F453195

General Info

Members Datasets Scaffolds Average Seq Length
485 275 971 116

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006393351|3006396747
Length 130
Sequence WTACAGPVVPTRLARMEILGATLRICVDDLETAIPFYERLTGAPAHRFGRGGVQAAAIGSFLLMSGPEAELEVLRKVTATIAVKDVDEAHRQLTELGARVVAGPLATPAGRNLLAVHPDGTVFEYVDQPG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
28 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
62 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
63 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
64 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
65 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
72 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
79 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
80 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
81 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
214 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
215 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
220 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
221 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
222 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
223 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
224 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
225 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
226 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
227 2643221548 Streptomyces sp. Root55 Isolate Unclassified
228 2643221578 Streptomyces sp. Root63 Isolate Unclassified
229 2643221647 Streptomyces sp. Root369 Isolate Unclassified
230 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
231 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
232 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
233 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
234 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
235 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
236 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
237 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
238 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
239 2808606448 Streptomyces sp. 193411 Isolate Unclassified
240 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
241 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
242 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
243 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
244 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
245 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
246 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
247 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
248 2867428634 Streptomyces sp. RP5T Isolate Unclassified
249 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
250 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
251 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
252 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
253 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
254 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
255 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
256 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
257 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
258 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
259 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
260 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
261 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
262 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
263 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
264 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
265 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
266 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
267 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
268 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
269 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
270 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
271 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
272 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
273 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
274 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
275 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.84
Metatranscriptomes 0.41
Isolates 11.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0.82
Rhizoplane 2.06
Rhizosphere 78.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10055973 3300001989 Bacteria 1259
2 JGI24735J21928_10135930 3300002067 Bacteria 709
3 JGI24738J21930_10150568 3300002075 Bacteria 517
4 rootH1_10010343 3300003316 Bacteria 2208
5 rootH1_10010343 3300003323 Bacteria 1699
6 rootH1_10066653 3300003316 Bacteria 1039
7 rootH1_10066654 3300003316 Bacteria 1455
8 rootH2_10052932 3300003320 Bacteria 2634
9 rootL2_10181653 3300003322 Bacteria 2020
10 rootH1_10065195 3300003323 Bacteria 6938
11 Ga0006562J51391_1059778 3300003578 Bacteria 840
12 Ga0006562J51391_1185274 3300003578 Bacteria 770
13 Ga0068853_100222530 3300005539 Bacteria 1724
14 Ga0068855_100332569 3300005563 Bacteria 1677
15 Ga0068862_101173876 3300005844 Bacteria 765
16 Ga0081539_10124576 3300005985 Bacteria 1275
17 Ga0075368_10016271 3300006042 Bacteria 2772
18 Ga0075363_100035076 3300006048 Bacteria 2622
19 Ga0075363_100222521 3300006048 Bacteria 1082
20 Ga0070715_10851705 3300006163 Bacteria 557
21 Ga0075367_10176920 3300006178 Bacteria 1330
22 Ga0075370_10242786 3300006353 Bacteria 1067
23 Ga0099826_10181754 3300006948 Bacteria 1169
24 Ga0105251_10084300 3300009011 Bacteria 1466
25 Ga0105250_10165075 3300009092 Bacteria 925
26 Ga0105248_11018521 3300009177 Bacteria 936
27 Ga0105249_11646195 3300009553 Bacteria 714
28 Ga0105239_10869413 3300010375 Bacteria 1034
29 Ga0157372_10163210 3300013307 Bacteria 2575
30 Ga0182008_10000981 3300014497 Bacteria 19805
31 Ga0182006_1083733 3300015261 Bacteria 1159
32 Ga0183367_1001 3300015688 Bacteria 1225545
33 Ga0209758_1018954 3300025297 Bacteria 3344
34 Ga0207426_1024450 3300025302 Bacteria 2049
35 Ga0207713_1065539 3300025735 Bacteria 1363
36 Ga0207647_10054058 3300025904 Bacteria 2472
37 Ga0207685_10564132 3300025905 Bacteria 607
38 Ga0207667_10502085 3300025949 Bacteria 1230
39 Ga0207639_10012340 3300026041 Bacteria 5949
40 Ga0207702_10130010 3300026078 Bacteria 2265
41 Ga0209371_1011030 3300027312 Bacteria 2717
42 Ga0209282_1400680 3300027666 Bacteria 539
43 Ga0209813_10018978 3300027866 Bacteria 1906
44 Ga0307517_10007152 3300028786 Bacteria 16365
45 Ga0307515_10000055 3300028794 Bacteria 264365
46 Ga0307515_10136999 3300028794 Bacteria 2654
47 Ga0307515_10277197 3300028794 Bacteria 1389
48 Ga0268256_1011919 3300030500 Bacteria 2718
49 Ga0307511_10000113 3300030521 Bacteria 72975
50 Ga0307511_10078831 3300030521 Bacteria 2333
51 Ga0307511_10192214 3300030521 Bacteria 1076
52 Ga0307512_10002717 3300030522 Bacteria 21689
53 Ga0307512_10036816 3300030522 Bacteria 4143
54 Ga0307513_10080215 3300031456 Bacteria 3367
55 Ga0307513_10093860 3300031456 Bacteria 3048
56 Ga0307509_10014761 3300031507 Bacteria 9159
57 Ga0307509_10016654 3300031507 Bacteria 8498
58 Ga0307408_100807161 3300031548 Bacteria 852
59 Ga0307408_101291975 3300031548 Bacteria 684
60 Ga0307508_10035469 3300031616 Bacteria 4495
61 Ga0307508_10129711 3300031616 Bacteria 2124
62 Ga0307508_10149523 3300031616 Bacteria 1939
63 Ga0307508_10805041 3300031616 Bacteria 557
64 Ga0307514_10043829 3300031649 Bacteria 3510
65 Ga0307514_10066598 3300031649 Bacteria 2723
66 Ga0307514_10200762 3300031649 Bacteria 1253
67 Ga0307516_10002534 3300031730 Bacteria 24324
68 Ga0307516_10360244 3300031730 Bacteria 1119
69 Ga0307518_10002513 3300031838 Bacteria 13382
70 Ga0307518_10107935 3300031838 Bacteria 1986
71 Ga0307518_10152462 3300031838 Bacteria 1597
72 Ga0307409_102197915 3300031995 Bacteria 581
73 Ga0307416_100457828 3300032002 Bacteria 1330
74 Ga0307416_103589052 3300032002 Bacteria 519
75 Ga0307507_10005356 3300033179 Bacteria 21193
76 Ga0307507_10006073 3300033179 Bacteria 18960
77 Ga0307510_10021380 3300033180 Bacteria 7538
78 Ga0307510_10123589 3300033180 Bacteria 2284
79 Ga0307510_10478802 3300033180 Bacteria 686
80 Ga0395899_0579490 3300037312 Bacteria 717
81 Ga0395900_0115298 3300037418 Bacteria 2757
82 Ga0395898_0006491 3300037466 Bacteria 12491
83 Ga0395898_0273684 3300037466 Bacteria 1610
84 Ga0395898_0396995 3300037466 Bacteria 1315
85 Ga0395901_0118780 3300038443 Bacteria 2778
86 Ga0395901_0503451 3300038443 Bacteria 1233
87 Ga0439436_0000971 3300041404 Bacteria 7932
88 Ga0439436_0018130 3300041404 Bacteria 2105
89 Ga0439439_0037612 3300041406 Bacteria 1248
90 Ga0451789_1152305 3300041443 Bacteria 813
91 Ga0451791_1017552 3300041451 Bacteria 1557
92 Ga0451791_1815008 3300041451 Bacteria 549
93 Ga0451795_1600941 3300041456 Bacteria 1927
94 Ga0451800_1146492 3300041459 Bacteria 1199
95 Ga0451802_0402445 3300041460 Bacteria 2242
96 Ga0451807_2339596 3300041486 Bacteria 1097
97 Ga0451833_0851518 3300041491 Bacteria 605
98 Ga0451837_0382226 3300041494 Bacteria 1060
99 Ga0451843_0377573 3300041509 Bacteria 774
100 Ga0451853_0986148 3300041512 Bacteria 1003
101 Ga0451853_2234632 3300041512 Bacteria 1851
102 Ga0451853_2677488 3300041512 Bacteria 2416
103 Ga0439433_0003412 3300041999 Bacteria 3410
104 Ga0439433_0023341 3300041999 Bacteria 1391
105 Ga0439442_010756 3300042002 Bacteria 1859
106 Ga0439448_0015188 3300042005 Bacteria 2330
107 Ga0439448_0142686 3300042005 Bacteria 829
108 Ga0439449_0001133 3300042007 Bacteria 10463
109 Ga0439449_0017378 3300042007 Bacteria 2701
110 Ga0439449_0025233 3300042007 Bacteria 2222
111 Ga0439449_0128673 3300042007 Bacteria 941
112 Ga0439455_0010561 3300042012 Bacteria 2033
113 Ga0439457_001744 3300042014 Bacteria 6443
114 Ga0439457_016474 3300042014 Bacteria 1646
115 Ga0439462_0014330 3300042015 Bacteria 2036
116 Ga0439462_0130932 3300042015 Bacteria 700
117 Ga0450894_000285 3300042131 Bacteria 9095
118 Ga0450896_018925 3300042133 Bacteria 1000
119 Ga0450902_004978 3300042137 Bacteria 1994
120 Ga0450903_001336 3300042138 Bacteria 4606
121 Ga0450906_042429 3300042145 Bacteria 803
122 Ga0439458_0000078 3300042157 Bacteria 18206
123 Ga0450901_007281 3300042533 Bacteria 1140
124 Ga0466969_0045768 3300044656 Bacteria 2171
125 Ga0466972_0010705 3300044658 Bacteria 4601
126 Ga0466972_0011639 3300044658 Bacteria 4417
127 Ga0466972_0074014 3300044658 Bacteria 1623
128 Ga0466965_0000877 3300044683 Bacteria 11481
129 Ga0466965_0158366 3300044683 Bacteria 1186
130 Ga0466965_0297217 3300044683 Bacteria 875
131 Ga0466965_0659646 3300044683 Bacteria 598
132 Ga0466966_0003596 3300044684 Bacteria 10230
133 Ga0466966_0066128 3300044684 Bacteria 2272
134 Ga0466966_0713954 3300044684 Bacteria 604
135 Ga0466961_0011773 3300044693 Bacteria 5590
136 Ga0466961_0066249 3300044693 Bacteria 2294
137 Ga0466963_0000819 3300044694 Bacteria 15537
138 Ga0466963_0001279 3300044694 Bacteria 13351
139 Ga0466964_0000800 3300044706 Bacteria 10254
140 Ga0466964_0251726 3300044706 Bacteria 871
141 Ga0466971_0000384 3300044719 Bacteria 17009
142 Ga0466968_0077510 3300044735 Bacteria 1456
143 Ga0466968_0182862 3300044735 Bacteria 975
144 Ga0466968_0514742 3300044735 Bacteria 597
145 Ga0466970_0001570 3300044765 Bacteria 11023
146 Ga0466970_0018425 3300044765 Bacteria 3613
147 Ga0466957_0000083 3300044842 Bacteria 38311
148 Ga0466957_0388817 3300044842 Bacteria 952
149 Ga0466960_0002028 3300044901 Bacteria 7517
150 Ga0466959_0003365 3300045049 Bacteria 10450
151 Ga0466959_1161046 3300045049 Bacteria 513
152 Ga0466958_0001876 3300045836 Bacteria 10278
153 Ga0466958_0365677 3300045836 Bacteria 929
154 Ga0466967_0011067 3300045976 Bacteria 6811
155 Ga0466967_0031232 3300045976 Bacteria 4481
156 Ga0466967_0160617 3300045976 Bacteria 2109
157 Ga0495592_0009141 3300046454 Bacteria 7456
158 Ga0495592_0021737 3300046454 Bacteria 4881
159 Ga0495603_0001397 3300046455 Bacteria 14042
160 Ga0495603_0001730 3300046455 Bacteria 12865
161 Ga0495603_0018011 3300046455 Bacteria 4273
162 Ga0495603_0026433 3300046455 Bacteria 3506
163 Ga0495603_0107554 3300046455 Bacteria 1627
164 Ga0495603_0267839 3300046455 Bacteria 983
165 Ga0495590_0176308 3300046457 Bacteria 780
166 Ga0495629_0001162 3300046459 Bacteria 20771
167 Ga0495629_0004297 3300046459 Bacteria 10678
168 Ga0495629_0010242 3300046459 Bacteria 6828
169 Ga0495629_0017660 3300046459 Bacteria 5113
170 Ga0495629_0030316 3300046459 Bacteria 3835
171 Ga0495629_0053807 3300046459 Bacteria 2815
172 Ga0495629_0064367 3300046459 Bacteria 2560
173 Ga0495629_0137713 3300046459 Bacteria 1699
174 Ga0495638_0169651 3300046460 Bacteria 1253
175 Ga0495638_0323711 3300046460 Bacteria 823
176 Ga0495638_0359721 3300046460 Bacteria 766
177 Ga0495638_0671945 3300046460 Bacteria 501
178 Ga0495651_0003604 3300046462 Bacteria 11868
179 Ga0495651_0087059 3300046462 Bacteria 2349
180 Ga0495653_0322588 3300046463 Bacteria 1001
181 Ga0495580_0112915 3300046472 Bacteria 1887
182 Ga0495582_0005596 3300046473 Bacteria 6995
183 Ga0495582_0127214 3300046473 Bacteria 1438
184 Ga0495582_0634573 3300046473 Bacteria 618
185 Ga0495605_0022971 3300046474 Bacteria 3286
186 Ga0495605_0030082 3300046474 Bacteria 2787
187 Ga0495662_0002930 3300046476 Bacteria 8612
188 Ga0495662_0015626 3300046476 Bacteria 3683
189 Ga0495662_0063225 3300046476 Bacteria 1788
190 Ga0495662_0125590 3300046476 Bacteria 1260
191 Ga0495662_0164169 3300046476 Bacteria 1094
192 Ga0495662_0244211 3300046476 Bacteria 884
193 Ga0495664_0000284 3300046477 Bacteria 24203
194 Ga0495664_0109216 3300046477 Bacteria 1669
195 Ga0495664_0133077 3300046477 Bacteria 1506
196 Ga0495594_0027497 3300046499 Bacteria 3065
197 Ga0495594_0027627 3300046499 Bacteria 3058
198 Ga0495594_0034422 3300046499 Bacteria 2755
199 Ga0495596_0127661 3300046500 Bacteria 987
200 Ga0495607_0099540 3300046501 Bacteria 1559
201 Ga0495607_0518075 3300046501 Bacteria 527
202 Ga0495606_0059425 3300046507 Bacteria 2452
203 Ga0495606_0179007 3300046507 Bacteria 1224
204 Ga0495608_0034270 3300046511 Bacteria 3428
205 Ga0495608_0371352 3300046511 Bacteria 878
206 Ga0495610_0188963 3300046512 Bacteria 851
207 Ga0495610_0255254 3300046512 Bacteria 693
208 Ga0495616_0026638 3300046513 Bacteria 3074
209 Ga0495618_0013427 3300046514 Bacteria 4983
210 Ga0495618_0162042 3300046514 Bacteria 1425
211 Ga0495620_0001237 3300046515 Bacteria 15589
212 Ga0495620_0118401 3300046515 Bacteria 1045
213 Ga0495628_0034826 3300046516 Bacteria 4048
214 Ga0495628_0066772 3300046516 Bacteria 2811
215 Ga0495628_0140919 3300046516 Bacteria 1840
216 Ga0495630_0084074 3300046517 Bacteria 2403
217 Ga0495630_0503622 3300046517 Bacteria 929
218 Ga0495631_0326932 3300046518 Bacteria 652
219 Ga0495637_0109832 3300046520 Bacteria 1070
220 Ga0495643_0005030 3300046522 Bacteria 9052
221 Ga0495644_0118387 3300046523 Bacteria 1007
222 Ga0495648_0518158 3300046524 Bacteria 508
223 Ga0495666_0009195 3300046526 Bacteria 4941
224 Ga0495642_0306425 3300046528 Bacteria 696
225 Ga0495642_0381764 3300046528 Bacteria 621
226 Ga0495652_0180527 3300046529 Bacteria 1620
227 Ga0495654_0173038 3300046530 Bacteria 940
228 Ga0495640_0037327 3300046533 Bacteria 3427
229 Ga0495586_0032547 3300046535 Bacteria 2795
230 Ga0495586_0561901 3300046535 Bacteria 659
231 Ga0495587_0015688 3300046536 Bacteria 4725
232 Ga0495587_0080276 3300046536 Bacteria 1891
233 Ga0495609_0249199 3300046538 Bacteria 731
234 Ga0495609_0346904 3300046538 Bacteria 599
235 Ga0495597_0107343 3300046542 Bacteria 1173
236 Ga0495645_0007603 3300046543 Bacteria 7540
237 Ga0495622_0233225 3300046557 Bacteria 813
238 Ga0495633_0029576 3300046558 Bacteria 2665
239 Ga0495633_0503443 3300046558 Bacteria 546
240 Ga0495667_0232097 3300046559 Bacteria 1176
241 Ga0495667_0259029 3300046559 Bacteria 1106
242 Ga0495667_0944379 3300046559 Bacteria 528
243 Ga0495656_0619854 3300046615 Bacteria 580
244 Ga0495668_0008152 3300046616 Bacteria 6583
245 Ga0495634_0029786 3300046642 Bacteria 3776
246 Ga0495634_0051320 3300046642 Bacteria 2767
247 Ga0495634_0281837 3300046642 Bacteria 1009
248 Ga0495611_0054459 3300046648 Bacteria 1808
249 Ga0495611_0090339 3300046648 Bacteria 1415
250 Ga0495625_0061061 3300046660 Bacteria 2668
251 Ga0495625_0062863 3300046660 Bacteria 2622
252 Ga0495625_0125238 3300046660 Bacteria 1745
253 Ga0495625_0844213 3300046660 Bacteria 529
254 Ga0495635_0034723 3300046663 Bacteria 3497
255 Ga0495635_0048822 3300046663 Bacteria 2918
256 Ga0495635_0128775 3300046663 Bacteria 1725
257 Ga0495661_0066279 3300046665 Bacteria 2126
258 Ga0495661_0410152 3300046665 Bacteria 657
259 Ga0495588_0009045 3300046674 Bacteria 4589
260 Ga0495588_0031937 3300046674 Bacteria 2652
261 Ga0495588_0058643 3300046674 Bacteria 1990
262 Ga0495588_0082221 3300046674 Bacteria 1682
263 Ga0495657_0013713 3300046675 Bacteria 5969
264 Ga0495657_0017511 3300046675 Bacteria 5199
265 Ga0495657_0058222 3300046675 Bacteria 2566
266 Ga0495657_0084480 3300046675 Bacteria 2047
267 Ga0495599_0364301 3300046678 Bacteria 865
268 Ga0495623_0201564 3300046679 Bacteria 1143
269 Ga0495646_0021598 3300046680 Bacteria 4066
270 Ga0495646_0183661 3300046680 Bacteria 1146
271 Ga0495658_0057887 3300046683 Bacteria 2215
272 Ga0495613_0000504 3300046689 Bacteria 32987
273 Ga0495613_0005547 3300046689 Bacteria 9475
274 Ga0495613_0008342 3300046689 Bacteria 7693
275 Ga0495613_0010667 3300046689 Bacteria 6816
276 Ga0495613_0028656 3300046689 Bacteria 4142
277 Ga0495613_0036744 3300046689 Bacteria 3632
278 Ga0495613_0126276 3300046689 Bacteria 1834
279 Ga0495613_0227814 3300046689 Bacteria 1306
280 Ga0495624_0072548 3300046690 Bacteria 2141
281 Ga0495624_0198824 3300046690 Bacteria 1218
282 Ga0495624_0217826 3300046690 Bacteria 1158
283 Ga0495624_0369495 3300046690 Bacteria 862
284 Ga0495670_0113322 3300046691 Bacteria 1405
285 Ga0495671_0002239 3300046692 Bacteria 12292
286 Ga0495671_0130875 3300046692 Bacteria 1224
287 Ga0495649_0015490 3300046694 Bacteria 4339
288 Ga0495649_0068661 3300046694 Bacteria 1901
289 Ga0495649_0176263 3300046694 Bacteria 1117
290 Ga0495589_0018113 3300046794 Bacteria 3613
291 Ga0495589_0023029 3300046794 Bacteria 3174
292 Ga0495589_0023869 3300046794 Bacteria 3111
293 Ga0495589_0085666 3300046794 Bacteria 1531
294 Ga0495589_0169958 3300046794 Bacteria 1036
295 Ga0495600_0002413 3300046809 Bacteria 10712
296 Ga0495600_0209685 3300046809 Bacteria 1249
297 Ga0495581_0006949 3300047315 Bacteria 6554
298 Ga0495581_0013215 3300047315 Bacteria 4788
299 Ga0495581_0536623 3300047315 Bacteria 679
300 Ga0495581_0612510 3300047315 Bacteria 630
301 Ga0495581_0737935 3300047315 Bacteria 567
302 Ga0495604_0000224 3300047317 Bacteria 51653
303 Ga0495604_0071421 3300047317 Bacteria 2626
304 Ga0495604_0092866 3300047317 Bacteria 2234
305 Ga0495636_0001077 3300047318 Bacteria 10258
306 Ga0495636_0002430 3300047318 Bacteria 7139
307 Ga0495636_0083984 3300047318 Bacteria 1375
308 Ga0495636_0168587 3300047318 Bacteria 989
309 Ga0495676_0002248 3300047321 Bacteria 17130
310 Ga0495676_0022783 3300047321 Bacteria 5443
311 Ga0495676_0030375 3300047321 Bacteria 4586
312 Ga0495676_0045523 3300047321 Bacteria 3571
313 Ga0495676_0055205 3300047321 Bacteria 3151
314 Ga0495676_0066378 3300047321 Bacteria 2796
315 Ga0495676_0196183 3300047321 Bacteria 1405
316 Ga0495680_0019551 3300047322 Bacteria 5714
317 Ga0495680_0045837 3300047322 Bacteria 3450
318 Ga0495683_0185652 3300047323 Bacteria 947
319 Ga0495683_0394855 3300047323 Bacteria 576
320 Ga0495687_003403 3300047443 Bacteria 11584
321 Ga0495687_032159 3300047443 Bacteria 2398
322 Ga0495687_035436 3300047443 Bacteria 2244
323 Ga0495687_047989 3300047443 Bacteria 1834
324 Ga0495687_049064 3300047443 Bacteria 1806
325 Ga0495687_204107 3300047443 Bacteria 625
326 Ga0495675_0006540 3300047444 Bacteria 7135
327 Ga0495675_0017127 3300047444 Bacteria 4588
328 Ga0495677_0342038 3300047445 Bacteria 590
329 Ga0495677_0395335 3300047445 Bacteria 547
330 Ga0495685_005824 3300047447 Bacteria 4026
331 Ga0495685_007359 3300047447 Bacteria 3633
332 Ga0495685_009508 3300047447 Bacteria 3250
333 Ga0495685_024445 3300047447 Bacteria 2079
334 Ga0495685_166355 3300047447 Bacteria 713
335 Ga0495685_289655 3300047447 Bacteria 515
336 Ga0495681_0003871 3300047470 Bacteria 10340
337 Ga0495684_0071379 3300047471 Bacteria 2639
338 Ga0495684_0570686 3300047471 Bacteria 767
339 Ga0495686_0033719 3300047472 Bacteria 3303
340 Ga0495686_0149993 3300047472 Bacteria 1369
341 Ga0495686_0736204 3300047472 Bacteria 501
342 Ga0495593_0227461 3300047673 Bacteria 935
343 Ga0495602_0017348 3300048088 Bacteria 7219
344 Ga0495614_0000523 3300048089 Bacteria 15819
345 Ga0495614_0007482 3300048089 Bacteria 4861
346 Ga0495614_0008977 3300048089 Bacteria 4436
347 Ga0495614_0073148 3300048089 Bacteria 1479
348 Ga0495614_0097504 3300048089 Bacteria 1282
349 Ga0496108_0271474 3300048911 Bacteria 1476
350 Ga0496109_0022553 3300048912 Bacteria 5578
351 Ga0496110_0790037 3300048913 Bacteria 853
352 Ga0496120_0413228 3300048923 Bacteria 594
353 Ga0495678_098294 3300049459 Bacteria 1018
354 Ga0495682_0169327 3300049460 Bacteria 777
355 Ga0501031_0039800 3300049568 Bacteria 3068
356 Ga0501031_0545632 3300049568 Bacteria 747
357 Ga0501032_0176298 3300049569 Bacteria 1400
358 Ga0501032_0213100 3300049569 Bacteria 1259
359 Ga0501033_0009016 3300049570 Bacteria 7696
360 Ga0501033_0183343 3300049570 Bacteria 1500
361 Ga0501033_1091277 3300049570 Bacteria 531
362 Ga0501034_0013798 3300049571 Bacteria 8314
363 Ga0501034_0035036 3300049571 Bacteria 5090
364 Ga0501034_0038727 3300049571 Bacteria 4828
365 Ga0501034_0055881 3300049571 Bacteria 3972
366 Ga0501036_0705747 3300049572 Bacteria 833
367 Ga0501037_0044384 3300049573 Bacteria 3264
368 Ga0501037_0105186 3300049573 Bacteria 2034
369 Ga0501037_0266070 3300049573 Bacteria 1197
370 Ga0501037_0628752 3300049573 Bacteria 719
371 Ga0501038_0003776 3300049574 Bacteria 14090
372 Ga0501038_0016781 3300049574 Bacteria 6631
373 Ga0501039_0868907 3300049575 Bacteria 702
374 Ga0501042_0010628 3300049578 Bacteria 6182
375 Ga0501043_0005513 3300049579 Bacteria 10219
376 Ga0501043_0111282 3300049579 Bacteria 2150
377 Ga0501043_0125242 3300049579 Bacteria 2014
378 Ga0501043_0348198 3300049579 Bacteria 1126
379 Ga0501046_0076305 3300049580 Bacteria 2597
380 Ga0501046_0102428 3300049580 Bacteria 2195
381 Ga0501046_0103312 3300049580 Bacteria 2184
382 Ga0501046_0119657 3300049580 Bacteria 2005
383 Ga0501047_0003466 3300049581 Bacteria 14904
384 Ga0501047_0089396 3300049581 Bacteria 2957
385 Ga0501047_0349853 3300049581 Bacteria 1314
386 Ga0501047_0491675 3300049581 Bacteria 1054
387 Ga0501048_0007183 3300049582 Bacteria 8457
388 Ga0501048_0305246 3300049582 Bacteria 1132
389 Ga0501048_0946816 3300049582 Bacteria 619
390 Ga0501070_0119950 3300049586 Bacteria 2174
391 Ga0501070_0843447 3300049586 Bacteria 717
392 Ga0501074_0376023 3300049590 Bacteria 1008
393 Ga0501225_0352530 3300049705 Bacteria 509
394 Ga0501080_0033661 3300049742 Bacteria 4783
395 Ga0501080_0907110 3300049742 Bacteria 768
396 Ga0501083_0757328 3300049744 Bacteria 632
397 Ga0501083_0924151 3300049744 Bacteria 568
398 Ga0501035_0026934 3300049822 Bacteria 5256
399 Ga0501035_0043543 3300049822 Bacteria 4045
400 Ga0501035_0078548 3300049822 Bacteria 2915
401 Ga0501035_0180760 3300049822 Bacteria 1817
402 Ga0501035_0345011 3300049822 Bacteria 1247
403 Ga0501044_0000295 3300049823 Bacteria 63284
404 Ga0501044_0001055 3300049823 Bacteria 33142
405 Ga0501044_0020657 3300049823 Bacteria 7030
406 Ga0501044_0089571 3300049823 Bacteria 3105
407 Ga0501044_0205242 3300049823 Bacteria 1927
408 Ga0501044_0280343 3300049823 Bacteria 1600
409 Ga0501044_0511360 3300049823 Bacteria 1101
410 Ga0501045_0017828 3300049824 Bacteria 5043
411 nmdc:mga03n38_168151_c1 3300050490 Bacteria 1115
412 nmdc:mga03n38_595825_c1 3300050490 Bacteria 629
413 nmdc:mga06z11_195772_c1 3300050494 Bacteria 1172
414 nmdc:mga04h51_22564_c1 3300050495 Bacteria 1906
415 nmdc:mga07m45_137927_c1 3300050496 Bacteria 1412
416 nmdc:mga07m45_874287_c1 3300050496 Bacteria 514
417 Ga0495612_0060624 3300053078 Bacteria 1566
418 Ga0500635_0253776 3300053080 Bacteria 690
419 Ga0495655_0024521 3300053083 Bacteria 1402
420 Ga0495619_0034341 3300053085 Bacteria 3297
421 Ga0500644_0004390 3300053088 Bacteria 3528
422 Ga0500640_017809 3300053095 Bacteria 3020
423 Ga0500560_002311 3300053107 Bacteria 3606
424 Ga0500572_003121 3300053111 Bacteria 3842
425 Ga0500559_0229263 3300053136 Bacteria 876
426 Ga0500634_0243939 3300053161 Bacteria 752
427 Ga0466962_0000664 3300061719 Bacteria 15252
428 Ga0466962_0012674 3300061719 Bacteria 4057
429 Ga0466962_0042558 3300061719 Bacteria 2174
430 3006396747 3006393351 Bacteria 6615579
431 2547410310 2547132111 Bacteria 8013147
432 2554260741 2554235005 Bacteria 6457341
433 2585298188 2582581312 Bacteria 7308206
434 2585304666 2582581313 Bacteria 10042643
435 2585314704 2582581314 Bacteria 11452267
436 2616698280 2616644814 Bacteria 11555299
437 2616901453 2616644941 Bacteria 8510691
438 2643762088 2643221548 Bacteria 8053412
439 2643901965 2643221578 Bacteria 9213798
440 2644261946 2643221647 Bacteria 10741251
441 2644408109 2643221673 Bacteria 9196637
442 2644438872 2643221678 Bacteria 9540101
443 2644459133 2643221682 Bacteria 6743283
444 2784591653 2784132148 Bacteria 8627943
445 2785340074 2784746763 Bacteria 9783172
446 2785372658 2784746768 Bacteria 10036182
447 2786675324 2786546132 Bacteria 10419719
448 2808845013 2808606359 Bacteria 9866990
449 2808914608 2808606375 Bacteria 9466072
450 2809235283 2808606448 Bacteria 8656184
451 2811843511 2808606982 Bacteria 7791042
452 2812354679 2811994879 Bacteria 9313447
453 2819698820 2818991463 Bacteria 7948711
454 2852636297 2852635781 Bacteria 8251373
455 2862184027 2862178590 Bacteria 8583590
456 2862283388 2862281513 Bacteria 9621493
457 2862383703 2862382967 Bacteria 10317375
458 2863409884 2863404153 Bacteria 9672205
459 2867435127 2867428634 Bacteria 9590268
460 2875397725 2875391855 Bacteria 7600475
461 2877678056 2877676314 Bacteria 9512378
462 2912729164 2912723979 Bacteria 8557534
463 2912763923 2912757875 Bacteria 7940295
464 2919471191 2919468124 Bacteria 9133025
465 2946046799 2946045630 Bacteria 8527308
466 2946070984 2946064051 Bacteria 8957905
467 2947225731 2947224130 Bacteria 9938529
468 2954680049 2954673503 Bacteria 9685905
469 2954684101 2954682443 Bacteria 9862841
470 2954693661 2954691527 Bacteria 10720516
471 2954708756 2954701450 Bacteria 10834262
472 2954713308 2954711539 Bacteria 10867210
473 2954723268 2954721474 Bacteria 10456478
474 2954738560 2954731030 Bacteria 10243860
475 2954742174 2954740390 Bacteria 10229294
476 2954757418 2954749733 Bacteria 10366972
477 2954761153 2954759201 Bacteria 9358192
478 2966599804 2966598605 Bacteria 7676064
479 2990061796 2990059506 Bacteria 9321252
480 8008563978 8008558824 Bacteria 10610750
481 8008576087 8008574985 Bacteria 7815457
482 8023626195 8023623736 Bacteria 8593882
483 8025533080 8025530807 Bacteria 8495698
484 8033685254 8033684223 Bacteria 6906479
485 8048407069 8048406513 Bacteria 8936924
486 8056837042 8056829672 Bacteria 9045328
487 JGI24739J22299_10055973
488 JGI24735J21928_10135930
489 JGI24738J21930_10150568
490 rootH1_10010343
491 rootH1_10066653
492 rootH1_10066654
493 rootH2_10052932
494 rootL2_10181653
495 rootH1_10065195
496 Ga0006562J51391_1059778
497 Ga0006562J51391_1185274
498 Ga0068853_100222530
499 Ga0068855_100332569
500 Ga0068862_101173876
501 Ga0081539_10124576
502 Ga0075368_10016271
503 Ga0075363_100035076
504 Ga0075363_100222521
505 Ga0070715_10851705
506 Ga0075367_10176920
507 Ga0075370_10242786
508 Ga0099826_10181754
509 Ga0105251_10084300
510 Ga0105250_10165075
511 Ga0105248_11018521
512 Ga0105249_11646195
513 Ga0105239_10869413
514 Ga0157372_10163210
515 Ga0182008_10000981
516 Ga0182006_1083733
517 Ga0183367_1001
518 Ga0209758_1018954
519 Ga0207426_1024450
520 Ga0207713_1065539
521 Ga0207647_10054058
522 Ga0207685_10564132
523 Ga0207667_10502085
524 Ga0207639_10012340
525 Ga0207702_10130010
526 Ga0209371_1011030
527 Ga0209282_1400680
528 Ga0209813_10018978
529 Ga0307517_10007152
530 Ga0307515_10000055
531 Ga0307515_10136999
532 Ga0307515_10277197
533 Ga0268256_1011919
534 Ga0307511_10000113
535 Ga0307511_10078831
536 Ga0307511_10192214
537 Ga0307512_10002717
538 Ga0307512_10036816
539 Ga0307513_10080215
540 Ga0307513_10093860
541 Ga0307509_10014761
542 Ga0307509_10016654
543 Ga0307408_100807161
544 Ga0307408_101291975
545 Ga0307508_10035469
546 Ga0307508_10129711
547 Ga0307508_10149523
548 Ga0307508_10805041
549 Ga0307514_10043829
550 Ga0307514_10066598
551 Ga0307514_10200762
552 Ga0307516_10002534
553 Ga0307516_10360244
554 Ga0307518_10002513
555 Ga0307518_10107935
556 Ga0307518_10152462
557 Ga0307409_102197915
558 Ga0307416_100457828
559 Ga0307416_103589052
560 Ga0307507_10005356
561 Ga0307507_10006073
562 Ga0307510_10021380
563 Ga0307510_10123589
564 Ga0307510_10478802
565 Ga0395899_0579490
566 Ga0395900_0115298
567 Ga0395898_0006491
568 Ga0395898_0273684
569 Ga0395898_0396995
570 Ga0395901_0118780
571 Ga0395901_0503451
572 Ga0439436_0000971
573 Ga0439436_0018130
574 Ga0439439_0037612
575 Ga0451789_1152305
576 Ga0451791_1017552
577 Ga0451791_1815008
578 Ga0451795_1600941
579 Ga0451800_1146492
580 Ga0451802_0402445
581 Ga0451807_2339596
582 Ga0451833_0851518
583 Ga0451837_0382226
584 Ga0451843_0377573
585 Ga0451853_0986148
586 Ga0451853_2234632
587 Ga0451853_2677488
588 Ga0439433_0003412
589 Ga0439433_0023341
590 Ga0439442_010756
591 Ga0439448_0015188
592 Ga0439448_0142686
593 Ga0439449_0001133
594 Ga0439449_0017378
595 Ga0439449_0025233
596 Ga0439449_0128673
597 Ga0439455_0010561
598 Ga0439457_001744
599 Ga0439457_016474
600 Ga0439462_0014330
601 Ga0439462_0130932
602 Ga0450894_000285
603 Ga0450896_018925
604 Ga0450902_004978
605 Ga0450903_001336
606 Ga0450906_042429
607 Ga0439458_0000078
608 Ga0450901_007281
609 Ga0466969_0045768
610 Ga0466972_0010705
611 Ga0466972_0011639
612 Ga0466972_0074014
613 Ga0466965_0000877
614 Ga0466965_0158366
615 Ga0466965_0297217
616 Ga0466965_0659646
617 Ga0466966_0003596
618 Ga0466966_0066128
619 Ga0466966_0713954
620 Ga0466961_0011773
621 Ga0466961_0066249
622 Ga0466963_0000819
623 Ga0466963_0001279
624 Ga0466964_0000800
625 Ga0466964_0251726
626 Ga0466971_0000384
627 Ga0466968_0077510
628 Ga0466968_0182862
629 Ga0466968_0514742
630 Ga0466970_0001570
631 Ga0466970_0018425
632 Ga0466957_0000083
633 Ga0466957_0388817
634 Ga0466960_0002028
635 Ga0466959_0003365
636 Ga0466959_1161046
637 Ga0466958_0001876
638 Ga0466958_0365677
639 Ga0466967_0011067
640 Ga0466967_0031232
641 Ga0466967_0160617
642 Ga0495592_0009141
643 Ga0495592_0021737
644 Ga0495603_0001397
645 Ga0495603_0001730
646 Ga0495603_0018011
647 Ga0495603_0026433
648 Ga0495603_0107554
649 Ga0495603_0267839
650 Ga0495590_0176308
651 Ga0495629_0001162
652 Ga0495629_0004297
653 Ga0495629_0010242
654 Ga0495629_0017660
655 Ga0495629_0030316
656 Ga0495629_0053807
657 Ga0495629_0064367
658 Ga0495629_0137713
659 Ga0495638_0169651
660 Ga0495638_0323711
661 Ga0495638_0359721
662 Ga0495638_0671945
663 Ga0495651_0003604
664 Ga0495651_0087059
665 Ga0495653_0322588
666 Ga0495580_0112915
667 Ga0495582_0005596
668 Ga0495582_0127214
669 Ga0495582_0634573
670 Ga0495605_0022971
671 Ga0495605_0030082
672 Ga0495662_0002930
673 Ga0495662_0015626
674 Ga0495662_0063225
675 Ga0495662_0125590
676 Ga0495662_0164169
677 Ga0495662_0244211
678 Ga0495664_0000284
679 Ga0495664_0109216
680 Ga0495664_0133077
681 Ga0495594_0027497
682 Ga0495594_0027627
683 Ga0495594_0034422
684 Ga0495596_0127661
685 Ga0495607_0099540
686 Ga0495607_0518075
687 Ga0495606_0059425
688 Ga0495606_0179007
689 Ga0495608_0034270
690 Ga0495608_0371352
691 Ga0495610_0188963
692 Ga0495610_0255254
693 Ga0495616_0026638
694 Ga0495618_0013427
695 Ga0495618_0162042
696 Ga0495620_0001237
697 Ga0495620_0118401
698 Ga0495628_0034826
699 Ga0495628_0066772
700 Ga0495628_0140919
701 Ga0495630_0084074
702 Ga0495630_0503622
703 Ga0495631_0326932
704 Ga0495637_0109832
705 Ga0495643_0005030
706 Ga0495644_0118387
707 Ga0495648_0518158
708 Ga0495666_0009195
709 Ga0495642_0306425
710 Ga0495642_0381764
711 Ga0495652_0180527
712 Ga0495654_0173038
713 Ga0495640_0037327
714 Ga0495586_0032547
715 Ga0495586_0561901
716 Ga0495587_0015688
717 Ga0495587_0080276
718 Ga0495609_0249199
719 Ga0495609_0346904
720 Ga0495597_0107343
721 Ga0495645_0007603
722 Ga0495622_0233225
723 Ga0495633_0029576
724 Ga0495633_0503443
725 Ga0495667_0232097
726 Ga0495667_0259029
727 Ga0495667_0944379
728 Ga0495656_0619854
729 Ga0495668_0008152
730 Ga0495634_0029786
731 Ga0495634_0051320
732 Ga0495634_0281837
733 Ga0495611_0054459
734 Ga0495611_0090339
735 Ga0495625_0061061
736 Ga0495625_0062863
737 Ga0495625_0125238
738 Ga0495625_0844213
739 Ga0495635_0034723
740 Ga0495635_0048822
741 Ga0495635_0128775
742 Ga0495661_0066279
743 Ga0495661_0410152
744 Ga0495588_0009045
745 Ga0495588_0031937
746 Ga0495588_0058643
747 Ga0495588_0082221
748 Ga0495657_0013713
749 Ga0495657_0017511
750 Ga0495657_0058222
751 Ga0495657_0084480
752 Ga0495599_0364301
753 Ga0495623_0201564
754 Ga0495646_0021598
755 Ga0495646_0183661
756 Ga0495658_0057887
757 Ga0495613_0000504
758 Ga0495613_0005547
759 Ga0495613_0008342
760 Ga0495613_0010667
761 Ga0495613_0028656
762 Ga0495613_0036744
763 Ga0495613_0126276
764 Ga0495613_0227814
765 Ga0495624_0072548
766 Ga0495624_0198824
767 Ga0495624_0217826
768 Ga0495624_0369495
769 Ga0495670_0113322
770 Ga0495671_0002239
771 Ga0495671_0130875
772 Ga0495649_0015490
773 Ga0495649_0068661
774 Ga0495649_0176263
775 Ga0495589_0018113
776 Ga0495589_0023029
777 Ga0495589_0023869
778 Ga0495589_0085666
779 Ga0495589_0169958
780 Ga0495600_0002413
781 Ga0495600_0209685
782 Ga0495581_0006949
783 Ga0495581_0013215
784 Ga0495581_0536623
785 Ga0495581_0612510
786 Ga0495581_0737935
787 Ga0495604_0000224
788 Ga0495604_0071421
789 Ga0495604_0092866
790 Ga0495636_0001077
791 Ga0495636_0002430
792 Ga0495636_0083984
793 Ga0495636_0168587
794 Ga0495676_0002248
795 Ga0495676_0022783
796 Ga0495676_0030375
797 Ga0495676_0045523
798 Ga0495676_0055205
799 Ga0495676_0066378
800 Ga0495676_0196183
801 Ga0495680_0019551
802 Ga0495680_0045837
803 Ga0495683_0185652
804 Ga0495683_0394855
805 Ga0495687_003403
806 Ga0495687_032159
807 Ga0495687_035436
808 Ga0495687_047989
809 Ga0495687_049064
810 Ga0495687_204107
811 Ga0495675_0006540
812 Ga0495675_0017127
813 Ga0495677_0342038
814 Ga0495677_0395335
815 Ga0495685_005824
816 Ga0495685_007359
817 Ga0495685_009508
818 Ga0495685_024445
819 Ga0495685_166355
820 Ga0495685_289655
821 Ga0495681_0003871
822 Ga0495684_0071379
823 Ga0495684_0570686
824 Ga0495686_0033719
825 Ga0495686_0149993
826 Ga0495686_0736204
827 Ga0495593_0227461
828 Ga0495602_0017348
829 Ga0495614_0000523
830 Ga0495614_0007482
831 Ga0495614_0008977
832 Ga0495614_0073148
833 Ga0495614_0097504
834 Ga0496108_0271474
835 Ga0496109_0022553
836 Ga0496110_0790037
837 Ga0496120_0413228
838 Ga0495678_098294
839 Ga0495682_0169327
840 Ga0501031_0039800
841 Ga0501031_0545632
842 Ga0501032_0176298
843 Ga0501032_0213100
844 Ga0501033_0009016
845 Ga0501033_0183343
846 Ga0501033_1091277
847 Ga0501034_0013798
848 Ga0501034_0035036
849 Ga0501034_0038727
850 Ga0501034_0055881
851 Ga0501036_0705747
852 Ga0501037_0044384
853 Ga0501037_0105186
854 Ga0501037_0266070
855 Ga0501037_0628752
856 Ga0501038_0003776
857 Ga0501038_0016781
858 Ga0501039_0868907
859 Ga0501042_0010628
860 Ga0501043_0005513
861 Ga0501043_0111282
862 Ga0501043_0125242
863 Ga0501043_0348198
864 Ga0501046_0076305
865 Ga0501046_0102428
866 Ga0501046_0103312
867 Ga0501046_0119657
868 Ga0501047_0003466
869 Ga0501047_0089396
870 Ga0501047_0349853
871 Ga0501047_0491675
872 Ga0501048_0007183
873 Ga0501048_0305246
874 Ga0501048_0946816
875 Ga0501070_0119950
876 Ga0501070_0843447
877 Ga0501074_0376023
878 Ga0501225_0352530
879 Ga0501080_0033661
880 Ga0501080_0907110
881 Ga0501083_0757328
882 Ga0501083_0924151
883 Ga0501035_0026934
884 Ga0501035_0043543
885 Ga0501035_0078548
886 Ga0501035_0180760
887 Ga0501035_0345011
888 Ga0501044_0000295
889 Ga0501044_0001055
890 Ga0501044_0020657
891 Ga0501044_0089571
892 Ga0501044_0205242
893 Ga0501044_0280343
894 Ga0501044_0511360
895 Ga0501045_0017828
896 nmdc:mga03n38_168151_c1
897 nmdc:mga03n38_595825_c1
898 nmdc:mga06z11_195772_c1
899 nmdc:mga04h51_22564_c1
900 nmdc:mga07m45_137927_c1
901 nmdc:mga07m45_874287_c1
902 Ga0495612_0060624
903 Ga0500635_0253776
904 Ga0495655_0024521
905 Ga0495619_0034341
906 Ga0500644_0004390
907 Ga0500640_017809
908 Ga0500560_002311
909 Ga0500572_003121
910 Ga0500559_0229263
911 Ga0500634_0243939
912 Ga0466962_0000664
913 Ga0466962_0012674
914 Ga0466962_0042558
915 3006396747
916 2547410310
917 2554260741
918 2585298188
919 2585304666
920 2585314704
921 2616698280
922 2616901453
923 2643762088
924 2643901965
925 2644261946
926 2644408109
927 2644438872
928 2644459133
929 2784591653
930 2785340074
931 2785372658
932 2786675324
933 2808845013
934 2808914608
935 2809235283
936 2811843511
937 2812354679
938 2819698820
939 2852636297
940 2862184027
941 2862283388
942 2862383703
943 2863409884
944 2867435127
945 2875397725
946 2877678056
947 2912729164
948 2912763923
949 2919471191
950 2946046799
951 2946070984
952 2947225731
953 2954680049
954 2954684101
955 2954693661
956 2954708756
957 2954713308
958 2954723268
959 2954738560
960 2954742174
961 2954757418
962 2954761153
963 2966599804
964 2990061796
965 8008563978
966 8008576087
967 8023626195
968 8025533080
969 8033685254
970 8048407069
971 8056837042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

125

0.74

PF18029

Glyoxalase_6

Glyoxalase-like domain

23

126

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.8966 1 112
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.8678 1 112
8aid-assembly2.cif.gz_D crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 0.8627 4 115
8aid-assembly2.cif.gz_D crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 0.836 4 115
5zbd-assembly1.cif.gz_B crystal structure of tryptophan oxidase (c395a mutant) from chromobacterium violaceum 0.7534 82 113
ID Description Score Start End Superfamily
3r6aA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8725 2 115 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8679 65 115 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8424 65 110 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.802 65 112 3.30.720.110
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7612 65 115 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A1H4KBG4-F1-model_v4 VOC domain-containing protein 0.9784 65 112
AF-A0A0U3KFY3-F1-model_v4 Uncharacterized protein 0.9744 65 112
AF-A0A7J0CRT3-F1-model_v4 VOC domain-containing protein 0.9714 65 112
AF-L7LP97-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9694 65 112
AF-A0A6N7YPG6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9614 65 112

Map