F453256

General Info

Members Datasets Scaffolds Average Seq Length
486 335 972 241

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10046501|Ga0105237_100465012
Length 266
Sequence MIGVIVSSSQAIAGQPRSASMILRQFLHSDPVGISYLFGCGGKATAAVVDPVGDIQPYLQAAATSGMQIHFVIDTHVHADHLSAGRALAAAAGAEYVLSAEAAVTFPFRGVRDGDLLPLGNVTAKVLHTPGHTPEHICLLVTDRTRTEEPWFVVTGHTLMAGDLGRTELAVSAEDGARQLFRSAQRLKGLPDYVEVMPGAYAGSVCGRRLSGKPWSTVGFEKRNNQALMIEDEAEFVRFMVAEIPPAPPEAARIRAVNSGVTAAAA

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
222 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
223 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
224 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
225 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
226 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
227 2643221618 Ensifer sp. Root231 Isolate Unclassified
228 2643221655 Ensifer sp. Root1252 Isolate Unclassified
229 2643221712 Ensifer sp. Root258 Isolate Unclassified
230 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
231 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
232 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
233 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
234 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
235 2791355199
236 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
237 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
238 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
239 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
240 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
241 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
242 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
243 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
244 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
245 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
246 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
247 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
248 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
249 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
250 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
251 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
252 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
253 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
254 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
255 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
256 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
257 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
258 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
259 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
260 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
261 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
262 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
263 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
264 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
265 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
266 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
267 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
268 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
269 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
270 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
271 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
272 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
273 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
274 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
275 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
276 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
277 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
278 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
279 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
280 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
281 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
282 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
283 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
284 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
285 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
286 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
287 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
288 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
289 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
290 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
291 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
292 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
293 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
294 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
295 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
296 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
297 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
298 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
299 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
300 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
301 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
302 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
303 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
304 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
305 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
306 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
307 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
308 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
309 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
310 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
311 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
312 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
313 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
314 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
315 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
316 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
317 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
318 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
319 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
320 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
321 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
322 3004167301 Mesorhizobium loti 582 Isolate Unclassified
323 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
324 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
325 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
326 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
327 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
328 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
329 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
330 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
331 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
332 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
333 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
334 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
335 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.88
Metatranscriptomes 0.41
Isolates 23.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.2
Nodule 19.75
Rhizoplane 2.47
Rhizosphere 64.2
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10046501 3300009545 Bacteria 4365
2 JGI24735J21928_10069745 3300002067 Bacteria 1007
3 JGI24751J29686_10059061 3300002459 Unclassified 790
4 rootL2_10206878 3300003322 Bacteria 1672
5 JGI25404J52841_10011695 3300003659 Bacteria 1895
6 Ga0065712_10158890 3300005290 Bacteria 1314
7 Ga0070658_10023152 3300005327 Bacteria 4987
8 Ga0070658_10103586 3300005327 Bacteria 2354
9 Ga0070683_100152152 3300005329 Bacteria 2193
10 Ga0070670_100150682 3300005331 Bacteria 2013
11 Ga0068869_100012094 3300005334 Bacteria 5690
12 Ga0070680_100003964 3300005336 Bacteria 11074
13 Ga0070680_100327480 3300005336 Bacteria 1301
14 Ga0070660_100006404 3300005339 Bacteria 8160
15 Ga0070689_100609220 3300005340 Bacteria 946
16 Ga0070692_10330961 3300005345 Bacteria 940
17 Ga0070675_100000721 3300005354 Bacteria 23013
18 Ga0070675_100158559 3300005354 Bacteria 1945
19 Ga0070659_100174763 3300005366 Bacteria 1761
20 Ga0070709_10283298 3300005434 Bacteria 1205
21 Ga0070714_100432619 3300005435 Bacteria 1248
22 Ga0070713_100181411 3300005436 Bacteria 1892
23 Ga0070713_100508364 3300005436 Bacteria 1137
24 Ga0070711_100573331 3300005439 Unclassified 939
25 Ga0070708_100079380 3300005445 Bacteria 2969
26 Ga0070663_100057193 3300005455 Bacteria 2797
27 Ga0070681_10082713 3300005458 Bacteria 3165
28 Ga0070681_10102112 3300005458 Bacteria 2813
29 Ga0070681_10140600 3300005458 Bacteria 2344
30 Ga0068867_100126356 3300005459 Bacteria 1982
31 Ga0070706_100189006 3300005467 Bacteria 1925
32 Ga0070707_100075378 3300005468 Bacteria 3254
33 Ga0070707_100328475 3300005468 Unclassified 1486
34 Ga0070699_100171298 3300005518 Archaea 1924
35 Ga0070679_100340005 3300005530 Bacteria 1449
36 Ga0070697_100071499 3300005536 Bacteria 2846
37 Ga0070697_100098853 3300005536 Bacteria 2422
38 Ga0070697_100116763 3300005536 Bacteria 2229
39 Ga0068853_100162167 3300005539 Bacteria 2018
40 Ga0068853_100308637 3300005539 Bacteria 1464
41 Ga0068855_100025995 3300005563 Bacteria 7004
42 Ga0068855_100075675 3300005563 Bacteria 3908
43 Ga0068855_100285389 3300005563 Bacteria 1832
44 Ga0068855_100446814 3300005563 Bacteria 1411
45 Ga0070664_100031282 3300005564 Bacteria 4445
46 Ga0070664_100603550 3300005564 Bacteria 1018
47 Ga0068857_100020561 3300005577 Bacteria 5807
48 Ga0068857_100032129 3300005577 Bacteria 4640
49 Ga0068857_100089151 3300005577 Bacteria 2760
50 Ga0068857_100407581 3300005577 Bacteria 1266
51 Ga0068854_100170510 3300005578 Unclassified 1693
52 Ga0068856_100021977 3300005614 Bacteria 6202
53 Ga0068856_100121387 3300005614 Bacteria 2615
54 Ga0068856_100292840 3300005614 Bacteria 1645
55 Ga0068856_100357186 3300005614 Bacteria 1480
56 Ga0068852_100005037 3300005616 Bacteria 9393
57 Ga0068852_100467015 3300005616 Bacteria 1252
58 Ga0068864_100019551 3300005618 Bacteria 5665
59 Ga0068864_100027816 3300005618 Bacteria 4778
60 Ga0068861_100489038 3300005719 Bacteria 1110
61 Ga0068851_10040774 3300005834 Bacteria 2334
62 Ga0068870_10007113 3300005840 Bacteria 4976
63 Ga0068858_100055997 3300005842 Bacteria 3645
64 Ga0068858_100497643 3300005842 Unclassified 1177
65 Ga0068860_100527337 3300005843 Bacteria 1181
66 Ga0068860_100601179 3300005843 Bacteria 1105
67 Ga0081455_10003129 3300005937 Bacteria 19259
68 Ga0081455_10074270 3300005937 Bacteria 2808
69 Ga0081455_10131468 3300005937 Bacteria 1957
70 Ga0081540_1010671 3300005983 Bacteria 6197
71 Ga0081539_10024293 3300005985 Bacteria 3937
72 Ga0070717_10008498 3300006028 Bacteria 7668
73 Ga0070717_10144202 3300006028 Bacteria 2056
74 Ga0070717_10272334 3300006028 Bacteria 1500
75 Ga0075365_10053213 3300006038 Bacteria 2680
76 Ga0075363_100013679 3300006048 Bacteria 3944
77 Ga0075364_10004651 3300006051 Bacteria 7916
78 Ga0070716_100086650 3300006173 Bacteria 1884
79 Ga0070716_100142191 3300006173 Bacteria 1532
80 Ga0070712_100069543 3300006175 Bacteria 2512
81 Ga0075362_10008798 3300006177 Bacteria 3878
82 Ga0075362_10065081 3300006177 Bacteria 1655
83 Ga0075362_10125805 3300006177 Bacteria 1216
84 Ga0075367_10015868 3300006178 Bacteria 4104
85 Ga0075367_10049974 3300006178 Bacteria 2467
86 Ga0075369_10010192 3300006186 Bacteria 3673
87 Ga0075366_10004696 3300006195 Bacteria 7350
88 Ga0075430_100039067 3300006846 Bacteria 4019
89 Ga0075430_100719538 3300006846 Bacteria 823
90 Ga0075431_100011300 3300006847 Bacteria 8994
91 Ga0075431_100114029 3300006847 Bacteria 2790
92 Ga0075433_10072233 3300006852 Bacteria 3034
93 Ga0075433_10136589 3300006852 Unclassified 2180
94 Ga0075433_10515157 3300006852 Unclassified 1052
95 Ga0075433_10557350 3300006852 Bacteria 1007
96 Ga0075433_10572212 3300006852 Bacteria 992
97 Ga0075434_100000461 3300006871 Bacteria 30401
98 Ga0075434_100000803 3300006871 Bacteria 24864
99 Ga0075434_100008151 3300006871 Bacteria 9716
100 Ga0075434_100023991 3300006871 Bacteria 5956
101 Ga0075436_100000446 3300006914 Bacteria 26474
102 Ga0075436_100041970 3300006914 Bacteria 3155
103 Ga0075436_100070471 3300006914 Bacteria 2417
104 Ga0075436_100108168 3300006914 Unclassified 1939
105 Ga0075436_100128504 3300006914 Bacteria 1776
106 Ga0075436_100135830 3300006914 Bacteria 1727
107 Ga0099823_1050473 3300006944 Bacteria 2560
108 Ga0075435_100000005 3300007076 Bacteria 121698
109 Ga0075435_100005397 3300007076 Bacteria 8913
110 Ga0075435_100016593 3300007076 Bacteria 5554
111 Ga0075435_100104292 3300007076 Unclassified 2352
112 Ga0075435_100169850 3300007076 Unclassified 1839
113 Ga0099794_10002248 3300007265 Bacteria 7073
114 Ga0099794_10002770 3300007265 Bacteria 6546
115 Ga0099794_10066033 3300007265 Bacteria 1765
116 Ga0099794_10088383 3300007265 Bacteria 1536
117 Ga0105240_10013094 3300009093 Bacteria 11415
118 Ga0105240_10014969 3300009093 Bacteria 10568
119 Ga0111539_10099735 3300009094 Bacteria 3410
120 Ga0111539_10160124 3300009094 Bacteria 2633
121 Ga0105245_10088252 3300009098 Bacteria 2848
122 Ga0114129_10031256 3300009147 Bacteria 7529
123 Ga0114129_10074960 3300009147 Bacteria 4712
124 Ga0114129_10089524 3300009147 Bacteria 4266
125 Ga0114129_10092490 3300009147 Bacteria 4190
126 Ga0114129_10371613 3300009147 Bacteria 1890
127 Ga0105243_10141751 3300009148 Bacteria 2051
128 Ga0105241_10168059 3300009174 Bacteria 1809
129 Ga0105241_10774465 3300009174 Bacteria 882
130 Ga0105241_11161784 3300009174 Bacteria 729
131 Ga0105242_10439953 3300009176 Bacteria 1226
132 Ga0105248_10325890 3300009177 Bacteria 1730
133 Ga0105237_10009752 3300009545 Bacteria 10272
134 Ga0105237_10242193 3300009545 Bacteria 1805
135 Ga0105238_10032387 3300009551 Bacteria 5320
136 Ga0105238_10055364 3300009551 Bacteria 3982
137 Ga0105239_10021383 3300010375 Bacteria 7133
138 Ga0105239_10103618 3300010375 Bacteria 3149
139 Ga0105239_10489919 3300010375 Bacteria 1397
140 Ga0157371_10304611 3300013102 Bacteria 1154
141 Ga0157370_10023609 3300013104 Bacteria 6104
142 Ga0157370_10189799 3300013104 Bacteria 1908
143 Ga0157370_10334820 3300013104 Bacteria 1395
144 Ga0157369_10020470 3300013105 Bacteria 7395
145 Ga0157369_10024932 3300013105 Bacteria 6646
146 Ga0163162_10051591 3300013306 Bacteria 4128
147 Ga0157372_10066539 3300013307 Bacteria 4048
148 Ga0157372_10121813 3300013307 Bacteria 2997
149 Ga0157372_10398326 3300013307 Bacteria 1604
150 Ga0157372_10532439 3300013307 Bacteria 1369
151 Ga0157375_10348994 3300013308 Bacteria 1646
152 Ga0163163_10010313 3300014325 Bacteria 8399
153 Ga0163163_10814946 3300014325 Bacteria 997
154 Ga0157379_10005726 3300014968 Bacteria 10687
155 Ga0157376_10163805 3300014969 Bacteria 2018
156 Ga0206353_11053305 3300020082 Bacteria 1021
157 Ga0224712_10004423 3300022467 Bacteria 3790
158 Ga0209677_101589 3300025253 Bacteria 9606
159 Ga0209233_1003404 3300025261 Bacteria 5611
160 Ga0209130_1000389 3300025284 Bacteria 48487
161 Ga0209025_1037885 3300025294 Bacteria 2131
162 Ga0209758_1007011 3300025297 Bacteria 7836
163 Ga0207426_1000361 3300025302 Bacteria 81889
164 Ga0207697_10178331 3300025315 Bacteria 931
165 Ga0207647_10052638 3300025904 Bacteria 2512
166 Ga0207699_10216811 3300025906 Bacteria 1304
167 Ga0207643_10008835 3300025908 Bacteria 5407
168 Ga0207684_10307529 3300025910 Bacteria 1366
169 Ga0207707_10011082 3300025912 Bacteria 7839
170 Ga0207707_10170214 3300025912 Bacteria 1904
171 Ga0207695_10011773 3300025913 Bacteria 10568
172 Ga0207695_10116756 3300025913 Bacteria 2642
173 Ga0207671_10099307 3300025914 Bacteria 2203
174 Ga0207693_10077646 3300025915 Bacteria 2600
175 Ga0207693_10089082 3300025915 Bacteria 2418
176 Ga0207693_10306754 3300025915 Bacteria 1243
177 Ga0207663_10014863 3300025916 Bacteria 4278
178 Ga0207663_10646761 3300025916 Archaea 834
179 Ga0207660_10085632 3300025917 Bacteria 2325
180 Ga0207660_10306189 3300025917 Bacteria 1266
181 Ga0207657_10007619 3300025919 Bacteria 11079
182 Ga0207649_10225981 3300025920 Bacteria 1336
183 Ga0207652_10040056 3300025921 Bacteria 3978
184 Ga0207652_10133437 3300025921 Bacteria 2216
185 Ga0207694_10050544 3300025924 Bacteria 3220
186 Ga0207694_10758681 3300025924 Bacteria 819
187 Ga0207659_10019272 3300025926 Bacteria 4487
188 Ga0207687_10343127 3300025927 Bacteria 1215
189 Ga0207700_10073674 3300025928 Bacteria 2638
190 Ga0207700_10185356 3300025928 Bacteria 1745
191 Ga0207700_10386851 3300025928 Bacteria 1224
192 Ga0207700_10572372 3300025928 Unclassified 1004
193 Ga0207700_10577143 3300025928 Bacteria 1000
194 Ga0207664_10109704 3300025929 Archaea 2293
195 Ga0207690_10610554 3300025932 Bacteria 891
196 Ga0207665_10121559 3300025939 Bacteria 1845
197 Ga0207661_10090625 3300025944 Bacteria 2546
198 Ga0207679_10030656 3300025945 Bacteria 3757
199 Ga0207667_10163434 3300025949 Bacteria 2289
200 Ga0207667_10906862 3300025949 Unclassified 873
201 Ga0207640_10153377 3300025981 Bacteria 1695
202 Ga0207640_10206145 3300025981 Unclassified 1494
203 Ga0207639_10143789 3300026041 Bacteria 1990
204 Ga0207678_10122997 3300026067 Bacteria 2214
205 Ga0207678_10414147 3300026067 Bacteria 1168
206 Ga0207702_10010239 3300026078 Bacteria 7852
207 Ga0207702_10121982 3300026078 Bacteria 2334
208 Ga0207702_10196803 3300026078 Unclassified 1866
209 Ga0207702_10278073 3300026078 Bacteria 1581
210 Ga0207676_10032977 3300026095 Bacteria 3909
211 Ga0207676_10036900 3300026095 Bacteria 3720
212 Ga0207674_10019996 3300026116 Bacteria 7245
213 Ga0207674_10074023 3300026116 Bacteria 3419
214 Ga0207674_10142456 3300026116 Bacteria 2356
215 Ga0207674_10148806 3300026116 Bacteria 2299
216 Ga0207674_10165403 3300026116 Bacteria 2166
217 Ga0207698_10042532 3300026142 Bacteria 3395
218 Ga0209389_1000008 3300027296 Bacteria 227385
219 Ga0209489_107658 3300027361 Bacteria 15767
220 Ga0209700_100062 3300027363 Bacteria 145471
221 Ga0209588_1001636 3300027671 Bacteria 5889
222 Ga0207428_10191844 3300027907 Bacteria 1540
223 Ga0268265_10119653 3300028380 Unclassified 2167
224 Ga0307408_100059933 3300031548 Bacteria 2772
225 Ga0307516_10003967 3300031730 Bacteria 18582
226 Ga0307516_10007143 3300031730 Bacteria 12893
227 Ga0307412_10037044 3300031911 Bacteria 3131
228 Ga0307412_10093040 3300031911 Bacteria 2114
229 Ga0307416_100054594 3300032002 Bacteria 3213
230 Ga0307416_101334056 3300032002 Bacteria 823
231 Ga0307510_10023482 3300033180 Bacteria 7148
232 Ga0373939_0016872 3300035114 Bacteria 1931
233 Ga0373945_0166617 3300035116 Bacteria 901
234 Ga0373925_0174697 3300037068 Bacteria 1697
235 Ga0395899_0002829 3300037312 Bacteria 13975
236 Ga0395898_0284621 3300037466 Bacteria 1577
237 Ga0395905_0025238 3300037471 Bacteria 5605
238 Ga0436364_0570165 3300037853 Bacteria 2306
239 Ga0395901_0017748 3300038443 Bacteria 7263
240 Ga0395901_0332350 3300038443 Bacteria 1571
241 Ga0395901_0577460 3300038443 Bacteria 1136
242 Ga0395901_0617185 3300038443 Bacteria 1092
243 Ga0436363_0163759 3300039450 Bacteria 8911
244 Ga0439465_0055158 3300041413 Bacteria 1308
245 Ga0439432_057747 3300042006 Bacteria 1201
246 Ga0439458_0005244 3300042157 Bacteria 2917
247 Ga0439460_0014753 3300042461 Bacteria 2057
248 Ga0466971_0065937 3300044719 Bacteria 1640
249 Ga0451576_0194616 3300045051 Bacteria 2118
250 Ga0451576_0493812 3300045051 Bacteria 1286
251 Ga0466967_0081961 3300045976 Bacteria 2915
252 Ga0466967_0697162 3300045976 Bacteria 1006
253 Ga0495629_0056647 3300046459 Bacteria 2740
254 Ga0495638_0001017 3300046460 Bacteria 27889
255 Ga0495582_0209286 3300046473 Unclassified 1115
256 Ga0495605_0056883 3300046474 Bacteria 1885
257 Ga0495610_0053134 3300046512 Bacteria 1964
258 Ga0495618_0011812 3300046514 Bacteria 5299
259 Ga0495618_0049156 3300046514 Bacteria 2663
260 Ga0495620_0022642 3300046515 Bacteria 3021
261 Ga0495628_0028485 3300046516 Bacteria 4537
262 Ga0495665_0035299 3300046531 Bacteria 2671
263 Ga0495640_0059006 3300046533 Bacteria 2615
264 Ga0495645_0127035 3300046543 Bacteria 1791
265 Ga0495656_0056552 3300046615 Bacteria 1696
266 Ga0495668_0046097 3300046616 Bacteria 2422
267 Ga0495634_0041113 3300046642 Bacteria 3140
268 Ga0495599_0259579 3300046678 Bacteria 1056
269 Ga0495613_0137232 3300046689 Bacteria 1749
270 Ga0495581_0044031 3300047315 Bacteria 2581
271 Ga0495581_0365326 3300047315 Bacteria 842
272 Ga0495604_0052480 3300047317 Bacteria 3157
273 Ga0495674_0045357 3300047319 Bacteria 3903
274 Ga0495674_0276173 3300047319 Bacteria 1378
275 Ga0495672_0055018 3300047320 Bacteria 2323
276 Ga0495683_0016134 3300047323 Bacteria 3879
277 Ga0495687_020678 3300047443 Bacteria 3204
278 Ga0495675_0105680 3300047444 Unclassified 1759
279 Ga0495684_0005224 3300047471 Bacteria 10118
280 Ga0495684_0191211 3300047471 Bacteria 1513
281 Ga0495684_0238786 3300047471 Bacteria 1326
282 Ga0495593_0204254 3300047673 Bacteria 993
283 Ga0495602_0214216 3300048088 Bacteria 1459
284 Ga0495626_0026160 3300048091 Bacteria 2847
285 Ga0496100_0402447 3300048903 Bacteria 1043
286 Ga0496102_0000450 3300048905 Bacteria 46831
287 Ga0496102_0289950 3300048905 Bacteria 1543
288 Ga0496104_0004777 3300048907 Bacteria 11797
289 Ga0496105_0323187 3300048908 Bacteria 1236
290 Ga0496106_0002524 3300048909 Bacteria 13636
291 Ga0496106_0113871 3300048909 Bacteria 2109
292 Ga0496111_0455312 3300048914 Bacteria 944
293 Ga0496112_0000067 3300048915 Bacteria 68767
294 Ga0496112_0113678 3300048915 Bacteria 2678
295 Ga0496112_0137411 3300048915 Bacteria 2414
296 Ga0496118_0265637 3300048921 Bacteria 965
297 Ga0496119_0131201 3300048922 Bacteria 1365
298 Ga0496120_0001808 3300048923 Bacteria 23949
299 Ga0496121_0002947 3300048924 Bacteria 24850
300 Ga0495682_0068563 3300049460 Bacteria 1277
301 Ga0501291_005925 3300049514 Bacteria 1615
302 Ga0501034_0001436 3300049571 Bacteria 31741
303 Ga0501034_0005645 3300049571 Bacteria 13614
304 Ga0501036_0021652 3300049572 Bacteria 5405
305 Ga0501038_0000257 3300049574 Bacteria 44845
306 Ga0501039_0008126 3300049575 Bacteria 7993
307 Ga0501040_0499154 3300049576 Bacteria 877
308 Ga0501043_0003577 3300049579 Bacteria 12754
309 Ga0501068_0001787 3300049584 Bacteria 11449
310 Ga0501070_0149058 3300049586 Bacteria 1930
311 Ga0501070_0269630 3300049586 Bacteria 1390
312 Ga0501073_0026869 3300049589 Bacteria 4121
313 Ga0501073_0274499 3300049589 Bacteria 1163
314 Ga0501076_0182144 3300049592 Bacteria 1713
315 Ga0501216_013889 3300049660 Bacteria 1341
316 Ga0501080_0028577 3300049742 Bacteria 5190
317 Ga0501044_0005491 3300049823 Bacteria 14084
318 Ga0501044_0074442 3300049823 Bacteria 3450
319 Ga0501044_0094485 3300049823 Bacteria 3015
320 nmdc:mga03683_3073_c1 3300050489 Bacteria 3880
321 nmdc:mga03683_56267_c1 3300050489 Bacteria 1653
322 nmdc:mga03n38_22042_c1 3300050490 Bacteria 2572
323 nmdc:mga03n38_51545_c1 3300050490 Bacteria 1838
324 nmdc:mga00v17_2444_c1 3300050491 Bacteria 9500
325 nmdc:mga00v17_489084_c1 3300050491 Bacteria 798
326 nmdc:mga0yw44_41557_c1 3300050492 Bacteria 2737
327 nmdc:mga0yw44_428695_c1 3300050492 Bacteria 896
328 nmdc:mga0yw44_6274_c1 3300050492 Bacteria 3628
329 nmdc:mga0yw44_7691_c1 3300050492 Bacteria 5320
330 nmdc:mga0k408_5991_c1 3300050493 Bacteria 6489
331 nmdc:mga06z11_35057_c1 3300050494 Bacteria 2467
332 nmdc:mga06z11_7017_c1 3300050494 Bacteria 4621
333 nmdc:mga05p37_202168_c1 3300050507 Bacteria 2405
334 nmdc:mga05p37_21619_c1 3300050507 Bacteria 7795
335 nmdc:mga05p37_305567_c1 3300050507 Bacteria 1888
336 nmdc:mga05p37_330978_c1 3300050507 Bacteria 1799
337 nmdc:mga09592_134094_c1 3300050508 Bacteria 2132
338 nmdc:mga0qj67_529252_c1 3300050509 Bacteria 946
339 nmdc:mga06r32_12577_c1 3300050510 Bacteria 7642
340 nmdc:mga08y16_723904_c1 3300050511 Bacteria 993
341 nmdc:mga0n895_17_c1 3300050512 Bacteria 97721
342 nmdc:mga0n895_18976_c1 3300050512 Bacteria 6379
343 nmdc:mga0n895_57208_c1 3300050512 Bacteria 3844
344 nmdc:mga0n895_8567_c1 3300050512 Bacteria 8866
345 nmdc:mga0n895_87291_c1 3300050512 Bacteria 3117
346 nmdc:mga0rr50_17561_c1 3300050513 Bacteria 4780
347 nmdc:mga0rr50_24_c1 3300050513 Bacteria 115213
348 nmdc:mga0rr50_286772_c1 3300050513 Unclassified 1375
349 nmdc:mga0rr50_29756_c1 3300050513 Unclassified 3857
350 nmdc:mga0rr50_3873_c1 3300050513 Bacteria 8706
351 nmdc:mga08x19_116409_c1 3300050514 Bacteria 1787
352 nmdc:mga08x19_12332_c1 3300050514 Bacteria 5148
353 nmdc:mga08x19_157636_c1 3300050514 Unclassified 1540
354 nmdc:mga08x19_445_c1 3300050514 Bacteria 28369
355 nmdc:mga08x19_519987_c1 3300050514 Bacteria 841
356 nmdc:mga08x19_63257_c1 3300050514 Bacteria 2400
357 nmdc:mga0a205_101571_c1 3300050515 Bacteria 2774
358 nmdc:mga0a205_12508_c1 3300050515 Bacteria 7854
359 nmdc:mga0a205_140637_c1 3300050515 Bacteria 2314
360 nmdc:mga0a205_324526_c1 3300050515 Bacteria 1410
361 nmdc:mga0a205_369318_c1 3300050515 Bacteria 1301
362 nmdc:mga0a205_61433_c1 3300050515 Unclassified 3629
363 nmdc:mga0sz30_5364_c1 3300050516 Bacteria 4697
364 Ga0495601_0001827 3300053077 Bacteria 11820
365 Ga0495612_0044253 3300053078 Bacteria 1821
366 Ga0500616_0089849 3300053153 Bacteria 1524
367 Ga0500627_0002469 3300053158 Bacteria 5491
368 Ga0500627_0031083 3300053158 Bacteria 2240
369 Ga0500627_0034645 3300053158 Bacteria 2141
370 Ga0500627_0068687 3300053158 Bacteria 1567
371 2509146495 2508501128 Bacteria 8613869
372 2513691580 2513237101 Bacteria 7952346
373 2514417907 2513237305 Bacteria 7293571
374 2524436624 2524023205 Bacteria 8918781
375 2599941046 2599185301 Bacteria 6161860
376 2644104511 2643221618 Bacteria 7717186
377 2644307900 2643221655 Bacteria 7722067
378 2644614055 2643221712 Bacteria 7729434
379 2723578326 2721755686 Bacteria 7343952
380 2723844996 2721755755 Bacteria 8322773
381 2745079302 2744054633 Bacteria 8678936
382 2753568124 2751185846 Bacteria 7242164
383 2792580648 2791355082 Bacteria 5973319
384 2793078893
385 2841736253 2841734538 Bacteria 6784580
386 2841947691 2841941048 Bacteria 8688029
387 2841962822 2841957949 Bacteria 8652217
388 2847687344 2847686936 Bacteria 6278406
389 2847936236 2847930680 Bacteria 9342022
390 2856353623 2856349417 Bacteria 6230045
391 2856363015 2856356410 Bacteria 6297484
392 2856370936 2856364286 Bacteria 6939991
393 2857355231 2857349434 Bacteria 7926032
394 2869292171 2869285874 Bacteria 6901219
395 2871435378 2871429161 Bacteria 6547891
396 2871445259 2871444079 Bacteria 6423508
397 2871481249 2871474448 Bacteria 6806570
398 2871493633 2871488783 Bacteria 6929816
399 2874102875 2874102143 Bacteria 6342645
400 2874155080 2874146452 Bacteria 7533118
401 2874161398 2874155637 Bacteria 6724144
402 2874605291 2874604998 Bacteria 7834745
403 2874615431 2874612657 Bacteria 8252029
404 2874621544 2874620515 Bacteria 8290088
405 2876395556 2876392853 Bacteria 6660880
406 2876420535 2876413966 Bacteria 6831344
407 2876761431 2876761206 Bacteria 10111113
408 2876765851 2876761206 Bacteria 10111113
409 2878752513 2878745973 Bacteria 6867388
410 2878756206 2878753008 Bacteria 6922523
411 2879083733 2879083081 Bacteria 8587928
412 2881152964 2881147464 Bacteria 7779814
413 2881157022 2881155292 Bacteria 6461656
414 2881162147 2881161766 Bacteria 7127907
415 2881849671 2881845957 Bacteria 6611900
416 2881858825 2881853255 Bacteria 6698367
417 2881862305 2881861095 Bacteria 7128710
418 2882634367 2882632389 Bacteria 8154593
419 2882914605 2882912400 Bacteria 6801539
420 2885310991 2885305155 Bacteria 7348390
421 2885314279 2885312484 Bacteria 6415165
422 2885319117 2885318864 Bacteria 6729568
423 2885329498 2885326080 Bacteria 7134805
424 2885340643 2885334103 Bacteria 7216818
425 2885350615 2885342637 Bacteria 7011821
426 2885357050 2885350715 Bacteria 6787678
427 2889792834 2889790730 Bacteria 5689708
428 2903502863 2903492973 Bacteria 13473544
429 2903505314 2903492973 Bacteria 13473544
430 2904617217 2904615490 Bacteria 10047340
431 2904662187 2904659560 Bacteria 6685615
432 2904668213 2904666416 Bacteria 8226587
433 2906314907 2906308376 Bacteria 6841989
434 2906328079 2906321335 Bacteria 6579571
435 2906332649 2906328253 Bacteria 6585166
436 2906649191 2906643746 Bacteria 8722424
437 2922161380 2922158528 Bacteria 6573167
438 2924727117 2924726620 Bacteria 6271473
439 2924768240 2924762789 Bacteria 6561353
440 2924787777 2924784321 Bacteria 7416538
441 2937821306 2937813078 Bacteria 7783518
442 2937827036 2937822353 Bacteria 7290551
443 2937843181 2937836603 Bacteria 6811263
444 2937894519 2937891427 Bacteria 6357007
445 2958077213 2958071322 Bacteria 6815895
446 2958117676 2958115193 Bacteria 6923548
447 2958136571 2958130278 Bacteria 6897202
448 2958186065 2958179912 Bacteria 6874908
449 2961084547 2961077736 Bacteria 7079850
450 2961117342 2961114664 Bacteria 6680456
451 2961136349 2961127735 Bacteria 7196641
452 2961172494 2961170736 Bacteria 7072258
453 2965063223 2965062239 Bacteria 7412989
454 2967997710 2967996073 Bacteria 6787468
455 2968008361 2968003550 Bacteria 6929263
456 2968096690 2968091066 Bacteria 6052692
457 2968099892 2968097103 Bacteria 6107094
458 2968113250 2968110612 Bacteria 6814636
459 2968123580 2968117919 Bacteria 6536078
460 2968132857 2968128360 Bacteria 6270294
461 2970505088 2970503327 Bacteria 7099517
462 2977825387 2977821940 Bacteria 6906439
463 2977829109 2977828996 Bacteria 7007971
464 2977849494 2977843712 Bacteria 6753583
465 2977864603 2977858184 Bacteria 6215359
466 2977948775 2977942078 Bacteria 7570577
467 2979780132 2979779861 Bacteria 6219781
468 2979809809 2979808191 Bacteria 7179355
469 2987640364 2987636660 Bacteria 8088555
470 2987671340 2987666974 Bacteria 6509233
471 2996347259 2996341866 Bacteria 6643098
472 3000141386 3000135777 Bacteria 6891109
473 3004174293 3004167301 Bacteria 8330599
474 3004208562 3004203850 Bacteria 7307914
475 8004377795 8004374579 Bacteria 6898112
476 8004394848 8004387939 Bacteria 7049250
477 8004451216 8004445564 Bacteria 6322258
478 8004638432 8004633249 Bacteria 6723080
479 8004642793 8004640170 Bacteria 6723001
480 8004711559 8004703790 Bacteria 8006957
481 8004721168 8004714634 Bacteria 6776161
482 8006996226 8006994254 Bacteria 8309700
483 8019654724 8019648815 Bacteria 10014479
484 8020950135 8020945358 Bacteria 8467355
485 8049295150 8049293176 Bacteria 6128433
486 8055617739 8055617313 Bacteria 7548464
487 Ga0105237_10046501
488 JGI24735J21928_10069745
489 JGI24751J29686_10059061
490 rootL2_10206878
491 JGI25404J52841_10011695
492 Ga0065712_10158890
493 Ga0070658_10023152
494 Ga0070658_10103586
495 Ga0070683_100152152
496 Ga0070670_100150682
497 Ga0068869_100012094
498 Ga0070680_100003964
499 Ga0070680_100327480
500 Ga0070660_100006404
501 Ga0070689_100609220
502 Ga0070692_10330961
503 Ga0070675_100000721
504 Ga0070675_100158559
505 Ga0070659_100174763
506 Ga0070709_10283298
507 Ga0070714_100432619
508 Ga0070713_100181411
509 Ga0070713_100508364
510 Ga0070711_100573331
511 Ga0070708_100079380
512 Ga0070663_100057193
513 Ga0070681_10082713
514 Ga0070681_10102112
515 Ga0070681_10140600
516 Ga0068867_100126356
517 Ga0070706_100189006
518 Ga0070707_100075378
519 Ga0070707_100328475
520 Ga0070699_100171298
521 Ga0070679_100340005
522 Ga0070697_100071499
523 Ga0070697_100098853
524 Ga0070697_100116763
525 Ga0068853_100162167
526 Ga0068853_100308637
527 Ga0068855_100025995
528 Ga0068855_100075675
529 Ga0068855_100285389
530 Ga0068855_100446814
531 Ga0070664_100031282
532 Ga0070664_100603550
533 Ga0068857_100020561
534 Ga0068857_100032129
535 Ga0068857_100089151
536 Ga0068857_100407581
537 Ga0068854_100170510
538 Ga0068856_100021977
539 Ga0068856_100121387
540 Ga0068856_100292840
541 Ga0068856_100357186
542 Ga0068852_100005037
543 Ga0068852_100467015
544 Ga0068864_100019551
545 Ga0068864_100027816
546 Ga0068861_100489038
547 Ga0068851_10040774
548 Ga0068870_10007113
549 Ga0068858_100055997
550 Ga0068858_100497643
551 Ga0068860_100527337
552 Ga0068860_100601179
553 Ga0081455_10003129
554 Ga0081455_10074270
555 Ga0081455_10131468
556 Ga0081540_1010671
557 Ga0081539_10024293
558 Ga0070717_10008498
559 Ga0070717_10144202
560 Ga0070717_10272334
561 Ga0075365_10053213
562 Ga0075363_100013679
563 Ga0075364_10004651
564 Ga0070716_100086650
565 Ga0070716_100142191
566 Ga0070712_100069543
567 Ga0075362_10008798
568 Ga0075362_10065081
569 Ga0075362_10125805
570 Ga0075367_10015868
571 Ga0075367_10049974
572 Ga0075369_10010192
573 Ga0075366_10004696
574 Ga0075430_100039067
575 Ga0075430_100719538
576 Ga0075431_100011300
577 Ga0075431_100114029
578 Ga0075433_10072233
579 Ga0075433_10136589
580 Ga0075433_10515157
581 Ga0075433_10557350
582 Ga0075433_10572212
583 Ga0075434_100000461
584 Ga0075434_100000803
585 Ga0075434_100008151
586 Ga0075434_100023991
587 Ga0075436_100000446
588 Ga0075436_100041970
589 Ga0075436_100070471
590 Ga0075436_100108168
591 Ga0075436_100128504
592 Ga0075436_100135830
593 Ga0099823_1050473
594 Ga0075435_100000005
595 Ga0075435_100005397
596 Ga0075435_100016593
597 Ga0075435_100104292
598 Ga0075435_100169850
599 Ga0099794_10002248
600 Ga0099794_10002770
601 Ga0099794_10066033
602 Ga0099794_10088383
603 Ga0105240_10013094
604 Ga0105240_10014969
605 Ga0111539_10099735
606 Ga0111539_10160124
607 Ga0105245_10088252
608 Ga0114129_10031256
609 Ga0114129_10074960
610 Ga0114129_10089524
611 Ga0114129_10092490
612 Ga0114129_10371613
613 Ga0105243_10141751
614 Ga0105241_10168059
615 Ga0105241_10774465
616 Ga0105241_11161784
617 Ga0105242_10439953
618 Ga0105248_10325890
619 Ga0105237_10009752
620 Ga0105237_10242193
621 Ga0105238_10032387
622 Ga0105238_10055364
623 Ga0105239_10021383
624 Ga0105239_10103618
625 Ga0105239_10489919
626 Ga0157371_10304611
627 Ga0157370_10023609
628 Ga0157370_10189799
629 Ga0157370_10334820
630 Ga0157369_10020470
631 Ga0157369_10024932
632 Ga0163162_10051591
633 Ga0157372_10066539
634 Ga0157372_10121813
635 Ga0157372_10398326
636 Ga0157372_10532439
637 Ga0157375_10348994
638 Ga0163163_10010313
639 Ga0163163_10814946
640 Ga0157379_10005726
641 Ga0157376_10163805
642 Ga0206353_11053305
643 Ga0224712_10004423
644 Ga0209677_101589
645 Ga0209233_1003404
646 Ga0209130_1000389
647 Ga0209025_1037885
648 Ga0209758_1007011
649 Ga0207426_1000361
650 Ga0207697_10178331
651 Ga0207647_10052638
652 Ga0207699_10216811
653 Ga0207643_10008835
654 Ga0207684_10307529
655 Ga0207707_10011082
656 Ga0207707_10170214
657 Ga0207695_10011773
658 Ga0207695_10116756
659 Ga0207671_10099307
660 Ga0207693_10077646
661 Ga0207693_10089082
662 Ga0207693_10306754
663 Ga0207663_10014863
664 Ga0207663_10646761
665 Ga0207660_10085632
666 Ga0207660_10306189
667 Ga0207657_10007619
668 Ga0207649_10225981
669 Ga0207652_10040056
670 Ga0207652_10133437
671 Ga0207694_10050544
672 Ga0207694_10758681
673 Ga0207659_10019272
674 Ga0207687_10343127
675 Ga0207700_10073674
676 Ga0207700_10185356
677 Ga0207700_10386851
678 Ga0207700_10572372
679 Ga0207700_10577143
680 Ga0207664_10109704
681 Ga0207690_10610554
682 Ga0207665_10121559
683 Ga0207661_10090625
684 Ga0207679_10030656
685 Ga0207667_10163434
686 Ga0207667_10906862
687 Ga0207640_10153377
688 Ga0207640_10206145
689 Ga0207639_10143789
690 Ga0207678_10122997
691 Ga0207678_10414147
692 Ga0207702_10010239
693 Ga0207702_10121982
694 Ga0207702_10196803
695 Ga0207702_10278073
696 Ga0207676_10032977
697 Ga0207676_10036900
698 Ga0207674_10019996
699 Ga0207674_10074023
700 Ga0207674_10142456
701 Ga0207674_10148806
702 Ga0207674_10165403
703 Ga0207698_10042532
704 Ga0209389_1000008
705 Ga0209489_107658
706 Ga0209700_100062
707 Ga0209588_1001636
708 Ga0207428_10191844
709 Ga0268265_10119653
710 Ga0307408_100059933
711 Ga0307516_10003967
712 Ga0307516_10007143
713 Ga0307412_10037044
714 Ga0307412_10093040
715 Ga0307416_100054594
716 Ga0307416_101334056
717 Ga0307510_10023482
718 Ga0373939_0016872
719 Ga0373945_0166617
720 Ga0373925_0174697
721 Ga0395899_0002829
722 Ga0395898_0284621
723 Ga0395905_0025238
724 Ga0436364_0570165
725 Ga0395901_0017748
726 Ga0395901_0332350
727 Ga0395901_0577460
728 Ga0395901_0617185
729 Ga0436363_0163759
730 Ga0439465_0055158
731 Ga0439432_057747
732 Ga0439458_0005244
733 Ga0439460_0014753
734 Ga0466971_0065937
735 Ga0451576_0194616
736 Ga0451576_0493812
737 Ga0466967_0081961
738 Ga0466967_0697162
739 Ga0495629_0056647
740 Ga0495638_0001017
741 Ga0495582_0209286
742 Ga0495605_0056883
743 Ga0495610_0053134
744 Ga0495618_0011812
745 Ga0495618_0049156
746 Ga0495620_0022642
747 Ga0495628_0028485
748 Ga0495665_0035299
749 Ga0495640_0059006
750 Ga0495645_0127035
751 Ga0495656_0056552
752 Ga0495668_0046097
753 Ga0495634_0041113
754 Ga0495599_0259579
755 Ga0495613_0137232
756 Ga0495581_0044031
757 Ga0495581_0365326
758 Ga0495604_0052480
759 Ga0495674_0045357
760 Ga0495674_0276173
761 Ga0495672_0055018
762 Ga0495683_0016134
763 Ga0495687_020678
764 Ga0495675_0105680
765 Ga0495684_0005224
766 Ga0495684_0191211
767 Ga0495684_0238786
768 Ga0495593_0204254
769 Ga0495602_0214216
770 Ga0495626_0026160
771 Ga0496100_0402447
772 Ga0496102_0000450
773 Ga0496102_0289950
774 Ga0496104_0004777
775 Ga0496105_0323187
776 Ga0496106_0002524
777 Ga0496106_0113871
778 Ga0496111_0455312
779 Ga0496112_0000067
780 Ga0496112_0113678
781 Ga0496112_0137411
782 Ga0496118_0265637
783 Ga0496119_0131201
784 Ga0496120_0001808
785 Ga0496121_0002947
786 Ga0495682_0068563
787 Ga0501291_005925
788 Ga0501034_0001436
789 Ga0501034_0005645
790 Ga0501036_0021652
791 Ga0501038_0000257
792 Ga0501039_0008126
793 Ga0501040_0499154
794 Ga0501043_0003577
795 Ga0501068_0001787
796 Ga0501070_0149058
797 Ga0501070_0269630
798 Ga0501073_0026869
799 Ga0501073_0274499
800 Ga0501076_0182144
801 Ga0501216_013889
802 Ga0501080_0028577
803 Ga0501044_0005491
804 Ga0501044_0074442
805 Ga0501044_0094485
806 nmdc:mga03683_3073_c1
807 nmdc:mga03683_56267_c1
808 nmdc:mga03n38_22042_c1
809 nmdc:mga03n38_51545_c1
810 nmdc:mga00v17_2444_c1
811 nmdc:mga00v17_489084_c1
812 nmdc:mga0yw44_41557_c1
813 nmdc:mga0yw44_428695_c1
814 nmdc:mga0yw44_6274_c1
815 nmdc:mga0yw44_7691_c1
816 nmdc:mga0k408_5991_c1
817 nmdc:mga06z11_35057_c1
818 nmdc:mga06z11_7017_c1
819 nmdc:mga05p37_202168_c1
820 nmdc:mga05p37_21619_c1
821 nmdc:mga05p37_305567_c1
822 nmdc:mga05p37_330978_c1
823 nmdc:mga09592_134094_c1
824 nmdc:mga0qj67_529252_c1
825 nmdc:mga06r32_12577_c1
826 nmdc:mga08y16_723904_c1
827 nmdc:mga0n895_17_c1
828 nmdc:mga0n895_18976_c1
829 nmdc:mga0n895_57208_c1
830 nmdc:mga0n895_8567_c1
831 nmdc:mga0n895_87291_c1
832 nmdc:mga0rr50_17561_c1
833 nmdc:mga0rr50_24_c1
834 nmdc:mga0rr50_286772_c1
835 nmdc:mga0rr50_29756_c1
836 nmdc:mga0rr50_3873_c1
837 nmdc:mga08x19_116409_c1
838 nmdc:mga08x19_12332_c1
839 nmdc:mga08x19_157636_c1
840 nmdc:mga08x19_445_c1
841 nmdc:mga08x19_519987_c1
842 nmdc:mga08x19_63257_c1
843 nmdc:mga0a205_101571_c1
844 nmdc:mga0a205_12508_c1
845 nmdc:mga0a205_140637_c1
846 nmdc:mga0a205_324526_c1
847 nmdc:mga0a205_369318_c1
848 nmdc:mga0a205_61433_c1
849 nmdc:mga0sz30_5364_c1
850 Ga0495601_0001827
851 Ga0495612_0044253
852 Ga0500616_0089849
853 Ga0500627_0002469
854 Ga0500627_0031083
855 Ga0500627_0034645
856 Ga0500627_0068687
857 2509146495
858 2513691580
859 2514417907
860 2524436624
861 2599941046
862 2644104511
863 2644307900
864 2644614055
865 2723578326
866 2723844996
867 2745079302
868 2753568124
869 2792580648
870 2793078893
871 2841736253
872 2841947691
873 2841962822
874 2847687344
875 2847936236
876 2856353623
877 2856363015
878 2856370936
879 2857355231
880 2869292171
881 2871435378
882 2871445259
883 2871481249
884 2871493633
885 2874102875
886 2874155080
887 2874161398
888 2874605291
889 2874615431
890 2874621544
891 2876395556
892 2876420535
893 2876761431
894 2876765851
895 2878752513
896 2878756206
897 2879083733
898 2881152964
899 2881157022
900 2881162147
901 2881849671
902 2881858825
903 2881862305
904 2882634367
905 2882914605
906 2885310991
907 2885314279
908 2885319117
909 2885329498
910 2885340643
911 2885350615
912 2885357050
913 2889792834
914 2903502863
915 2903505314
916 2904617217
917 2904662187
918 2904668213
919 2906314907
920 2906328079
921 2906332649
922 2906649191
923 2922161380
924 2924727117
925 2924768240
926 2924787777
927 2937821306
928 2937827036
929 2937843181
930 2937894519
931 2958077213
932 2958117676
933 2958136571
934 2958186065
935 2961084547
936 2961117342
937 2961136349
938 2961172494
939 2965063223
940 2967997710
941 2968008361
942 2968096690
943 2968099892
944 2968113250
945 2968123580
946 2968132857
947 2970505088
948 2977825387
949 2977829109
950 2977849494
951 2977864603
952 2977948775
953 2979780132
954 2979809809
955 2987640364
956 2987671340
957 2996347259
958 3000141386
959 3004174293
960 3004208562
961 8004377795
962 8004394848
963 8004451216
964 8004638432
965 8004642793
966 8004711559
967 8004721168
968 8006996226
969 8019654724
970 8020950135
971 8049295150
972 8055617739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

32

199

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.9085 2 218
3r2u-assembly1.cif.gz_A 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. aureus col 0.9023 2 219
3r2u-assembly1.cif.gz_B 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. aureus col 0.8907 1 219
3r2u-assembly1.cif.gz_C 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. aureus col 0.863 2 232
5ve5-assembly2.cif.gz_B crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.8565 2 216
ID Description Score Start End Superfamily
af_Q2G1R6_1_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8987 1 219 3.60.15.10
af_Q86PD3_43_273_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8595 2 216 3.60.15.10
af_K7MDN4_21_187_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8583 2 137 3.60.15.10
af_Q2G1R6_1_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8481 1 219 3.60.15.10
af_Q4DDD0_184_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8232 2 138 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A529HEB8-F1-model_v4 MBL fold metallo-hydrolase 1.001 1 131 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A529FKH3-F1-model_v4 MBL fold metallo-hydrolase 1.001 1 120 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A533J983-F1-model_v4 deleted 0.9948 1 112
AF-A0A533J983-F1-model_v4 deleted 0.986 1 112
AF-A0A7V9BQW7-F1-model_v4 MBL fold metallo-hydrolase 0.985 1 111 GO:0006749
GO:0016787
GO:0050313
GO:0070813

Map