F453172

General Info

Members Datasets Scaffolds Average Seq Length
485 255 970 208

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0004016|Ga0501034_0004016_10600_11253
Length 195
Sequence MLGQLYDRALGGERCWIRHDDGELRPLPAHRWLGVRCPGDGSDMCTGPTIELGCGPGRLVARLIQRGIPALGIDRSATAIQLAGRGGAPALLGDVFEPLPGMGLWQTVLLVDGNVGLGGDPRRILGRAFELLACGGRCVAEFEAEAIGICSRWVRLEAWASVGVDSAAALAAQVGLTLTGVRLVGGRVIADLTAR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
235 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
249 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
250 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
251 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
252 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
253 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
254 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
255 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.94
Nodule 0.21
Rhizoplane 9.69
Rhizosphere 67.42
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0004016 3300049571 Bacteria 16506
2 JGI24744J21845_10003837 3300002077 Bacteria 3106
3 Ga0070676_10241804 3300005328 Bacteria 1201
4 Ga0070677_10054900 3300005333 Bacteria 1624
5 Ga0068869_100029804 3300005334 Bacteria 3827
6 Ga0068869_100066725 3300005334 Bacteria 2652
7 Ga0070666_10172075 3300005335 Bacteria 1517
8 Ga0070682_100013115 3300005337 Bacteria 4760
9 Ga0068868_100000483 3300005338 Bacteria 26462
10 Ga0068868_100308417 3300005338 Bacteria 1346
11 Ga0068868_100353392 3300005338 Bacteria 1259
12 Ga0070660_100193350 3300005339 Bacteria 1649
13 Ga0070660_100413483 3300005339 Bacteria 1116
14 Ga0070691_10003447 3300005341 Bacteria 7110
15 Ga0070661_100863171 3300005344 Bacteria 745
16 Ga0070692_10080387 3300005345 Bacteria 1754
17 Ga0070668_100000385 3300005347 Bacteria 29197
18 Ga0070668_100036201 3300005347 Bacteria 3765
19 Ga0070668_100798465 3300005347 Bacteria 838
20 Ga0070669_100006500 3300005353 Bacteria 8416
21 Ga0070675_100009415 3300005354 Bacteria 7600
22 Ga0070671_100009817 3300005355 Bacteria 7681
23 Ga0070671_100055261 3300005355 Bacteria 3303
24 Ga0070671_100297935 3300005355 Bacteria 1373
25 Ga0070674_100001147 3300005356 Bacteria 13956
26 Ga0070674_100185749 3300005356 Bacteria 1595
27 Ga0070673_100654860 3300005364 Bacteria 962
28 Ga0070688_100010458 3300005365 Bacteria 5116
29 Ga0070688_100041807 3300005365 Bacteria 2816
30 Ga0070659_100193936 3300005366 Bacteria 1670
31 Ga0070659_100258743 3300005366 Bacteria 1444
32 Ga0070667_100002282 3300005367 Bacteria 16878
33 Ga0070667_100002722 3300005367 Bacteria 15296
34 Ga0070667_100204578 3300005367 Bacteria 1753
35 Ga0070703_10019616 3300005406 Bacteria 1961
36 Ga0070709_10004515 3300005434 Bacteria 7508
37 Ga0070709_10007241 3300005434 Bacteria 6079
38 Ga0070714_100325681 3300005435 Bacteria 1438
39 Ga0070713_100932509 3300005436 Bacteria 836
40 Ga0070710_10001246 3300005437 Bacteria 12078
41 Ga0070711_100000197 3300005439 Bacteria 31831
42 Ga0070711_100083573 3300005439 Bacteria 2282
43 Ga0070705_100011744 3300005440 Bacteria 4430
44 Ga0070700_100001650 3300005441 Bacteria 11173
45 Ga0070694_100006852 3300005444 Bacteria 6923
46 Ga0070663_100029232 3300005455 Bacteria 3763
47 Ga0070663_100064090 3300005455 Bacteria 2656
48 Ga0070678_100001200 3300005456 Bacteria 13776
49 Ga0070678_100434089 3300005456 Bacteria 1147
50 Ga0070662_100003299 3300005457 Bacteria 10054
51 Ga0070662_100125358 3300005457 Bacteria 1973
52 Ga0068867_100006517 3300005459 Bacteria 8247
53 Ga0070685_10203322 3300005466 Bacteria 1289
54 Ga0070685_10468222 3300005466 Bacteria 886
55 Ga0070685_10679400 3300005466 Bacteria 749
56 Ga0070684_100697229 3300005535 Bacteria 946
57 Ga0070697_100267963 3300005536 Bacteria 1463
58 Ga0068853_100016079 3300005539 Bacteria 6153
59 Ga0068853_100206457 3300005539 Bacteria 1789
60 Ga0068853_100994503 3300005539 Bacteria 807
61 Ga0070672_100156354 3300005543 Bacteria 1889
62 Ga0070695_100028699 3300005545 Bacteria 3454
63 Ga0070696_100005763 3300005546 Bacteria 8270
64 Ga0070693_100015732 3300005547 Bacteria 3901
65 Ga0070665_100010069 3300005548 Bacteria 9570
66 Ga0070665_100011098 3300005548 Bacteria 9102
67 Ga0070665_100038994 3300005548 Bacteria 4777
68 Ga0070665_100202050 3300005548 Bacteria 1988
69 Ga0070665_100313795 3300005548 Bacteria 1572
70 Ga0070704_100000219 3300005549 Bacteria 24091
71 Ga0070704_100607690 3300005549 Bacteria 962
72 Ga0068855_100685468 3300005563 Bacteria 1098
73 Ga0070664_100379132 3300005564 Bacteria 1291
74 Ga0068854_100003036 3300005578 Bacteria 10437
75 Ga0068856_100571609 3300005614 Bacteria 1152
76 Ga0070702_100000458 3300005615 Bacteria 14558
77 Ga0070702_100251008 3300005615 Bacteria 1199
78 Ga0068852_100045916 3300005616 Bacteria 3719
79 Ga0068852_100150057 3300005616 Bacteria 2167
80 Ga0068852_100921715 3300005616 Bacteria 891
81 Ga0068859_100006560 3300005617 Bacteria 11812
82 Ga0068859_100020437 3300005617 Bacteria 6645
83 Ga0068859_100633273 3300005617 Bacteria 1162
84 Ga0068864_100162249 3300005618 Bacteria 2032
85 Ga0068866_10002121 3300005718 Bacteria 8255
86 Ga0068866_10055258 3300005718 Bacteria 2038
87 Ga0068861_100004067 3300005719 Bacteria 9799
88 Ga0068861_100105954 3300005719 Bacteria 2245
89 Ga0068861_100188910 3300005719 Bacteria 1721
90 Ga0068861_100934222 3300005719 Bacteria 824
91 Ga0068870_10036643 3300005840 Bacteria 2524
92 Ga0068863_100002251 3300005841 Bacteria 19166
93 Ga0068863_100038449 3300005841 Bacteria 4552
94 Ga0068863_100127168 3300005841 Bacteria 2432
95 Ga0068863_100427400 3300005841 Bacteria 1298
96 Ga0068858_100004503 3300005842 Bacteria 13656
97 Ga0068858_100011653 3300005842 Bacteria 8293
98 Ga0068858_100086310 3300005842 Bacteria 2919
99 Ga0068860_100000186 3300005843 Bacteria 98982
100 Ga0068860_100005606 3300005843 Bacteria 12682
101 Ga0068860_100238010 3300005843 Bacteria 1770
102 Ga0068862_100000018 3300005844 Bacteria 231245
103 Ga0068862_100002385 3300005844 Bacteria 16701
104 Ga0068862_100402774 3300005844 Bacteria 1280
105 Ga0075365_10103887 3300006038 Bacteria 1948
106 Ga0075365_10189243 3300006038 Bacteria 1440
107 Ga0075365_10229863 3300006038 Bacteria 1302
108 Ga0075365_10267607 3300006038 Bacteria 1202
109 Ga0075368_10054976 3300006042 Bacteria 1587
110 Ga0075363_100011910 3300006048 Bacteria 4177
111 Ga0075363_100024060 3300006048 Bacteria 3093
112 Ga0075363_100034710 3300006048 Bacteria 2634
113 Ga0075363_100044539 3300006048 Bacteria 2351
114 Ga0075363_100084146 3300006048 Bacteria 1744
115 Ga0075363_100477273 3300006048 Bacteria 739
116 Ga0075364_10007181 3300006051 Bacteria 6594
117 Ga0075364_10011718 3300006051 Bacteria 5335
118 Ga0075364_10031632 3300006051 Bacteria 3399
119 Ga0075364_10036740 3300006051 Bacteria 3168
120 Ga0075364_10155001 3300006051 Bacteria 1545
121 Ga0075364_10181560 3300006051 Bacteria 1424
122 Ga0075364_10183751 3300006051 Bacteria 1415
123 Ga0070715_10001384 3300006163 Bacteria 7009
124 Ga0070715_10063254 3300006163 Bacteria 1631
125 Ga0070716_100006481 3300006173 Bacteria 5719
126 Ga0070716_100406770 3300006173 Bacteria 980
127 Ga0070712_100000786 3300006175 Bacteria 18763
128 Ga0070712_100026611 3300006175 Bacteria 3855
129 Ga0075362_10058739 3300006177 Bacteria 1735
130 Ga0075362_10090928 3300006177 Bacteria 1417
131 Ga0075362_10122896 3300006177 Bacteria 1230
132 Ga0075367_10010827 3300006178 Bacteria 4806
133 Ga0075367_10053859 3300006178 Bacteria 2385
134 Ga0075367_10151105 3300006178 Bacteria 1441
135 Ga0075369_10002015 3300006186 Bacteria 7157
136 Ga0075369_10004580 3300006186 Bacteria 5126
137 Ga0075369_10007832 3300006186 Bacteria 4088
138 Ga0075369_10008250 3300006186 Bacteria 4003
139 Ga0075369_10013922 3300006186 Bacteria 3204
140 Ga0075369_10022723 3300006186 Bacteria 2589
141 Ga0075369_10025288 3300006186 Bacteria 2467
142 Ga0075369_10070847 3300006186 Bacteria 1534
143 Ga0075369_10080567 3300006186 Bacteria 1443
144 Ga0075370_10000928 3300006353 Bacteria 12046
145 Ga0075370_10006110 3300006353 Bacteria 6039
146 Ga0075370_10025129 3300006353 Bacteria 3292
147 Ga0075370_10032937 3300006353 Bacteria 2900
148 Ga0075370_10100594 3300006353 Bacteria 1673
149 Ga0075370_10150503 3300006353 Bacteria 1364
150 Ga0068871_100741082 3300006358 Bacteria 902
151 Ga0075428_100011360 3300006844 Bacteria 9905
152 Ga0075430_100103622 3300006846 Bacteria 2375
153 Ga0075431_100171129 3300006847 Bacteria 2232
154 Ga0068865_100001721 3300006881 Bacteria 12840
155 Ga0068865_100045924 3300006881 Bacteria 2995
156 Ga0097620_100006560 3300006931 Bacteria 11812
157 Ga0097620_100020437 3300006931 Bacteria 6645
158 Ga0097620_100633345 3300006931 Bacteria 1162
159 Ga0097620_101311560 3300006931 Bacteria 798
160 Ga0105245_10006314 3300009098 Bacteria 10432
161 Ga0105245_10231419 3300009098 Bacteria 1788
162 Ga0105247_10000696 3300009101 Bacteria 26401
163 Ga0105247_10025969 3300009101 Bacteria 3535
164 Ga0105243_10001347 3300009148 Bacteria 21882
165 Ga0105241_10219869 3300009174 Bacteria 1596
166 Ga0105242_10000373 3300009176 Bacteria 35638
167 Ga0105248_10084472 3300009177 Bacteria 3571
168 Ga0105248_10230488 3300009177 Bacteria 2085
169 Ga0105237_10002512 3300009545 Bacteria 22710
170 Ga0105237_10602310 3300009545 Bacteria 1106
171 Ga0105238_10202740 3300009551 Bacteria 1960
172 Ga0105238_10364365 3300009551 Bacteria 1435
173 Ga0105249_10015053 3300009553 Bacteria 6843
174 Ga0105249_10104376 3300009553 Bacteria 2671
175 Ga0105249_10640623 3300009553 Bacteria 1120
176 Ga0105239_10008769 3300010375 Bacteria 11446
177 Ga0105239_10118972 3300010375 Bacteria 2932
178 Ga0105239_10605128 3300010375 Bacteria 1250
179 Ga0105246_10038418 3300011119 Bacteria 3219
180 Ga0105246_10202990 3300011119 Bacteria 1542
181 Ga0157378_10002499 3300013297 Bacteria 16362
182 Ga0157378_10080277 3300013297 Bacteria 2947
183 Ga0163162_10008072 3300013306 Bacteria 10273
184 Ga0163162_10187473 3300013306 Bacteria 2196
185 Ga0163162_10228161 3300013306 Bacteria 1992
186 Ga0163162_10384564 3300013306 Bacteria 1537
187 Ga0157372_10023509 3300013307 Bacteria 6682
188 Ga0157372_11355924 3300013307 Bacteria 820
189 Ga0157375_10000487 3300013308 Bacteria 35984
190 Ga0163163_10036396 3300014325 Bacteria 4781
191 Ga0157380_10005863 3300014326 Bacteria 8596
192 Ga0157380_10112983 3300014326 Bacteria 2286
193 Ga0157377_10024882 3300014745 Bacteria 3187
194 Ga0157377_10084412 3300014745 Bacteria 1863
195 Ga0157379_10009349 3300014968 Bacteria 8538
196 Ga0157379_10510219 3300014968 Bacteria 1115
197 Ga0157376_10133214 3300014969 Bacteria 2221
198 Ga0163161_10018232 3300017792 Bacteria 4920
199 Ga0163161_10068571 3300017792 Bacteria 2592
200 Ga0213876_10061037 3300021384 Bacteria 1989
201 Ga0213875_10066570 3300021388 Bacteria 1683
202 Ga0209673_1018257 3300025273 Bacteria 2558
203 Ga0209051_1001058 3300025303 Bacteria 25726
204 Ga0207653_10054425 3300025885 Bacteria 1338
205 Ga0207692_10003859 3300025898 Bacteria 5887
206 Ga0207692_10024457 3300025898 Bacteria 2808
207 Ga0207642_10016544 3300025899 Bacteria 2781
208 Ga0207642_10028431 3300025899 Bacteria 2302
209 Ga0207642_10299257 3300025899 Bacteria 932
210 Ga0207710_10000006 3300025900 Bacteria 538831
211 Ga0207710_10003466 3300025900 Bacteria 7030
212 Ga0207710_10142438 3300025900 Bacteria 1158
213 Ga0207688_10000196 3300025901 Bacteria 26802
214 Ga0207688_10000812 3300025901 Bacteria 15629
215 Ga0207647_10074634 3300025904 Bacteria 2042
216 Ga0207699_10066244 3300025906 Bacteria 2192
217 Ga0207699_10124868 3300025906 Bacteria 1670
218 Ga0207645_10040369 3300025907 Bacteria 2988
219 Ga0207654_10093175 3300025911 Bacteria 1841
220 Ga0207671_10006488 3300025914 Bacteria 10413
221 Ga0207693_10004850 3300025915 Bacteria 11319
222 Ga0207693_10020023 3300025915 Bacteria 5323
223 Ga0207663_10002207 3300025916 Bacteria 9315
224 Ga0207663_10075658 3300025916 Bacteria 2185
225 Ga0207662_10281940 3300025918 Bacteria 1100
226 Ga0207657_10109791 3300025919 Bacteria 2279
227 Ga0207657_10591320 3300025919 Bacteria 866
228 Ga0207681_10000371 3300025923 Bacteria 31749
229 Ga0207681_10004653 3300025923 Bacteria 8437
230 Ga0207681_10065934 3300025923 Bacteria 2505
231 Ga0207694_10504765 3300025924 Bacteria 1013
232 Ga0207659_10072314 3300025926 Bacteria 2520
233 Ga0207687_10024562 3300025927 Bacteria 4028
234 Ga0207687_10040030 3300025927 Bacteria 3211
235 Ga0207700_10436090 3300025928 Bacteria 1153
236 Ga0207644_10255260 3300025931 Bacteria 1400
237 Ga0207706_10008091 3300025933 Bacteria 9703
238 Ga0207706_10009019 3300025933 Bacteria 9180
239 Ga0207686_10003015 3300025934 Bacteria 9073
240 Ga0207686_10100617 3300025934 Bacteria 1929
241 Ga0207709_10016481 3300025935 Bacteria 4108
242 Ga0207709_10141511 3300025935 Bacteria 1654
243 Ga0207709_10243010 3300025935 Bacteria 1311
244 Ga0207670_10059304 3300025936 Bacteria 2603
245 Ga0207669_10003734 3300025937 Bacteria 6615
246 Ga0207669_10042304 3300025937 Bacteria 2658
247 Ga0207704_10003331 3300025938 Bacteria 7288
248 Ga0207704_10087154 3300025938 Bacteria 2038
249 Ga0207665_10000947 3300025939 Bacteria 19623
250 Ga0207665_10016016 3300025939 Bacteria 4924
251 Ga0207665_10336917 3300025939 Bacteria 1136
252 Ga0207711_10000080 3300025941 Bacteria 103331
253 Ga0207711_10067156 3300025941 Bacteria 3103
254 Ga0207711_10672232 3300025941 Bacteria 966
255 Ga0207689_10006811 3300025942 Bacteria 10052
256 Ga0207689_10039954 3300025942 Bacteria 3883
257 Ga0207667_10041449 3300025949 Bacteria 4896
258 Ga0207651_10233834 3300025960 Bacteria 1494
259 Ga0207712_10000061 3300025961 Bacteria 136114
260 Ga0207712_10012781 3300025961 Bacteria 5368
261 Ga0207712_10053306 3300025961 Bacteria 2837
262 Ga0207712_10594045 3300025961 Bacteria 957
263 Ga0207668_10001177 3300025972 Bacteria 15533
264 Ga0207668_10005147 3300025972 Bacteria 7694
265 Ga0207668_10713202 3300025972 Bacteria 882
266 Ga0207640_10009734 3300025981 Bacteria 5387
267 Ga0207658_10000123 3300025986 Bacteria 84341
268 Ga0207658_10001454 3300025986 Bacteria 18467
269 Ga0207658_10009627 3300025986 Bacteria 6558
270 Ga0207677_10000670 3300026023 Bacteria 20364
271 Ga0207677_10257744 3300026023 Bacteria 1420
272 Ga0207703_10065728 3300026035 Bacteria 2981
273 Ga0207639_10013326 3300026041 Bacteria 5752
274 Ga0207639_10994872 3300026041 Bacteria 785
275 Ga0207678_10007937 3300026067 Bacteria 9359
276 Ga0207678_10062675 3300026067 Bacteria 3195
277 Ga0207708_10001599 3300026075 Bacteria 16873
278 Ga0207708_10013634 3300026075 Bacteria 6072
279 Ga0207641_10004140 3300026088 Bacteria 12636
280 Ga0207641_10236236 3300026088 Bacteria 1701
281 Ga0207641_10574495 3300026088 Bacteria 1101
282 Ga0207648_10000671 3300026089 Bacteria 38354
283 Ga0207648_10011295 3300026089 Bacteria 8420
284 Ga0207676_10075414 3300026095 Bacteria 2721
285 Ga0207675_100000388 3300026118 Bacteria 42128
286 Ga0207675_100024639 3300026118 Bacteria 5594
287 Ga0207675_100054336 3300026118 Bacteria 3736
288 Ga0207683_10000929 3300026121 Bacteria 26957
289 Ga0207683_10158145 3300026121 Bacteria 2047
290 Ga0207683_10922159 3300026121 Bacteria 811
291 Ga0207698_10193696 3300026142 Bacteria 1813
292 Ga0207698_10306337 3300026142 Bacteria 1481
293 Ga0209813_10003181 3300027866 Bacteria 3824
294 Ga0268266_10009541 3300028379 Bacteria 8541
295 Ga0268266_10015289 3300028379 Bacteria 6588
296 Ga0268266_10037454 3300028379 Bacteria 4132
297 Ga0268266_10044788 3300028379 Bacteria 3783
298 Ga0268265_10000005 3300028380 Bacteria 535350
299 Ga0268265_10017442 3300028380 Bacteria 4954
300 Ga0268265_10031847 3300028380 Bacteria 3812
301 Ga0268265_10265692 3300028380 Bacteria 1528
302 Ga0268265_10303880 3300028380 Bacteria 1438
303 Ga0268264_10000177 3300028381 Bacteria 135644
304 Ga0268264_10495912 3300028381 Bacteria 1190
305 Ga0265327_10000850 3300031251 Bacteria 45645
306 Ga0265327_10127326 3300031251 Unclassified 1201
307 Ga0316578_10172243 3300031728 Bacteria 1305
308 Ga0307405_10238712 3300031731 Bacteria 1345
309 Ga0307413_10130461 3300031824 Bacteria 1719
310 Ga0307413_10210385 3300031824 Bacteria 1412
311 Ga0307410_10078102 3300031852 Bacteria 2316
312 Ga0307410_10198637 3300031852 Bacteria 1530
313 Ga0307406_10166545 3300031901 Bacteria 1590
314 Ga0307416_100022439 3300032002 Bacteria 4557
315 Ga0307416_100211991 3300032002 Bacteria 1849
316 Ga0307415_100032149 3300032126 Bacteria 3390
317 Ga0373943_0102834 3300035170 Bacteria 1497
318 Ga0373931_0062161 3300035691 Bacteria 2016
319 Ga0373931_0125578 3300035691 Bacteria 1471
320 Ga0436364_1423249 3300037853 Bacteria 25823
321 Ga0436365_0422923 3300039437 Bacteria 7447
322 Ga0436365_0778904 3300039437 Bacteria 1066
323 Ga0439461_0001093 3300041410 Bacteria 4092
324 Ga0439466_0001265 3300041411 Bacteria 9825
325 Ga0439466_0006281 3300041411 Bacteria 4523
326 Ga0439465_0002821 3300041413 Bacteria 5693
327 Ga0439465_0002857 3300041413 Bacteria 5655
328 Ga0439465_0019385 3300041413 Bacteria 2126
329 Ga0439445_0012240 3300042004 Bacteria 2059
330 Ga0439435_0021394 3300042436 Bacteria 1679
331 Ga0466965_0004239 3300044683 Bacteria 6375
332 Ga0466963_0011774 3300044694 Bacteria 5334
333 Ga0466968_0143930 3300044735 Bacteria 1092
334 Ga0466957_0324575 3300044842 Bacteria 1039
335 Ga0466957_0572895 3300044842 Bacteria 788
336 Ga0466960_0000316 3300044901 Bacteria 16570
337 Ga0466960_0001990 3300044901 Bacteria 7579
338 Ga0466960_0059619 3300044901 Bacteria 1868
339 Ga0466959_0389110 3300045049 Bacteria 948
340 Ga0466967_0001731 3300045976 Bacteria 13020
341 Ga0495638_0000539 3300046460 Bacteria 43648
342 Ga0495641_0014766 3300046461 Bacteria 4212
343 Ga0495580_0288835 3300046472 Bacteria 1118
344 Ga0495583_0097674 3300046506 Bacteria 1257
345 Ga0495611_0197080 3300046648 Bacteria 940
346 Ga0495658_0200659 3300046683 Bacteria 1243
347 Ga0495624_0185769 3300046690 Bacteria 1265
348 Ga0495649_0051930 3300046694 Bacteria 2223
349 Ga0495604_0565320 3300047317 Bacteria 732
350 Ga0495674_0013448 3300047319 Bacteria 7695
351 Ga0495672_0053398 3300047320 Bacteria 2368
352 Ga0495673_0045777 3300047469 Bacteria 1942
353 Ga0495593_0003943 3300047673 Bacteria 8860
354 Ga0496100_0002060 3300048903 Bacteria 10095
355 Ga0496100_0301983 3300048903 Bacteria 1198
356 Ga0496100_0374283 3300048903 Bacteria 1081
357 Ga0496100_0649007 3300048903 Bacteria 822
358 Ga0496101_0002508 3300048904 Bacteria 11282
359 Ga0496101_0017201 3300048904 Bacteria 4901
360 Ga0496101_0029676 3300048904 Bacteria 3826
361 Ga0496102_0000229 3300048905 Bacteria 73486
362 Ga0496102_0015480 3300048905 Bacteria 6644
363 Ga0496102_0090467 3300048905 Bacteria 2832
364 Ga0496102_0094017 3300048905 Bacteria 2777
365 Ga0496102_0134404 3300048905 Bacteria 2317
366 Ga0496102_0149765 3300048905 Bacteria 2192
367 Ga0496102_0213088 3300048905 Bacteria 1821
368 Ga0496103_0000208 3300048906 Bacteria 58823
369 Ga0496103_0000584 3300048906 Bacteria 28834
370 Ga0496103_0030618 3300048906 Bacteria 3276
371 Ga0496103_0300748 3300048906 Bacteria 1032
372 Ga0496104_0383119 3300048907 Bacteria 1319
373 Ga0496104_0430512 3300048907 Bacteria 1231
374 Ga0496105_0027736 3300048908 Bacteria 4629
375 Ga0496105_0565812 3300048908 Bacteria 886
376 Ga0496106_0000264 3300048909 Bacteria 36882
377 Ga0496106_0059931 3300048909 Bacteria 2884
378 Ga0496106_0184614 3300048909 Bacteria 1657
379 Ga0496107_0058068 3300048910 Bacteria 2797
380 Ga0496107_0059633 3300048910 Bacteria 2762
381 Ga0496107_0462044 3300048910 Bacteria 942
382 Ga0496108_0000246 3300048911 Bacteria 48269
383 Ga0496108_0024221 3300048911 Bacteria 4998
384 Ga0496108_0026785 3300048911 Bacteria 4758
385 Ga0496108_0115090 3300048911 Bacteria 2303
386 Ga0496109_0069121 3300048912 Bacteria 3238
387 Ga0496109_0081426 3300048912 Bacteria 2983
388 Ga0496109_0082171 3300048912 Bacteria 2969
389 Ga0496109_0847990 3300048912 Bacteria 852
390 Ga0496110_0223584 3300048913 Bacteria 1712
391 Ga0496110_0478425 3300048913 Bacteria 1134
392 Ga0496112_0017094 3300048915 Bacteria 6809
393 Ga0496112_0018435 3300048915 Bacteria 6572
394 Ga0496112_0025607 3300048915 Bacteria 5666
395 Ga0496112_0114073 3300048915 Bacteria 2673
396 Ga0496112_0314096 3300048915 Bacteria 1512
397 Ga0496113_0042234 3300048916 Bacteria 3368
398 Ga0496113_0050464 3300048916 Bacteria 3102
399 Ga0496113_0096436 3300048916 Bacteria 2287
400 Ga0496114_0233211 3300048917 Bacteria 1617
401 Ga0496117_0001509 3300048920 Bacteria 33350
402 Ga0496118_0026421 3300048921 Bacteria 4947
403 Ga0496119_0002954 3300048922 Bacteria 18059
404 Ga0496119_0097579 3300048922 Bacteria 1656
405 Ga0496120_0189080 3300048923 Bacteria 1005
406 Ga0496121_0011810 3300048924 Bacteria 9622
407 Ga0496122_0019142 3300048925 Bacteria 6276
408 Ga0496123_0004839 3300048926 Bacteria 13875
409 Ga0496125_0062362 3300048928 Bacteria 2981
410 Ga0496126_0012559 3300048929 Bacteria 8670
411 Ga0496126_0324594 3300048929 Bacteria 1264
412 Ga0501034_0057484 3300049571 Bacteria 3911
413 Ga0501034_0562497 3300049571 Bacteria 1049
414 Ga0501036_0036747 3300049572 Bacteria 4145
415 Ga0501037_0004758 3300049573 Bacteria 9873
416 Ga0501043_0100817 3300049579 Bacteria 2270
417 Ga0501043_0350270 3300049579 Bacteria 1122
418 Ga0501046_0045825 3300049580 Bacteria 3471
419 Ga0501047_0216639 3300049581 Bacteria 1771
420 Ga0501048_0032185 3300049582 Bacteria 3791
421 Ga0501069_0070072 3300049585 Bacteria 1964
422 Ga0501070_0005341 3300049586 Bacteria 10957
423 Ga0501073_0025852 3300049589 Bacteria 4206
424 Ga0501080_0065995 3300049742 Bacteria 3366
425 Ga0501080_0139369 3300049742 Bacteria 2243
426 Ga0501083_0169869 3300049744 Bacteria 1425
427 Ga0501035_0007357 3300049822 Bacteria 10290
428 Ga0501044_0007519 3300049823 Bacteria 11985
429 nmdc:mga03683_131091_c1 3300050489 Bacteria 1121
430 nmdc:mga03683_40142_c1 3300050489 Bacteria 1918
431 nmdc:mga03683_69318_c1 3300050489 Bacteria 1504
432 nmdc:mga03n38_11170_c1 3300050490 Bacteria 3337
433 nmdc:mga03n38_13619_c1 3300050490 Bacteria 3095
434 nmdc:mga03n38_17371_c1 3300050490 Bacteria 2817
435 nmdc:mga03n38_23479_c1 3300050490 Bacteria 2509
436 nmdc:mga03n38_27802_c1 3300050490 Bacteria 2350
437 nmdc:mga03n38_38751_c1 3300050490 Bacteria 2063
438 nmdc:mga03n38_46076_c1 3300050490 Bacteria 1923
439 nmdc:mga03n38_68115_c1 3300050490 Bacteria 1640
440 nmdc:mga00v17_11432_c1 3300050491 Bacteria 4878
441 nmdc:mga00v17_223421_c1 3300050491 Bacteria 1219
442 nmdc:mga00v17_250941_c1 3300050491 Bacteria 1147
443 nmdc:mga00v17_4649_c1 3300050491 Bacteria 7163
444 nmdc:mga00v17_6240_c1 3300050491 Bacteria 6319
445 nmdc:mga00v17_63660_c1 3300050491 Bacteria 2272
446 nmdc:mga0yw44_108396_c1 3300050492 Bacteria 1777
447 nmdc:mga0yw44_59407_c1 3300050492 Bacteria 2339
448 nmdc:mga06z11_128150_c1 3300050494 Bacteria 1422
449 nmdc:mga06z11_143103_c1 3300050494 Bacteria 1353
450 nmdc:mga06z11_3413_c1 3300050494 Bacteria 6137
451 nmdc:mga07m45_1181_c1 3300050496 Bacteria 11776
452 nmdc:mga07m45_140861_c1 3300050496 Bacteria 1397
453 nmdc:mga07m45_370032_c1 3300050496 Bacteria 832
454 nmdc:mga0qj67_230466_c1 3300050509 Bacteria 1503
455 nmdc:mga06r32_202000_c1 3300050510 Bacteria 1975
456 nmdc:mga0sz30_25438_c1 3300050516 Bacteria 2420
457 nmdc:mga0sz30_34555_c1 3300050516 Bacteria 2105
458 nmdc:mga0sz30_56424_c1 3300050516 Bacteria 1673
459 nmdc:mga0sz30_8291_c1 3300050516 Bacteria 3919
460 nmdc:mga0sz30_84638_c1 3300050516 Bacteria 1375
461 nmdc:mga0sz30_95263_c1 3300050516 Bacteria 1298
462 Ga0500610_0002920 3300053079 Bacteria 6437
463 Ga0495655_0034102 3300053083 Bacteria 1257
464 Ga0495619_0048143 3300053085 Bacteria 2809
465 Ga0500643_010632 3300053087 Bacteria 3411
466 Ga0500556_0003702 3300053104 Bacteria 4441
467 Ga0500595_053869 3300053119 Bacteria 1237
468 Ga0500642_0098471 3300053130 Bacteria 1358
469 Ga0500652_145540 3300053131 Bacteria 985
470 Ga0500559_0041572 3300053136 Bacteria 2004
471 Ga0500604_0114531 3300053151 Bacteria 898
472 Ga0500616_0103947 3300053153 Bacteria 1383
473 Ga0500620_023532 3300053155 Bacteria 1870
474 Ga0500627_0003967 3300053158 Bacteria 4674
475 Ga0500627_0089418 3300053158 Bacteria 1378
476 Ga0500645_000176 3300053730 Bacteria 50665
477 Ga0500645_019177 3300053730 Bacteria 2130
478 2644638834 2643221715 Bacteria 6671032
479 2738702763 2738541274 Bacteria 6909446
480 2739329672 2738543028 Bacteria 6917070
481 2842135040 2842134933 Bacteria 5847019
482 2902794540 2902792274 Bacteria 7270173
483 2902803092 2902799365 Bacteria 5419524
484 2902813969 2902810491 Bacteria 6794147
485 2929213308 2929212328 Bacteria 7708288
486 Ga0501034_0004016
487 JGI24744J21845_10003837
488 Ga0070676_10241804
489 Ga0070677_10054900
490 Ga0068869_100029804
491 Ga0068869_100066725
492 Ga0070666_10172075
493 Ga0070682_100013115
494 Ga0068868_100000483
495 Ga0068868_100308417
496 Ga0068868_100353392
497 Ga0070660_100193350
498 Ga0070660_100413483
499 Ga0070691_10003447
500 Ga0070661_100863171
501 Ga0070692_10080387
502 Ga0070668_100000385
503 Ga0070668_100036201
504 Ga0070668_100798465
505 Ga0070669_100006500
506 Ga0070675_100009415
507 Ga0070671_100009817
508 Ga0070671_100055261
509 Ga0070671_100297935
510 Ga0070674_100001147
511 Ga0070674_100185749
512 Ga0070673_100654860
513 Ga0070688_100010458
514 Ga0070688_100041807
515 Ga0070659_100193936
516 Ga0070659_100258743
517 Ga0070667_100002282
518 Ga0070667_100002722
519 Ga0070667_100204578
520 Ga0070703_10019616
521 Ga0070709_10004515
522 Ga0070709_10007241
523 Ga0070714_100325681
524 Ga0070713_100932509
525 Ga0070710_10001246
526 Ga0070711_100000197
527 Ga0070711_100083573
528 Ga0070705_100011744
529 Ga0070700_100001650
530 Ga0070694_100006852
531 Ga0070663_100029232
532 Ga0070663_100064090
533 Ga0070678_100001200
534 Ga0070678_100434089
535 Ga0070662_100003299
536 Ga0070662_100125358
537 Ga0068867_100006517
538 Ga0070685_10203322
539 Ga0070685_10468222
540 Ga0070685_10679400
541 Ga0070684_100697229
542 Ga0070697_100267963
543 Ga0068853_100016079
544 Ga0068853_100206457
545 Ga0068853_100994503
546 Ga0070672_100156354
547 Ga0070695_100028699
548 Ga0070696_100005763
549 Ga0070693_100015732
550 Ga0070665_100010069
551 Ga0070665_100011098
552 Ga0070665_100038994
553 Ga0070665_100202050
554 Ga0070665_100313795
555 Ga0070704_100000219
556 Ga0070704_100607690
557 Ga0068855_100685468
558 Ga0070664_100379132
559 Ga0068854_100003036
560 Ga0068856_100571609
561 Ga0070702_100000458
562 Ga0070702_100251008
563 Ga0068852_100045916
564 Ga0068852_100150057
565 Ga0068852_100921715
566 Ga0068859_100006560
567 Ga0068859_100020437
568 Ga0068859_100633273
569 Ga0068864_100162249
570 Ga0068866_10002121
571 Ga0068866_10055258
572 Ga0068861_100004067
573 Ga0068861_100105954
574 Ga0068861_100188910
575 Ga0068861_100934222
576 Ga0068870_10036643
577 Ga0068863_100002251
578 Ga0068863_100038449
579 Ga0068863_100127168
580 Ga0068863_100427400
581 Ga0068858_100004503
582 Ga0068858_100011653
583 Ga0068858_100086310
584 Ga0068860_100000186
585 Ga0068860_100005606
586 Ga0068860_100238010
587 Ga0068862_100000018
588 Ga0068862_100002385
589 Ga0068862_100402774
590 Ga0075365_10103887
591 Ga0075365_10189243
592 Ga0075365_10229863
593 Ga0075365_10267607
594 Ga0075368_10054976
595 Ga0075363_100011910
596 Ga0075363_100024060
597 Ga0075363_100034710
598 Ga0075363_100044539
599 Ga0075363_100084146
600 Ga0075363_100477273
601 Ga0075364_10007181
602 Ga0075364_10011718
603 Ga0075364_10031632
604 Ga0075364_10036740
605 Ga0075364_10155001
606 Ga0075364_10181560
607 Ga0075364_10183751
608 Ga0070715_10001384
609 Ga0070715_10063254
610 Ga0070716_100006481
611 Ga0070716_100406770
612 Ga0070712_100000786
613 Ga0070712_100026611
614 Ga0075362_10058739
615 Ga0075362_10090928
616 Ga0075362_10122896
617 Ga0075367_10010827
618 Ga0075367_10053859
619 Ga0075367_10151105
620 Ga0075369_10002015
621 Ga0075369_10004580
622 Ga0075369_10007832
623 Ga0075369_10008250
624 Ga0075369_10013922
625 Ga0075369_10022723
626 Ga0075369_10025288
627 Ga0075369_10070847
628 Ga0075369_10080567
629 Ga0075370_10000928
630 Ga0075370_10006110
631 Ga0075370_10025129
632 Ga0075370_10032937
633 Ga0075370_10100594
634 Ga0075370_10150503
635 Ga0068871_100741082
636 Ga0075428_100011360
637 Ga0075430_100103622
638 Ga0075431_100171129
639 Ga0068865_100001721
640 Ga0068865_100045924
641 Ga0097620_100006560
642 Ga0097620_100020437
643 Ga0097620_100633345
644 Ga0097620_101311560
645 Ga0105245_10006314
646 Ga0105245_10231419
647 Ga0105247_10000696
648 Ga0105247_10025969
649 Ga0105243_10001347
650 Ga0105241_10219869
651 Ga0105242_10000373
652 Ga0105248_10084472
653 Ga0105248_10230488
654 Ga0105237_10002512
655 Ga0105237_10602310
656 Ga0105238_10202740
657 Ga0105238_10364365
658 Ga0105249_10015053
659 Ga0105249_10104376
660 Ga0105249_10640623
661 Ga0105239_10008769
662 Ga0105239_10118972
663 Ga0105239_10605128
664 Ga0105246_10038418
665 Ga0105246_10202990
666 Ga0157378_10002499
667 Ga0157378_10080277
668 Ga0163162_10008072
669 Ga0163162_10187473
670 Ga0163162_10228161
671 Ga0163162_10384564
672 Ga0157372_10023509
673 Ga0157372_11355924
674 Ga0157375_10000487
675 Ga0163163_10036396
676 Ga0157380_10005863
677 Ga0157380_10112983
678 Ga0157377_10024882
679 Ga0157377_10084412
680 Ga0157379_10009349
681 Ga0157379_10510219
682 Ga0157376_10133214
683 Ga0163161_10018232
684 Ga0163161_10068571
685 Ga0213876_10061037
686 Ga0213875_10066570
687 Ga0209673_1018257
688 Ga0209051_1001058
689 Ga0207653_10054425
690 Ga0207692_10003859
691 Ga0207692_10024457
692 Ga0207642_10016544
693 Ga0207642_10028431
694 Ga0207642_10299257
695 Ga0207710_10000006
696 Ga0207710_10003466
697 Ga0207710_10142438
698 Ga0207688_10000196
699 Ga0207688_10000812
700 Ga0207647_10074634
701 Ga0207699_10066244
702 Ga0207699_10124868
703 Ga0207645_10040369
704 Ga0207654_10093175
705 Ga0207671_10006488
706 Ga0207693_10004850
707 Ga0207693_10020023
708 Ga0207663_10002207
709 Ga0207663_10075658
710 Ga0207662_10281940
711 Ga0207657_10109791
712 Ga0207657_10591320
713 Ga0207681_10000371
714 Ga0207681_10004653
715 Ga0207681_10065934
716 Ga0207694_10504765
717 Ga0207659_10072314
718 Ga0207687_10024562
719 Ga0207687_10040030
720 Ga0207700_10436090
721 Ga0207644_10255260
722 Ga0207706_10008091
723 Ga0207706_10009019
724 Ga0207686_10003015
725 Ga0207686_10100617
726 Ga0207709_10016481
727 Ga0207709_10141511
728 Ga0207709_10243010
729 Ga0207670_10059304
730 Ga0207669_10003734
731 Ga0207669_10042304
732 Ga0207704_10003331
733 Ga0207704_10087154
734 Ga0207665_10000947
735 Ga0207665_10016016
736 Ga0207665_10336917
737 Ga0207711_10000080
738 Ga0207711_10067156
739 Ga0207711_10672232
740 Ga0207689_10006811
741 Ga0207689_10039954
742 Ga0207667_10041449
743 Ga0207651_10233834
744 Ga0207712_10000061
745 Ga0207712_10012781
746 Ga0207712_10053306
747 Ga0207712_10594045
748 Ga0207668_10001177
749 Ga0207668_10005147
750 Ga0207668_10713202
751 Ga0207640_10009734
752 Ga0207658_10000123
753 Ga0207658_10001454
754 Ga0207658_10009627
755 Ga0207677_10000670
756 Ga0207677_10257744
757 Ga0207703_10065728
758 Ga0207639_10013326
759 Ga0207639_10994872
760 Ga0207678_10007937
761 Ga0207678_10062675
762 Ga0207708_10001599
763 Ga0207708_10013634
764 Ga0207641_10004140
765 Ga0207641_10236236
766 Ga0207641_10574495
767 Ga0207648_10000671
768 Ga0207648_10011295
769 Ga0207676_10075414
770 Ga0207675_100000388
771 Ga0207675_100024639
772 Ga0207675_100054336
773 Ga0207683_10000929
774 Ga0207683_10158145
775 Ga0207683_10922159
776 Ga0207698_10193696
777 Ga0207698_10306337
778 Ga0209813_10003181
779 Ga0268266_10009541
780 Ga0268266_10015289
781 Ga0268266_10037454
782 Ga0268266_10044788
783 Ga0268265_10000005
784 Ga0268265_10017442
785 Ga0268265_10031847
786 Ga0268265_10265692
787 Ga0268265_10303880
788 Ga0268264_10000177
789 Ga0268264_10495912
790 Ga0265327_10000850
791 Ga0265327_10127326
792 Ga0316578_10172243
793 Ga0307405_10238712
794 Ga0307413_10130461
795 Ga0307413_10210385
796 Ga0307410_10078102
797 Ga0307410_10198637
798 Ga0307406_10166545
799 Ga0307416_100022439
800 Ga0307416_100211991
801 Ga0307415_100032149
802 Ga0373943_0102834
803 Ga0373931_0062161
804 Ga0373931_0125578
805 Ga0436364_1423249
806 Ga0436365_0422923
807 Ga0436365_0778904
808 Ga0439461_0001093
809 Ga0439466_0001265
810 Ga0439466_0006281
811 Ga0439465_0002821
812 Ga0439465_0002857
813 Ga0439465_0019385
814 Ga0439445_0012240
815 Ga0439435_0021394
816 Ga0466965_0004239
817 Ga0466963_0011774
818 Ga0466968_0143930
819 Ga0466957_0324575
820 Ga0466957_0572895
821 Ga0466960_0000316
822 Ga0466960_0001990
823 Ga0466960_0059619
824 Ga0466959_0389110
825 Ga0466967_0001731
826 Ga0495638_0000539
827 Ga0495641_0014766
828 Ga0495580_0288835
829 Ga0495583_0097674
830 Ga0495611_0197080
831 Ga0495658_0200659
832 Ga0495624_0185769
833 Ga0495649_0051930
834 Ga0495604_0565320
835 Ga0495674_0013448
836 Ga0495672_0053398
837 Ga0495673_0045777
838 Ga0495593_0003943
839 Ga0496100_0002060
840 Ga0496100_0301983
841 Ga0496100_0374283
842 Ga0496100_0649007
843 Ga0496101_0002508
844 Ga0496101_0017201
845 Ga0496101_0029676
846 Ga0496102_0000229
847 Ga0496102_0015480
848 Ga0496102_0090467
849 Ga0496102_0094017
850 Ga0496102_0134404
851 Ga0496102_0149765
852 Ga0496102_0213088
853 Ga0496103_0000208
854 Ga0496103_0000584
855 Ga0496103_0030618
856 Ga0496103_0300748
857 Ga0496104_0383119
858 Ga0496104_0430512
859 Ga0496105_0027736
860 Ga0496105_0565812
861 Ga0496106_0000264
862 Ga0496106_0059931
863 Ga0496106_0184614
864 Ga0496107_0058068
865 Ga0496107_0059633
866 Ga0496107_0462044
867 Ga0496108_0000246
868 Ga0496108_0024221
869 Ga0496108_0026785
870 Ga0496108_0115090
871 Ga0496109_0069121
872 Ga0496109_0081426
873 Ga0496109_0082171
874 Ga0496109_0847990
875 Ga0496110_0223584
876 Ga0496110_0478425
877 Ga0496112_0017094
878 Ga0496112_0018435
879 Ga0496112_0025607
880 Ga0496112_0114073
881 Ga0496112_0314096
882 Ga0496113_0042234
883 Ga0496113_0050464
884 Ga0496113_0096436
885 Ga0496114_0233211
886 Ga0496117_0001509
887 Ga0496118_0026421
888 Ga0496119_0002954
889 Ga0496119_0097579
890 Ga0496120_0189080
891 Ga0496121_0011810
892 Ga0496122_0019142
893 Ga0496123_0004839
894 Ga0496125_0062362
895 Ga0496126_0012559
896 Ga0496126_0324594
897 Ga0501034_0057484
898 Ga0501034_0562497
899 Ga0501036_0036747
900 Ga0501037_0004758
901 Ga0501043_0100817
902 Ga0501043_0350270
903 Ga0501046_0045825
904 Ga0501047_0216639
905 Ga0501048_0032185
906 Ga0501069_0070072
907 Ga0501070_0005341
908 Ga0501073_0025852
909 Ga0501080_0065995
910 Ga0501080_0139369
911 Ga0501083_0169869
912 Ga0501035_0007357
913 Ga0501044_0007519
914 nmdc:mga03683_131091_c1
915 nmdc:mga03683_40142_c1
916 nmdc:mga03683_69318_c1
917 nmdc:mga03n38_11170_c1
918 nmdc:mga03n38_13619_c1
919 nmdc:mga03n38_17371_c1
920 nmdc:mga03n38_23479_c1
921 nmdc:mga03n38_27802_c1
922 nmdc:mga03n38_38751_c1
923 nmdc:mga03n38_46076_c1
924 nmdc:mga03n38_68115_c1
925 nmdc:mga00v17_11432_c1
926 nmdc:mga00v17_223421_c1
927 nmdc:mga00v17_250941_c1
928 nmdc:mga00v17_4649_c1
929 nmdc:mga00v17_6240_c1
930 nmdc:mga00v17_63660_c1
931 nmdc:mga0yw44_108396_c1
932 nmdc:mga0yw44_59407_c1
933 nmdc:mga06z11_128150_c1
934 nmdc:mga06z11_143103_c1
935 nmdc:mga06z11_3413_c1
936 nmdc:mga07m45_1181_c1
937 nmdc:mga07m45_140861_c1
938 nmdc:mga07m45_370032_c1
939 nmdc:mga0qj67_230466_c1
940 nmdc:mga06r32_202000_c1
941 nmdc:mga0sz30_25438_c1
942 nmdc:mga0sz30_34555_c1
943 nmdc:mga0sz30_56424_c1
944 nmdc:mga0sz30_8291_c1
945 nmdc:mga0sz30_84638_c1
946 nmdc:mga0sz30_95263_c1
947 Ga0500610_0002920
948 Ga0495655_0034102
949 Ga0495619_0048143
950 Ga0500643_010632
951 Ga0500556_0003702
952 Ga0500595_053869
953 Ga0500642_0098471
954 Ga0500652_145540
955 Ga0500559_0041572
956 Ga0500604_0114531
957 Ga0500616_0103947
958 Ga0500620_023532
959 Ga0500627_0003967
960 Ga0500627_0089418
961 Ga0500645_000176
962 Ga0500645_019177
963 2644638834
964 2738702763
965 2739329672
966 2842135040
967 2902794540
968 2902803092
969 2902813969
970 2929213308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bp9-assembly1.cif.gz_A crystal structure of sam-dependent methyltransferase from bacteroides fragilis in complex with s-adenosyl-l-homocysteine 0.8313 2 209
5bp9-assembly1.cif.gz_A crystal structure of sam-dependent methyltransferase from bacteroides fragilis in complex with s-adenosyl-l-homocysteine 0.8242 2 209
2gs9-assembly1.cif.gz_B crystal structure of tt1324 from thermus thermophilis hb8 0.7837 30 150
3ktd-assembly1.cif.gz_A crystal structure of a putative prephenate dehydrogenase (cgl0226) from corynebacterium glutamicum atcc 13032 at 2.60 a resolution 0.7821 50 98
3e8s-assembly1.cif.gz_A-2 crystal structure of putative sam dependent methyltransferase in complex with sah (np_744700.1) from pseudomonas putida kt2440 at 2.10 a resolution 0.7791 38 209
ID Description Score Start End Superfamily
af_O53443_2_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8725 64 96 3.40.50.1010
af_A4HYM5_212_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8482 51 209 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8313 41 145 3.40.50.150
af_Q2QUD2_542_827_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8307 38 147 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.828 43 143 3.40.50.150
ID Description Score Start End GO Terms
AF-A1T3H6-F1-model_v4 Methyltransferase type 12 0.9958 1 208 GO:0008168
GO:0032259
AF-G8RU33-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9954 1 209 GO:0008757
AF-A0A7Z7IG56-F1-model_v4 Methyltransferase type 12 0.9922 1 209
AF-A1T3H6-F1-model_v4 Methyltransferase type 12 0.9911 1 208 GO:0008168
GO:0032259
AF-A0A7I7RU36-F1-model_v4 Methyltransferase type 12 0.9878 5 209 GO:0008168
GO:0032259

Map