ga0207711_11101962
661 Ga0207661_10283978
662 Ga0207679_11891465
663 Ga0207667_10659871
664 Ga0207712_10313907
665 Ga0207668_10141730
666 Ga0207640_11460697
667 Ga0207677_12260220
668 Ga0207703_10374016
669 Ga0207639_11399622
670 Ga0207708_10188806
671 Ga0207648_10103679
672 Ga0207675_100685479
673 Ga0207675_101254756
674 Ga0207675_101728987
675 Ga0207683_11463785
676 Ga0207428_10638684
677 Ga0268264_10374688
678 Ga0265338_10071131
679 Ga0265327_10089308
680 Ga0265342_10305952
681 Ga0307405_10204724
682 Ga0307405_11621970
683 Ga0307413_11306101
684 Ga0307413_11540466
685 Ga0307406_10355679
686 Ga0307409_101493564
687 Ga0307409_101658701
688 Ga0307416_100350424
689 Ga0307416_100752495
690 Ga0307416_100832122
691 Ga0307416_102091659
692 Ga0307411_10792485
693 Ga0307411_11176377
694 Ga0307415_102072036
695 Ga0373934_0175566
696 Ga0373944_0313026
697 Ga0373953_0332360
698 Ga0373956_0092328
699 Ga0373943_0037776
700 Ga0373943_0051394
701 Ga0373961_0321983
702 Ga0373924_0147869
703 Ga0373935_0385149
704 Ga0373935_1114515
705 Ga0373947_0218427
706 Ga0373947_0719152
707 Ga0373947_0937362
708 Ga0373937_0013176
709 Ga0373937_0047352
710 Ga0373937_0845247
711 Ga0373937_1568278
712 Ga0373925_0014939
713 Ga0373925_0746501
714 Ga0373925_1248875
715 Ga0395899_0702915
716 Ga0395900_0202436
717 Ga0395900_1481511
718 Ga0395900_1812714
719 Ga0395898_0022620
720 Ga0395898_0291159
721 Ga0395898_0833147
722 Ga0395905_0717906
723 Ga0395905_0824845
724 Ga0395905_1304474
725 Ga0395901_0121487
726 Ga0395901_0179451
727 Ga0395901_0564788
728 Ga0395901_0876902
729 Ga0395901_1063105
730 Ga0395901_1164602
731 Ga0436365_1624459
732 Ga0436363_0933685
733 Ga0439439_0000098
734 Ga0439461_0050642
735 Ga0439431_0053113
736 Ga0439433_0001521
737 Ga0439442_055426
738 Ga0439454_056180
739 Ga0439457_098118
740 Ga0439462_0059738
741 Ga0450912_013242
742 Ga0450904_032268
743 Ga0439446_0213903
744 Ga0439434_0014063
745 Ga0439459_0062634
746 Ga0450916_035595
747 Ga0466963_0074831
748 Ga0466963_0114532
749 Ga0466963_1250138
750 Ga0466964_0027455
751 Ga0466971_0344135
752 Ga0466968_0148835
753 Ga0466958_0314244
754 Ga0466958_0336791
755 Ga0466958_0429750
756 Ga0466967_0009001
757 Ga0466967_1485295
758 Ga0466967_2340811
759 Ga0466967_2499416
760 Ga0495592_0306467
761 Ga0495603_0058452
762 Ga0495603_0062800
763 Ga0495629_0044788
764 Ga0495629_0072768
765 Ga0495629_0541611
766 Ga0495641_0018458
767 Ga0495641_0056111
768 Ga0495641_0154144
769 Ga0495641_0156919
770 Ga0495641_0472872
771 Ga0495651_0024384
772 Ga0495651_0727257
773 Ga0495653_0073306
774 Ga0495580_0583523
775 Ga0495582_0051548
776 Ga0495582_0259220
777 Ga0495582_0909833
778 Ga0495664_0457785
779 Ga0495584_0623778
780 Ga0495608_0015683
781 Ga0495618_0070826
782 Ga0495628_0257673
783 Ga0495628_0546371
784 Ga0495628_0653103
785 Ga0495630_0831741
786 Ga0495630_0868292
787 Ga0495630_1033355
788 Ga0495630_1428678
789 Ga0495644_0308557
790 Ga0495663_0306449
791 Ga0495666_0215114
792 Ga0495666_0268710
793 Ga0495642_0251399
794 Ga0495642_0298833
795 Ga0495652_0201839
796 Ga0495652_0340891
797 Ga0495652_0479744
798 Ga0495665_0111604
799 Ga0495665_0679848
800 Ga0495640_0644683
801 Ga0495587_0093734
802 Ga0495587_0708672
803 Ga0495645_0484098
804 Ga0495667_0055547
805 Ga0495667_0311385
806 Ga0495667_0330017
807 Ga0495634_0019619
808 Ga0495634_0462127
809 Ga0495634_0498004
810 Ga0495634_0713550
811 Ga0495635_0100946
812 Ga0495635_0504926
813 Ga0495635_0617761
814 Ga0495659_0217750
815 Ga0495657_0046021
816 Ga0495599_0905061
817 Ga0495647_0038803
818 Ga0495658_0044484
819 Ga0495658_0095467
820 Ga0495658_0661070
821 Ga0495658_0842441
822 Ga0495613_0500614
823 Ga0495613_0533706
824 Ga0495589_0388268
825 Ga0495600_0055314
826 Ga0495581_0070181
827 Ga0495581_0233927
828 Ga0495604_0457318
829 Ga0495636_0400206
830 Ga0495674_0035833
831 Ga0495674_0384046
832 Ga0495676_0061423
833 Ga0495676_0247619
834 Ga0495676_0480615
835 Ga0495680_0003032
836 Ga0495680_0008636
837 Ga0495680_0622945
838 Ga0495675_0134651
839 Ga0495684_0063976
840 Ga0495593_0029233
841 Ga0495602_0157065
842 Ga0495614_0293482
843 Ga0496100_0448179
844 Ga0496100_0767978
845 Ga0496100_0933876
846 Ga0496100_0956476
847 Ga0496100_1496947
848 Ga0496101_0334461
849 Ga0496102_0566364
850 Ga0496104_0015937
851 Ga0496104_0098489
852 Ga0496104_1466769
853 Ga0496105_0017408
854 Ga0496105_0076660
855 Ga0496105_0145331
856 Ga0496105_0287244
857 Ga0496107_0936117
858 Ga0496107_1213451
859 Ga0496108_0604188
860 Ga0496108_1040071
861 Ga0496109_0535218
862 Ga0496109_0888714
863 Ga0496109_1780799
864 Ga0496110_1781062
865 Ga0496111_0268472
866 Ga0496112_0089179
867 Ga0496112_0116900
868 Ga0496112_0208858
869 Ga0496112_0370637
870 Ga0496112_1769782
871 Ga0496113_0480519
872 Ga0496113_0514463
873 Ga0496113_0683759
874 Ga0496114_0156226
875 Ga0496115_0360467
876 Ga0496115_0545125
877 Ga0496115_0895742
878 Ga0501031_0014811
879 Ga0501031_0099646
880 Ga0501032_0007415
881 Ga0501032_0281512
882 Ga0501033_0001444
883 Ga0501033_0344870
884 Ga0501033_0359724
885 Ga0501034_0106195
886 Ga0501034_0942962
887 Ga0501036_0025877
888 Ga0501036_0409690
889 Ga0501037_0003438
890 Ga0501038_0002635
891 Ga0501038_0227940
892 Ga0501038_0287010
893 Ga0501039_0116386
894 Ga0501039_0285969
895 Ga0501039_0690776
896 Ga0501040_0085622
897 Ga0501040_0125184
898 Ga0501040_0133793
899 Ga0501041_0024099
900 Ga0501041_0121066
901 Ga0501042_0038870
902 Ga0501042_0043933
903 Ga0501043_0008035
904 Ga0501046_0023416
905 Ga0501046_1186018
906 Ga0501048_0057582
907 Ga0501048_0167088
908 Ga0501068_0045285
909 Ga0501069_0018010
910 Ga0501070_0020141
911 Ga0501071_0025977
912 Ga0501071_0334174
913 Ga0501071_0601470
914 Ga0501072_0019620
915 Ga0501072_0250842
916 Ga0501072_0418690
917 Ga0501073_0002406
918 Ga0501074_0001798
919 Ga0501074_0580006
920 Ga0501075_0115853
921 Ga0501075_0501027
922 Ga0501075_0949358
923 Ga0501076_0026684
924 Ga0501076_0108885
925 Ga0501077_0013651
926 Ga0501077_0023485
927 Ga0501079_0041359
928 Ga0501079_0053271
929 Ga0501079_0193181
930 Ga0501080_0028363
931 Ga0501080_0828959
932 Ga0501081_0024357
933 Ga0501081_0313029
934 Ga0501081_0896365
935 Ga0501083_0019484
936 Ga0501035_0040402
937 Ga0501044_0840426
938 Ga0501045_0068709
939 Ga0501045_0087869
940 Ga0501045_0823286
941 Ga0501045_0849657
942 Ga0501045_1339610
943 nmdc:mga0yw44_173150_c1
944 nmdc:mga0yw44_418333_c1
945 nmdc:mga05p37_1628893_c1
946 nmdc:mga05p37_224820_c1
947 nmdc:mga05p37_966839_c1
948 nmdc:mga08y16_178168_c1
949 nmdc:mga0n895_1615154_c1
950 nmdc:mga0n895_451220_c1
951 nmdc:mga0rr50_469956_c1
952 Ga0495601_0296921
953 Ga0495601_0695304
954 Ga0495612_0585053
955 Ga0495595_0004156
956 Ga0495595_0279231
957 Ga0495595_0385368
958 Ga0495619_0133852
959 Ga0495619_0355496
960 Ga0495619_0363244
961 Ga0501084_0050572
962 Ga0501084_0197286
963 Ga0501084_0205138
964 Ga0501082_0081808
965 Ga0501082_0266192
966 Ga0501082_1454877
967 Ga0466962_0366726
968 Ga0466962_0666836
969 Ga0530510_0025178
970 Ga0530510_0031473
971 Ga0530510_0644605
972 Ga0530510_1285415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

16

79

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9615 3 68
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.9511 4 69
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9477 3 68
2ux9-assembly1.cif.gz_C crystal structure of the t. thermophilus dodecin r65a mutant 0.9459 4 70
2vyx-assembly1.cif.gz_F crystal structure of the t. thermophilus dodecin w38f mutant 0.9442 4 69
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9266 5 67 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8995 5 67 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8873 1 70 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8763 5 71 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8757 1 70 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A537VDW4-F1-model_v4 Dodecin domain-containing protein 0.998 5 67
AF-A0A7W9DVU8-F1-model_v4 deleted 0.9963 14 65
AF-A0A6A0QW26-F1-model_v4 Dodecin domain-containing protein 0.9939 5 67
AF-A0A7Y3G0C6-F1-model_v4 Dodecin domain-containing protein 0.9936 5 60
AF-A0A1I4Y463-F1-model_v4 Dodecin domain-containing protein 0.9923 4 67

Map