F453171
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 234 | 485 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0237531|Ga0501033_0237531_156_1214 |
| Length | 352 |
| Sequence | MKPEKKLIAVRACGYSRASKEDCMAGVIDVHTHMLNHEWLELLEKHGKPRYTLAAVPGGLRAIHLDGAPFMTPVPEMFDWDQRIRNMNKAGIDVAVVSLTCPNCYWGDEAVSLRAAQTMNDEMARARKTWPDRIQFFCSLPWQHPSRALQELKRARSLGASGVMVLANIDGKPLTDEAFAPIWKAIDDEKLPVLVHPTAPPGVRDMDMAQFQLTASIGFTFDTSLAVSRMIFDGFFDRYAELKIIASHGGGALPFLIGRLDQCFDNIPACRVKVRERPSLYARRIWADSVVFTDDALAMAVRVFGSERVLYGSDYPHTIGDPIGCLARVDRLPDGVRRRVRSANAKRIFDFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 183 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 184 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 185 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 186 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 187 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 233 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.24 |
| Rhizosphere | 98.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10020822 | 3300005328 | Bacteria | 3666 |
| 2 | Ga0070676_10183438 | 3300005328 | Bacteria | 1362 |
| 3 | Ga0070670_100000840 | 3300005331 | Bacteria | 24010 |
| 4 | Ga0070670_100009503 | 3300005331 | Bacteria | 8300 |
| 5 | Ga0070670_100032213 | 3300005331 | Bacteria | 4514 |
| 6 | Ga0070670_100049466 | 3300005331 | Bacteria | 3614 |
| 7 | Ga0070670_100094212 | 3300005331 | Bacteria | 2575 |
| 8 | Ga0070677_10000343 | 3300005333 | Bacteria | 16239 |
| 9 | Ga0070677_10072179 | 3300005333 | Bacteria | 1455 |
| 10 | Ga0068869_100000025 | 3300005334 | Bacteria | 63244 |
| 11 | Ga0070666_10007974 | 3300005335 | Bacteria | 6548 |
| 12 | Ga0070666_10040963 | 3300005335 | Bacteria | 3094 |
| 13 | Ga0070666_10049446 | 3300005335 | Bacteria | 2826 |
| 14 | Ga0070680_100392581 | 3300005336 | Bacteria | 1182 |
| 15 | Ga0068868_100015555 | 3300005338 | Bacteria | 5630 |
| 16 | Ga0068868_100106770 | 3300005338 | Unclassified | 2271 |
| 17 | Ga0070660_100004883 | 3300005339 | Bacteria | 9268 |
| 18 | Ga0070661_100012900 | 3300005344 | Bacteria | 5854 |
| 19 | Ga0070668_100002498 | 3300005347 | Bacteria | 13540 |
| 20 | Ga0070668_100002549 | 3300005347 | Bacteria | 13404 |
| 21 | Ga0070668_100007175 | 3300005347 | Bacteria | 8262 |
| 22 | Ga0070668_100010955 | 3300005347 | Bacteria | 6747 |
| 23 | Ga0070668_100031144 | 3300005347 | Bacteria | 4058 |
| 24 | Ga0070668_100047702 | 3300005347 | Bacteria | 3293 |
| 25 | Ga0070669_100009220 | 3300005353 | Bacteria | 7032 |
| 26 | Ga0070669_100018043 | 3300005353 | Bacteria | 5040 |
| 27 | Ga0070669_100028306 | 3300005353 | Bacteria | 4036 |
| 28 | Ga0070675_100003678 | 3300005354 | Bacteria | 11653 |
| 29 | Ga0070675_100012472 | 3300005354 | Bacteria | 6659 |
| 30 | Ga0070675_100039898 | 3300005354 | Bacteria | 3832 |
| 31 | Ga0070675_100128481 | 3300005354 | Bacteria | 2158 |
| 32 | Ga0070671_100002054 | 3300005355 | Bacteria | 15515 |
| 33 | Ga0070671_100064224 | 3300005355 | Unclassified | 3058 |
| 34 | Ga0070674_100005249 | 3300005356 | Bacteria | 7458 |
| 35 | Ga0070674_100005784 | 3300005356 | Bacteria | 7177 |
| 36 | Ga0070674_100272642 | 3300005356 | Archaea | 1338 |
| 37 | Ga0070673_100001140 | 3300005364 | Bacteria | 15254 |
| 38 | Ga0070673_100031620 | 3300005364 | Bacteria | 3975 |
| 39 | Ga0070673_100095172 | 3300005364 | Bacteria | 2443 |
| 40 | Ga0070673_100127837 | 3300005364 | Bacteria | 2128 |
| 41 | Ga0070659_100048704 | 3300005366 | Bacteria | 3330 |
| 42 | Ga0070667_100001812 | 3300005367 | Bacteria | 19031 |
| 43 | Ga0070667_100015613 | 3300005367 | Bacteria | 6279 |
| 44 | Ga0070667_100287845 | 3300005367 | Bacteria | 1477 |
| 45 | Ga0070714_100000451 | 3300005435 | Bacteria | 29894 |
| 46 | Ga0070714_100076562 | 3300005435 | Bacteria | 2905 |
| 47 | Ga0070713_100000031 | 3300005436 | Bacteria | 88727 |
| 48 | Ga0070705_100007589 | 3300005440 | Bacteria | 5344 |
| 49 | Ga0070705_100195006 | 3300005440 | Bacteria | 1384 |
| 50 | Ga0070700_100074267 | 3300005441 | Bacteria | 2178 |
| 51 | Ga0070694_100133039 | 3300005444 | Bacteria | 1799 |
| 52 | Ga0070708_100000522 | 3300005445 | Bacteria | 28901 |
| 53 | Ga0070663_100022191 | 3300005455 | Bacteria | 4239 |
| 54 | Ga0070663_100036791 | 3300005455 | Bacteria | 3403 |
| 55 | Ga0070678_100028874 | 3300005456 | Bacteria | 3790 |
| 56 | Ga0070678_100160650 | 3300005456 | Bacteria | 1820 |
| 57 | Ga0070678_100303083 | 3300005456 | Unclassified | 1358 |
| 58 | Ga0070662_100021446 | 3300005457 | Bacteria | 4411 |
| 59 | Ga0070662_100026838 | 3300005457 | Bacteria | 3992 |
| 60 | Ga0070662_100223291 | 3300005457 | Bacteria | 1504 |
| 61 | Ga0070681_10019661 | 3300005458 | Bacteria | 6763 |
| 62 | Ga0068867_100001753 | 3300005459 | Bacteria | 15109 |
| 63 | Ga0068867_100008998 | 3300005459 | Bacteria | 7044 |
| 64 | Ga0068867_100018231 | 3300005459 | Bacteria | 4988 |
| 65 | Ga0070706_100187081 | 3300005467 | Unclassified | 1935 |
| 66 | Ga0070707_100258289 | 3300005468 | Unclassified | 1695 |
| 67 | Ga0070707_100434766 | 3300005468 | Unclassified | 1273 |
| 68 | Ga0070698_100009043 | 3300005471 | Bacteria | 10708 |
| 69 | Ga0070698_100356689 | 3300005471 | Bacteria | 1394 |
| 70 | Ga0070699_100017245 | 3300005518 | Bacteria | 6201 |
| 71 | Ga0070699_100116640 | 3300005518 | Bacteria | 2347 |
| 72 | Ga0070679_100001739 | 3300005530 | Bacteria | 19624 |
| 73 | Ga0070679_100146716 | 3300005530 | Bacteria | 2337 |
| 74 | Ga0070684_100051130 | 3300005535 | Bacteria | 3590 |
| 75 | Ga0070684_100054509 | 3300005535 | Bacteria | 3484 |
| 76 | Ga0070697_100007116 | 3300005536 | Bacteria | 8698 |
| 77 | Ga0070697_100034545 | 3300005536 | Bacteria | 4077 |
| 78 | Ga0070697_100124782 | 3300005536 | Bacteria | 2156 |
| 79 | Ga0068853_100004289 | 3300005539 | Bacteria | 11022 |
| 80 | Ga0068853_100005040 | 3300005539 | Bacteria | 10302 |
| 81 | Ga0070672_100012855 | 3300005543 | Bacteria | 5897 |
| 82 | Ga0070672_100013375 | 3300005543 | Bacteria | 5796 |
| 83 | Ga0070672_100030863 | 3300005543 | Bacteria | 4030 |
| 84 | Ga0070672_100046623 | 3300005543 | Bacteria | 3359 |
| 85 | Ga0070672_100177471 | 3300005543 | Unclassified | 1774 |
| 86 | Ga0070686_100065353 | 3300005544 | Bacteria | 2363 |
| 87 | Ga0070695_100055361 | 3300005545 | Bacteria | 2556 |
| 88 | Ga0070695_100084120 | 3300005545 | Bacteria | 2110 |
| 89 | Ga0070696_100012859 | 3300005546 | Bacteria | 5618 |
| 90 | Ga0070696_100140187 | 3300005546 | Bacteria | 1767 |
| 91 | Ga0070665_100008185 | 3300005548 | Bacteria | 10589 |
| 92 | Ga0070665_100024239 | 3300005548 | Bacteria | 6110 |
| 93 | Ga0070665_100035193 | 3300005548 | Bacteria | 5035 |
| 94 | Ga0070665_100119224 | 3300005548 | Bacteria | 2641 |
| 95 | Ga0070665_100213823 | 3300005548 | Bacteria | 1929 |
| 96 | Ga0070704_100139120 | 3300005549 | Bacteria | 1893 |
| 97 | Ga0068855_100007056 | 3300005563 | Bacteria | 13626 |
| 98 | Ga0068855_100142621 | 3300005563 | Bacteria | 2729 |
| 99 | Ga0070664_100000262 | 3300005564 | Bacteria | 37939 |
| 100 | Ga0070664_100266647 | 3300005564 | Unclassified | 1542 |
| 101 | Ga0068857_100001952 | 3300005577 | Bacteria | 16647 |
| 102 | Ga0068857_100006645 | 3300005577 | Bacteria | 9937 |
| 103 | Ga0068854_100127619 | 3300005578 | Bacteria | 1939 |
| 104 | Ga0068856_100007834 | 3300005614 | Bacteria | 10431 |
| 105 | Ga0068856_100015908 | 3300005614 | Bacteria | 7272 |
| 106 | Ga0068856_100192882 | 3300005614 | Bacteria | 2051 |
| 107 | Ga0070702_100025695 | 3300005615 | Bacteria | 3158 |
| 108 | Ga0068852_100131958 | 3300005616 | Bacteria | 2301 |
| 109 | Ga0068852_100407131 | 3300005616 | Unclassified | 1339 |
| 110 | Ga0068859_100000330 | 3300005617 | Bacteria | 47242 |
| 111 | Ga0068859_100032436 | 3300005617 | Bacteria | 5247 |
| 112 | Ga0068859_100075446 | 3300005617 | Bacteria | 3412 |
| 113 | Ga0068864_100001602 | 3300005618 | Bacteria | 18660 |
| 114 | Ga0068864_100003579 | 3300005618 | Bacteria | 12843 |
| 115 | Ga0068864_100032118 | 3300005618 | Bacteria | 4458 |
| 116 | Ga0068866_10168048 | 3300005718 | Unclassified | 1285 |
| 117 | Ga0068861_100000777 | 3300005719 | Bacteria | 19173 |
| 118 | Ga0068861_100012323 | 3300005719 | Bacteria | 5963 |
| 119 | Ga0068861_100066502 | 3300005719 | Bacteria | 2779 |
| 120 | Ga0068861_100069776 | 3300005719 | Bacteria | 2719 |
| 121 | Ga0068851_10001153 | 3300005834 | Bacteria | 11457 |
| 122 | Ga0068851_10082506 | 3300005834 | Unclassified | 1681 |
| 123 | Ga0068870_10022663 | 3300005840 | Bacteria | 3088 |
| 124 | Ga0068870_10078514 | 3300005840 | Unclassified | 1818 |
| 125 | Ga0068870_10209808 | 3300005840 | Unclassified | 1186 |
| 126 | Ga0068863_100014883 | 3300005841 | Bacteria | 7473 |
| 127 | Ga0068863_100019911 | 3300005841 | Bacteria | 6418 |
| 128 | Ga0068863_100054314 | 3300005841 | Bacteria | 3795 |
| 129 | Ga0068863_100160155 | 3300005841 | Bacteria | 2156 |
| 130 | Ga0068863_100355366 | 3300005841 | Bacteria | 1427 |
| 131 | Ga0068858_100002918 | 3300005842 | Bacteria | 17202 |
| 132 | Ga0068858_100093274 | 3300005842 | Bacteria | 2803 |
| 133 | Ga0068858_100288276 | 3300005842 | Bacteria | 1564 |
| 134 | Ga0068858_100321960 | 3300005842 | Bacteria | 1478 |
| 135 | Ga0068858_100535031 | 3300005842 | Unclassified | 1134 |
| 136 | Ga0068860_100002326 | 3300005843 | Bacteria | 19958 |
| 137 | Ga0068860_100013607 | 3300005843 | Bacteria | 7975 |
| 138 | Ga0068860_100019078 | 3300005843 | Bacteria | 6657 |
| 139 | Ga0068860_100036880 | 3300005843 | Bacteria | 4681 |
| 140 | Ga0068860_100037773 | 3300005843 | Bacteria | 4622 |
| 141 | Ga0068860_100196532 | 3300005843 | Bacteria | 1953 |
| 142 | Ga0068860_100212110 | 3300005843 | Bacteria | 1878 |
| 143 | Ga0068862_100004250 | 3300005844 | Bacteria | 12129 |
| 144 | Ga0068862_100023570 | 3300005844 | Bacteria | 5157 |
| 145 | Ga0068862_100028486 | 3300005844 | Bacteria | 4704 |
| 146 | Ga0081455_10293125 | 3300005937 | Bacteria | 1170 |
| 147 | Ga0081539_10000521 | 3300005985 | Bacteria | 80101 |
| 148 | Ga0070715_10054888 | 3300006163 | Unclassified | 1727 |
| 149 | Ga0097621_100002336 | 3300006237 | Bacteria | 12996 |
| 150 | Ga0097621_100003701 | 3300006237 | Bacteria | 10579 |
| 151 | Ga0097621_100008390 | 3300006237 | Bacteria | 7435 |
| 152 | Ga0097621_100026548 | 3300006237 | Bacteria | 4544 |
| 153 | Ga0068871_100003284 | 3300006358 | Bacteria | 11094 |
| 154 | Ga0068871_100042885 | 3300006358 | Bacteria | 3635 |
| 155 | Ga0075428_100117321 | 3300006844 | Bacteria | 2899 |
| 156 | Ga0075430_100024465 | 3300006846 | Bacteria | 5138 |
| 157 | Ga0075430_100081693 | 3300006846 | Bacteria | 2707 |
| 158 | Ga0075431_100024247 | 3300006847 | Bacteria | 6214 |
| 159 | Ga0075431_100082592 | 3300006847 | Bacteria | 3317 |
| 160 | Ga0075433_10085475 | 3300006852 | Bacteria | 2785 |
| 161 | Ga0075434_100010242 | 3300006871 | Bacteria | 8780 |
| 162 | Ga0075429_100010719 | 3300006880 | Bacteria | 7927 |
| 163 | Ga0075429_100184852 | 3300006880 | Bacteria | 1826 |
| 164 | Ga0068865_100003924 | 3300006881 | Bacteria | 8928 |
| 165 | Ga0068865_100027370 | 3300006881 | Bacteria | 3766 |
| 166 | Ga0068865_100055339 | 3300006881 | Bacteria | 2760 |
| 167 | Ga0068865_100124463 | 3300006881 | Bacteria | 1922 |
| 168 | Ga0075436_100003776 | 3300006914 | Bacteria | 10388 |
| 169 | Ga0075436_100052273 | 3300006914 | Bacteria | 2820 |
| 170 | Ga0097620_100000330 | 3300006931 | Bacteria | 47242 |
| 171 | Ga0097620_100032436 | 3300006931 | Bacteria | 5247 |
| 172 | Ga0097620_100075447 | 3300006931 | Bacteria | 3412 |
| 173 | Ga0075435_100000996 | 3300007076 | Bacteria | 17936 |
| 174 | Ga0075435_100005730 | 3300007076 | Bacteria | 8714 |
| 175 | Ga0075435_100067205 | 3300007076 | Unclassified | 2918 |
| 176 | Ga0075435_100297959 | 3300007076 | Bacteria | 1379 |
| 177 | Ga0099794_10036244 | 3300007265 | Bacteria | 2331 |
| 178 | Ga0105240_10003200 | 3300009093 | Bacteria | 25701 |
| 179 | Ga0111539_10061100 | 3300009094 | Bacteria | 4464 |
| 180 | Ga0105245_10067157 | 3300009098 | Bacteria | 3247 |
| 181 | Ga0114129_10698016 | 3300009147 | Unclassified | 1304 |
| 182 | Ga0105243_10039506 | 3300009148 | Bacteria | 3679 |
| 183 | Ga0105241_10082934 | 3300009174 | Bacteria | 2514 |
| 184 | Ga0105242_10000684 | 3300009176 | Bacteria | 26626 |
| 185 | Ga0105242_10021200 | 3300009176 | Bacteria | 5099 |
| 186 | Ga0105248_10008280 | 3300009177 | Bacteria | 11422 |
| 187 | Ga0105248_10025672 | 3300009177 | Bacteria | 6552 |
| 188 | Ga0105248_10098280 | 3300009177 | Bacteria | 3298 |
| 189 | Ga0105248_10185673 | 3300009177 | Bacteria | 2343 |
| 190 | Ga0105248_10568814 | 3300009177 | Unclassified | 1279 |
| 191 | Ga0105238_10000670 | 3300009551 | Bacteria | 35955 |
| 192 | Ga0105249_10004775 | 3300009553 | Bacteria | 11693 |
| 193 | Ga0105249_10081199 | 3300009553 | Bacteria | 3013 |
| 194 | Ga0157373_10021603 | 3300013100 | Bacteria | 4673 |
| 195 | Ga0157371_10115313 | 3300013102 | Bacteria | 1908 |
| 196 | Ga0157370_10003353 | 3300013104 | Bacteria | 18859 |
| 197 | Ga0157369_10001648 | 3300013105 | Bacteria | 27252 |
| 198 | Ga0157378_10009398 | 3300013297 | Bacteria | 8518 |
| 199 | Ga0157378_10016068 | 3300013297 | Bacteria | 6555 |
| 200 | Ga0157378_10126288 | 3300013297 | Bacteria | 2363 |
| 201 | Ga0157378_10277947 | 3300013297 | Bacteria | 1613 |
| 202 | Ga0163162_10008337 | 3300013306 | Bacteria | 10109 |
| 203 | Ga0163162_10013531 | 3300013306 | Bacteria | 7967 |
| 204 | Ga0157372_10000841 | 3300013307 | Bacteria | 33273 |
| 205 | Ga0157375_10012622 | 3300013308 | Bacteria | 7497 |
| 206 | Ga0157375_10031440 | 3300013308 | Bacteria | 5019 |
| 207 | Ga0157375_10055865 | 3300013308 | Bacteria | 3894 |
| 208 | Ga0157375_10057559 | 3300013308 | Unclassified | 3843 |
| 209 | Ga0157375_10264262 | 3300013308 | Bacteria | 1882 |
| 210 | Ga0163163_10001202 | 3300014325 | Bacteria | 21901 |
| 211 | Ga0163163_10003372 | 3300014325 | Bacteria | 13559 |
| 212 | Ga0163163_10056492 | 3300014325 | Bacteria | 3880 |
| 213 | Ga0163163_10248877 | 3300014325 | Bacteria | 1828 |
| 214 | Ga0157380_10026158 | 3300014326 | Bacteria | 4430 |
| 215 | Ga0157380_10127804 | 3300014326 | Unclassified | 2163 |
| 216 | Ga0157379_10000522 | 3300014968 | Bacteria | 31120 |
| 217 | Ga0157379_10160113 | 3300014968 | Bacteria | 2032 |
| 218 | Ga0157376_10210716 | 3300014969 | Bacteria | 1794 |
| 219 | Ga0157376_10419395 | 3300014969 | Unclassified | 1298 |
| 220 | Ga0163161_10009380 | 3300017792 | Bacteria | 6775 |
| 221 | Ga0163161_10217757 | 3300017792 | Bacteria | 1477 |
| 222 | Ga0207697_10031196 | 3300025315 | Bacteria | 2181 |
| 223 | Ga0207656_10063126 | 3300025321 | Unclassified | 1630 |
| 224 | Ga0207682_10000198 | 3300025893 | Bacteria | 27362 |
| 225 | Ga0207682_10049757 | 3300025893 | Bacteria | 1731 |
| 226 | Ga0207642_10056312 | 3300025899 | Bacteria | 1803 |
| 227 | Ga0207688_10156661 | 3300025901 | Bacteria | 1348 |
| 228 | Ga0207680_10004517 | 3300025903 | Bacteria | 6600 |
| 229 | Ga0207680_10016093 | 3300025903 | Bacteria | 3918 |
| 230 | Ga0207680_10046950 | 3300025903 | Bacteria | 2556 |
| 231 | Ga0207680_10087743 | 3300025903 | Bacteria | 1970 |
| 232 | Ga0207645_10000676 | 3300025907 | Bacteria | 28210 |
| 233 | Ga0207645_10009493 | 3300025907 | Bacteria | 6724 |
| 234 | Ga0207645_10019774 | 3300025907 | Bacteria | 4411 |
| 235 | Ga0207645_10211080 | 3300025907 | Bacteria | 1279 |
| 236 | Ga0207643_10040898 | 3300025908 | Bacteria | 2611 |
| 237 | Ga0207684_10035403 | 3300025910 | Bacteria | 4240 |
| 238 | Ga0207654_10115508 | 3300025911 | Bacteria | 1677 |
| 239 | Ga0207707_10037480 | 3300025912 | Bacteria | 4238 |
| 240 | Ga0207707_10058016 | 3300025912 | Bacteria | 3369 |
| 241 | Ga0207695_10020136 | 3300025913 | Bacteria | 7652 |
| 242 | Ga0207663_10274584 | 3300025916 | Unclassified | 1250 |
| 243 | Ga0207660_10076123 | 3300025917 | Bacteria | 2453 |
| 244 | Ga0207657_10006985 | 3300025919 | Bacteria | 11623 |
| 245 | Ga0207649_10005550 | 3300025920 | Bacteria | 6823 |
| 246 | Ga0207652_10003366 | 3300025921 | Bacteria | 13201 |
| 247 | Ga0207652_10085287 | 3300025921 | Bacteria | 2768 |
| 248 | Ga0207681_10005688 | 3300025923 | Bacteria | 7657 |
| 249 | Ga0207681_10014951 | 3300025923 | Bacteria | 4835 |
| 250 | Ga0207681_10031449 | 3300025923 | Bacteria | 3466 |
| 251 | Ga0207681_10036993 | 3300025923 | Bacteria | 3224 |
| 252 | Ga0207694_10002194 | 3300025924 | Bacteria | 16036 |
| 253 | Ga0207650_10004678 | 3300025925 | Bacteria | 9354 |
| 254 | Ga0207650_10035053 | 3300025925 | Bacteria | 3642 |
| 255 | Ga0207650_10082189 | 3300025925 | Bacteria | 2445 |
| 256 | Ga0207650_10237930 | 3300025925 | Unclassified | 1471 |
| 257 | Ga0207650_10319076 | 3300025925 | Bacteria | 1272 |
| 258 | Ga0207659_10005942 | 3300025926 | Bacteria | 7448 |
| 259 | Ga0207659_10059462 | 3300025926 | Bacteria | 2747 |
| 260 | Ga0207659_10172293 | 3300025926 | Unclassified | 1708 |
| 261 | Ga0207687_10044351 | 3300025927 | Bacteria | 3068 |
| 262 | Ga0207700_10000084 | 3300025928 | Bacteria | 58386 |
| 263 | Ga0207664_10033440 | 3300025929 | Bacteria | 3950 |
| 264 | Ga0207664_10042020 | 3300025929 | Bacteria | 3566 |
| 265 | Ga0207644_10019180 | 3300025931 | Bacteria | 4637 |
| 266 | Ga0207644_10052129 | 3300025931 | Unclassified | 2940 |
| 267 | Ga0207690_10033726 | 3300025932 | Bacteria | 3294 |
| 268 | Ga0207706_10007454 | 3300025933 | Bacteria | 10119 |
| 269 | Ga0207706_10185923 | 3300025933 | Bacteria | 1824 |
| 270 | Ga0207686_10009300 | 3300025934 | Bacteria | 5332 |
| 271 | Ga0207686_10245881 | 3300025934 | Unclassified | 1304 |
| 272 | Ga0207709_10017317 | 3300025935 | Bacteria | 4020 |
| 273 | Ga0207704_10005159 | 3300025938 | Bacteria | 6016 |
| 274 | Ga0207704_10021005 | 3300025938 | Bacteria | 3468 |
| 275 | Ga0207704_10059504 | 3300025938 | Bacteria | 2359 |
| 276 | Ga0207704_10322187 | 3300025938 | Bacteria | 1193 |
| 277 | Ga0207691_10000243 | 3300025940 | Bacteria | 53649 |
| 278 | Ga0207691_10004761 | 3300025940 | Bacteria | 13124 |
| 279 | Ga0207691_10030957 | 3300025940 | Bacteria | 4997 |
| 280 | Ga0207691_10033363 | 3300025940 | Bacteria | 4793 |
| 281 | Ga0207691_10042871 | 3300025940 | Bacteria | 4171 |
| 282 | Ga0207691_10176529 | 3300025940 | Bacteria | 1868 |
| 283 | Ga0207691_10222557 | 3300025940 | Unclassified | 1636 |
| 284 | Ga0207711_10015861 | 3300025941 | Bacteria | 6250 |
| 285 | Ga0207711_10032403 | 3300025941 | Bacteria | 4419 |
| 286 | Ga0207689_10000072 | 3300025942 | Bacteria | 82171 |
| 287 | Ga0207689_10002822 | 3300025942 | Bacteria | 16042 |
| 288 | Ga0207661_10120700 | 3300025944 | Bacteria | 2231 |
| 289 | Ga0207661_10162670 | 3300025944 | Bacteria | 1937 |
| 290 | Ga0207661_10331133 | 3300025944 | Bacteria | 1371 |
| 291 | Ga0207679_10007525 | 3300025945 | Bacteria | 6912 |
| 292 | Ga0207679_10237250 | 3300025945 | Unclassified | 1543 |
| 293 | Ga0207667_10005160 | 3300025949 | Bacteria | 15954 |
| 294 | Ga0207667_10063560 | 3300025949 | Bacteria | 3857 |
| 295 | Ga0207651_10012672 | 3300025960 | Bacteria | 4784 |
| 296 | Ga0207651_10178584 | 3300025960 | Archaea | 1682 |
| 297 | Ga0207668_10005128 | 3300025972 | Bacteria | 7706 |
| 298 | Ga0207668_10014856 | 3300025972 | Bacteria | 4827 |
| 299 | Ga0207668_10035335 | 3300025972 | Bacteria | 3326 |
| 300 | Ga0207668_10195831 | 3300025972 | Unclassified | 1605 |
| 301 | Ga0207668_10208249 | 3300025972 | Bacteria | 1562 |
| 302 | Ga0207640_10122576 | 3300025981 | Bacteria | 1865 |
| 303 | Ga0207658_10007396 | 3300025986 | Bacteria | 7489 |
| 304 | Ga0207658_10019572 | 3300025986 | Bacteria | 4681 |
| 305 | Ga0207658_10032041 | 3300025986 | Bacteria | 3738 |
| 306 | Ga0207658_10190237 | 3300025986 | Unclassified | 1705 |
| 307 | Ga0207677_10031104 | 3300026023 | Bacteria | 3416 |
| 308 | Ga0207703_10000588 | 3300026035 | Bacteria | 36998 |
| 309 | Ga0207703_10078396 | 3300026035 | Bacteria | 2745 |
| 310 | Ga0207639_10021685 | 3300026041 | Bacteria | 4617 |
| 311 | Ga0207639_10411839 | 3300026041 | Bacteria | 1220 |
| 312 | Ga0207678_10020859 | 3300026067 | Bacteria | 5743 |
| 313 | Ga0207678_10176375 | 3300026067 | Bacteria | 1825 |
| 314 | Ga0207678_10311786 | 3300026067 | Bacteria | 1353 |
| 315 | Ga0207708_10014098 | 3300026075 | Bacteria | 5973 |
| 316 | Ga0207708_10202619 | 3300026075 | Bacteria | 1584 |
| 317 | Ga0207702_10011568 | 3300026078 | Bacteria | 7353 |
| 318 | Ga0207702_10255715 | 3300026078 | Bacteria | 1647 |
| 319 | Ga0207641_10005320 | 3300026088 | Bacteria | 10990 |
| 320 | Ga0207641_10035898 | 3300026088 | Bacteria | 4134 |
| 321 | Ga0207641_10082260 | 3300026088 | Unclassified | 2797 |
| 322 | Ga0207641_10104082 | 3300026088 | Bacteria | 2505 |
| 323 | Ga0207641_10122339 | 3300026088 | Bacteria | 2324 |
| 324 | Ga0207641_10190972 | 3300026088 | Bacteria | 1883 |
| 325 | Ga0207641_10394644 | 3300026088 | Unclassified | 1327 |
| 326 | Ga0207648_10000476 | 3300026089 | Bacteria | 44737 |
| 327 | Ga0207648_10003505 | 3300026089 | Bacteria | 16438 |
| 328 | Ga0207648_10004321 | 3300026089 | Bacteria | 14629 |
| 329 | Ga0207648_10125215 | 3300026089 | Bacteria | 2260 |
| 330 | Ga0207648_10284326 | 3300026089 | Bacteria | 1480 |
| 331 | Ga0207648_10354104 | 3300026089 | Bacteria | 1324 |
| 332 | Ga0207648_10386733 | 3300026089 | Bacteria | 1266 |
| 333 | Ga0207676_10008380 | 3300026095 | Bacteria | 7347 |
| 334 | Ga0207676_10013905 | 3300026095 | Bacteria | 5777 |
| 335 | Ga0207676_10015881 | 3300026095 | Bacteria | 5445 |
| 336 | Ga0207676_10197808 | 3300026095 | Unclassified | 1773 |
| 337 | Ga0207674_10000020 | 3300026116 | Bacteria | 162474 |
| 338 | Ga0207674_10007698 | 3300026116 | Bacteria | 12542 |
| 339 | Ga0207675_100000846 | 3300026118 | Bacteria | 30438 |
| 340 | Ga0207675_100001565 | 3300026118 | Bacteria | 22938 |
| 341 | Ga0207675_100030212 | 3300026118 | Bacteria | 5046 |
| 342 | Ga0207675_100072628 | 3300026118 | Bacteria | 3218 |
| 343 | Ga0207675_100091631 | 3300026118 | Bacteria | 2858 |
| 344 | Ga0207675_100241124 | 3300026118 | Unclassified | 1747 |
| 345 | Ga0207683_10000308 | 3300026121 | Bacteria | 44216 |
| 346 | Ga0207683_10017509 | 3300026121 | Bacteria | 6108 |
| 347 | Ga0207683_10068917 | 3300026121 | Bacteria | 3124 |
| 348 | Ga0207683_10109422 | 3300026121 | Bacteria | 2473 |
| 349 | Ga0207698_10136796 | 3300026142 | Bacteria | 2103 |
| 350 | Ga0207698_10177789 | 3300026142 | Bacteria | 1881 |
| 351 | Ga0209995_1003334 | 3300027471 | Bacteria | 2559 |
| 352 | Ga0209970_1006292 | 3300027614 | Bacteria | 1944 |
| 353 | Ga0209588_1062638 | 3300027671 | Bacteria | 1202 |
| 354 | Ga0209971_1007674 | 3300027682 | Bacteria | 2561 |
| 355 | Ga0209998_10030586 | 3300027717 | Bacteria | 1190 |
| 356 | Ga0268266_10056421 | 3300028379 | Bacteria | 3379 |
| 357 | Ga0268265_10005063 | 3300028380 | Bacteria | 9044 |
| 358 | Ga0268265_10017961 | 3300028380 | Bacteria | 4894 |
| 359 | Ga0268265_10101735 | 3300028380 | Bacteria | 2322 |
| 360 | Ga0268264_10000593 | 3300028381 | Bacteria | 43940 |
| 361 | Ga0268264_10011874 | 3300028381 | Bacteria | 7175 |
| 362 | Ga0268264_10036052 | 3300028381 | Bacteria | 4072 |
| 363 | Ga0268264_10044155 | 3300028381 | Bacteria | 3696 |
| 364 | Ga0268264_10237662 | 3300028381 | Bacteria | 1686 |
| 365 | Ga0268264_10357642 | 3300028381 | Bacteria | 1392 |
| 366 | Ga0307408_100010521 | 3300031548 | Bacteria | 6099 |
| 367 | Ga0307405_10006379 | 3300031731 | Bacteria | 5797 |
| 368 | Ga0307413_10015135 | 3300031824 | Bacteria | 3944 |
| 369 | Ga0307410_10003556 | 3300031852 | Bacteria | 7845 |
| 370 | Ga0307407_10011402 | 3300031903 | Bacteria | 4229 |
| 371 | Ga0307412_10016159 | 3300031911 | Bacteria | 4439 |
| 372 | Ga0307409_100010606 | 3300031995 | Bacteria | 5742 |
| 373 | Ga0307409_100502546 | 3300031995 | Bacteria | 1181 |
| 374 | Ga0307416_100041793 | 3300032002 | Bacteria | 3573 |
| 375 | Ga0307416_100150969 | 3300032002 | Bacteria | 2131 |
| 376 | Ga0307411_10005803 | 3300032005 | Bacteria | 6114 |
| 377 | Ga0307415_100002355 | 3300032126 | Bacteria | 9398 |
| 378 | Ga0307507_10052242 | 3300033179 | Bacteria | 3921 |
| 379 | Ga0373936_0017551 | 3300035113 | Bacteria | 2757 |
| 380 | Ga0373936_0094079 | 3300035113 | Bacteria | 1259 |
| 381 | Ga0373956_0037445 | 3300035119 | Bacteria | 2144 |
| 382 | Ga0373943_0020691 | 3300035170 | Bacteria | 3036 |
| 383 | Ga0373942_0003671 | 3300035207 | Bacteria | 3600 |
| 384 | Ga0373931_0032743 | 3300035691 | Bacteria | 2691 |
| 385 | Ga0373931_0209253 | 3300035691 | Bacteria | 1169 |
| 386 | Ga0373935_0007224 | 3300035692 | Bacteria | 6635 |
| 387 | Ga0373935_0031265 | 3300035692 | Bacteria | 3303 |
| 388 | Ga0373927_0018026 | 3300035695 | Bacteria | 4643 |
| 389 | Ga0373927_0040742 | 3300035695 | Bacteria | 3013 |
| 390 | Ga0373933_0012380 | 3300035724 | Bacteria | 4711 |
| 391 | Ga0373937_0078527 | 3300036401 | Bacteria | 3050 |
| 392 | Ga0373937_0105286 | 3300036401 | Bacteria | 2621 |
| 393 | Ga0373937_0121903 | 3300036401 | Bacteria | 2430 |
| 394 | Ga0373937_0142725 | 3300036401 | Bacteria | 2241 |
| 395 | Ga0373937_0182532 | 3300036401 | Bacteria | 1971 |
| 396 | Ga0373925_0002246 | 3300037068 | Bacteria | 15638 |
| 397 | Ga0373925_0034718 | 3300037068 | Bacteria | 3718 |
| 398 | Ga0373925_0084662 | 3300037068 | Bacteria | 2416 |
| 399 | Ga0373925_0217136 | 3300037068 | Bacteria | 1525 |
| 400 | Ga0436360_1171664 | 3300039438 | Bacteria | 1204 |
| 401 | Ga0439461_0000816 | 3300041410 | Bacteria | 4599 |
| 402 | Ga0439441_000133 | 3300042001 | Bacteria | 6237 |
| 403 | Ga0439434_0014388 | 3300042435 | Bacteria | 2353 |
| 404 | Ga0439435_0000222 | 3300042436 | Bacteria | 8087 |
| 405 | Ga0439435_0007845 | 3300042436 | Bacteria | 2460 |
| 406 | Ga0439444_0003774 | 3300042437 | Bacteria | 2161 |
| 407 | Ga0439460_0007270 | 3300042461 | Bacteria | 2763 |
| 408 | Ga0439460_0008593 | 3300042461 | Bacteria | 2581 |
| 409 | Ga0451576_0066861 | 3300045051 | Bacteria | 3741 |
| 410 | Ga0451576_0142537 | 3300045051 | Bacteria | 2499 |
| 411 | Ga0466967_0002352 | 3300045976 | Bacteria | 11705 |
| 412 | Ga0495580_0071642 | 3300046472 | Bacteria | 2421 |
| 413 | Ga0495652_0158925 | 3300046529 | Bacteria | 1757 |
| 414 | Ga0495586_0077253 | 3300046535 | Bacteria | 1825 |
| 415 | Ga0496102_0006283 | 3300048905 | Bacteria | 10129 |
| 416 | Ga0496109_0125424 | 3300048912 | Bacteria | 2394 |
| 417 | Ga0496109_0155317 | 3300048912 | Bacteria | 2143 |
| 418 | Ga0496110_0078728 | 3300048913 | Bacteria | 2935 |
| 419 | Ga0496111_0216714 | 3300048914 | Bacteria | 1422 |
| 420 | Ga0496112_0019850 | 3300048915 | Bacteria | 6359 |
| 421 | Ga0501031_0117106 | 3300049568 | Bacteria | 1741 |
| 422 | Ga0501033_0237531 | 3300049570 | Bacteria | 1293 |
| 423 | Ga0501036_0060808 | 3300049572 | Bacteria | 3199 |
| 424 | Ga0501037_0272737 | 3300049573 | Bacteria | 1180 |
| 425 | Ga0501038_0023127 | 3300049574 | Bacteria | 5561 |
| 426 | Ga0501038_0133101 | 3300049574 | Bacteria | 2039 |
| 427 | Ga0501038_0286329 | 3300049574 | Unclassified | 1296 |
| 428 | Ga0501039_0013237 | 3300049575 | Bacteria | 6307 |
| 429 | Ga0501039_0073764 | 3300049575 | Bacteria | 2651 |
| 430 | Ga0501040_0080524 | 3300049576 | Bacteria | 2256 |
| 431 | Ga0501040_0128685 | 3300049576 | Bacteria | 1779 |
| 432 | Ga0501040_0175319 | 3300049576 | Bacteria | 1519 |
| 433 | Ga0501041_0019570 | 3300049577 | Bacteria | 4043 |
| 434 | Ga0501041_0141983 | 3300049577 | Bacteria | 1497 |
| 435 | Ga0501042_0010164 | 3300049578 | Bacteria | 6297 |
| 436 | Ga0501042_0028096 | 3300049578 | Bacteria | 3959 |
| 437 | Ga0501042_0234957 | 3300049578 | Bacteria | 1323 |
| 438 | Ga0501043_0088323 | 3300049579 | Bacteria | 2436 |
| 439 | Ga0501046_0113655 | 3300049580 | Bacteria | 2066 |
| 440 | Ga0501048_0081201 | 3300049582 | Bacteria | 2287 |
| 441 | Ga0501048_0315267 | 3300049582 | Bacteria | 1114 |
| 442 | Ga0501069_0061640 | 3300049585 | Bacteria | 2095 |
| 443 | Ga0501071_0074857 | 3300049587 | Bacteria | 2471 |
| 444 | Ga0501072_0000694 | 3300049588 | Bacteria | 24389 |
| 445 | Ga0501072_0015257 | 3300049588 | Bacteria | 5889 |
| 446 | Ga0501072_0058881 | 3300049588 | Bacteria | 3028 |
| 447 | Ga0501072_0147911 | 3300049588 | Bacteria | 1873 |
| 448 | Ga0501074_0181969 | 3300049590 | Bacteria | 1499 |
| 449 | Ga0501075_0002986 | 3300049591 | Bacteria | 11313 |
| 450 | Ga0501075_0010150 | 3300049591 | Bacteria | 6609 |
| 451 | Ga0501075_0044831 | 3300049591 | Bacteria | 3318 |
| 452 | Ga0501076_0002670 | 3300049592 | Bacteria | 12307 |
| 453 | Ga0501076_0009683 | 3300049592 | Bacteria | 7117 |
| 454 | Ga0501076_0057578 | 3300049592 | Bacteria | 3086 |
| 455 | Ga0501077_0011324 | 3300049593 | Bacteria | 5570 |
| 456 | Ga0501079_0003783 | 3300049741 | Bacteria | 11174 |
| 457 | Ga0501079_0059319 | 3300049741 | Bacteria | 2952 |
| 458 | Ga0501079_0123655 | 3300049741 | Bacteria | 2012 |
| 459 | Ga0501080_0006239 | 3300049742 | Bacteria | 10695 |
| 460 | Ga0501080_0278840 | 3300049742 | Bacteria | 1520 |
| 461 | Ga0501081_0035003 | 3300049743 | Bacteria | 3418 |
| 462 | Ga0501081_0038545 | 3300049743 | Bacteria | 3266 |
| 463 | Ga0501035_0088424 | 3300049822 | Bacteria | 2730 |
| 464 | Ga0501045_0013057 | 3300049824 | Bacteria | 5857 |
| 465 | Ga0501045_0019724 | 3300049824 | Bacteria | 4810 |
| 466 | Ga0501045_0263792 | 3300049824 | Unclassified | 1282 |
| 467 | nmdc:mga05p37_80176_c1 | 3300050507 | Bacteria | 4021 |
| 468 | nmdc:mga09592_36057_c1 | 3300050508 | Bacteria | 4143 |
| 469 | nmdc:mga09592_87513_c1 | 3300050508 | Bacteria | 2660 |
| 470 | nmdc:mga0qj67_41166_c1 | 3300050509 | Bacteria | 3633 |
| 471 | nmdc:mga0qj67_58465_c1 | 3300050509 | Bacteria | 3057 |
| 472 | nmdc:mga0qj67_81623_c1 | 3300050509 | Bacteria | 2593 |
| 473 | nmdc:mga06r32_17940_c1 | 3300050510 | Bacteria | 6471 |
| 474 | nmdc:mga06r32_20475_c1 | 3300050510 | Bacteria | 6092 |
| 475 | nmdc:mga08y16_345144_c1 | 3300050511 | Bacteria | 1530 |
| 476 | nmdc:mga0n895_12787_c1 | 3300050512 | Bacteria | 7539 |
| 477 | nmdc:mga0n895_25548_c1 | 3300050512 | Bacteria | 5582 |
| 478 | nmdc:mga0rr50_11752_c1 | 3300050513 | Bacteria | 5619 |
| 479 | nmdc:mga0a205_111320_c1 | 3300050515 | Bacteria | 2637 |
| 480 | nmdc:mga0a205_78468_c1 | 3300050515 | Bacteria | 3190 |
| 481 | Ga0495601_0143568 | 3300053077 | Bacteria | 1558 |
| 482 | Ga0501084_0268837 | 3300054114 | Unclassified | 1439 |
| 483 | Ga0590071_002250 | 3300059421 | Bacteria | 4892 |
| 484 | Ga0501082_0056775 | 3300060353 | Bacteria | 3373 |
| 485 | Ga0530510_0000247 | 3300061734 | Bacteria | 33846 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_1171664 | Ga0436360_1171664_24_896 | 281 |
| 2 | 3300009177 | Ga0105248_10568814 | Ga0105248_105688142 | 318 |
| 3 | 3300042437 | Ga0439444_0003774 | Ga0439444_0003774_33_989 | 318 |
| 4 | 3300049573 | Ga0501037_0272737 | Ga0501037_0272737_195_1151 | 318 |
| 5 | 3300049578 | Ga0501042_0010164 | Ga0501042_0010164_13_972 | 318 |
| 6 | 3300049578 | Ga0501042_0234957 | Ga0501042_0234957_344_1300 | 318 |
| 7 | 3300049592 | Ga0501076_0009683 | Ga0501076_0009683_6133_7089 | 318 |
| 8 | 3300050509 | nmdc:mga0qj67_58465_c1 | nmdc:mga0qj67_58465_c1_2035_2994 | 318 |
| 9 | 3300045051 | Ga0451576_0142537 | Ga0451576_0142537_127_1113 | 321 |
| 10 | 3300005444 | Ga0070694_100133039 | Ga0070694_1001330392 | 325 |
| 11 | 3300049574 | Ga0501038_0133101 | Ga0501038_0133101_832_1812 | 325 |
| 12 | 3300006163 | Ga0070715_10054888 | Ga0070715_100548882 | 326 |
| 13 | 3300036401 | Ga0373937_0182532 | Ga0373937_0182532_167_1150 | 327 |
| 14 | 3300046529 | Ga0495652_0158925 | Ga0495652_0158925_256_1239 | 327 |
| 15 | 3300049574 | Ga0501038_0286329 | Ga0501038_0286329_254_1237 | 327 |
| 16 | 3300049588 | Ga0501072_0058881 | Ga0501072_0058881_1474_2457 | 327 |
| 17 | 3300049590 | Ga0501074_0181969 | Ga0501074_0181969_147_1130 | 327 |
| 18 | 3300049592 | Ga0501076_0002670 | Ga0501076_0002670_9514_10497 | 327 |
| 19 | 3300049743 | Ga0501081_0038545 | Ga0501081_0038545_882_1865 | 327 |
| 20 | 3300054114 | Ga0501084_0268837 | Ga0501084_0268837_329_1312 | 327 |
| 21 | 3300005328 | Ga0070676_10183438 | Ga0070676_101834381 | 328 |
| 22 | 3300005336 | Ga0070680_100392581 | Ga0070680_1003925811 | 328 |
| 23 | 3300005353 | Ga0070669_100028306 | Ga0070669_1000283063 | 328 |
| 24 | 3300005356 | Ga0070674_100005784 | Ga0070674_1000057845 | 328 |
| 25 | 3300005435 | Ga0070714_100076562 | Ga0070714_1000765622 | 328 |
| 26 | 3300005436 | Ga0070713_100000031 | Ga0070713_10000003158 | 328 |
| 27 | 3300005440 | Ga0070705_100007589 | Ga0070705_1000075894 | 328 |
| 28 | 3300005441 | Ga0070700_100074267 | Ga0070700_1000742672 | 328 |
| 29 | 3300005456 | Ga0070678_100160650 | Ga0070678_1001606502 | 328 |
| 30 | 3300005459 | Ga0068867_100008998 | Ga0068867_1000089985 | 328 |
| 31 | 3300005467 | Ga0070706_100187081 | Ga0070706_1001870812 | 328 |
| 32 | 3300005468 | Ga0070707_100258289 | Ga0070707_1002582891 | 328 |
| 33 | 3300005468 | Ga0070707_100434766 | Ga0070707_1004347661 | 328 |
| 34 | 3300005471 | Ga0070698_100009043 | Ga0070698_10000904313 | 328 |
| 35 | 3300005471 | Ga0070698_100356689 | Ga0070698_1003566892 | 328 |
| 36 | 3300005518 | Ga0070699_100017245 | Ga0070699_1000172452 | 328 |
| 37 | 3300005536 | Ga0070697_100007116 | Ga0070697_1000071169 | 328 |
| 38 | 3300005536 | Ga0070697_100034545 | Ga0070697_1000345452 | 328 |
| 39 | 3300005536 | Ga0070697_100124782 | Ga0070697_1001247822 | 328 |
| 40 | 3300005543 | Ga0070672_100046623 | Ga0070672_1000466234 | 328 |
| 41 | 3300005545 | Ga0070695_100084120 | Ga0070695_1000841202 | 328 |
| 42 | 3300005546 | Ga0070696_100012859 | Ga0070696_1000128593 | 328 |
| 43 | 3300005546 | Ga0070696_100140187 | Ga0070696_1001401872 | 328 |
| 44 | 3300005549 | Ga0070704_100139120 | Ga0070704_1001391202 | 328 |
| 45 | 3300005614 | Ga0068856_100192882 | Ga0068856_1001928822 | 328 |
| 46 | 3300005615 | Ga0070702_100025695 | Ga0070702_1000256952 | 328 |
| 47 | 3300005617 | Ga0068859_100075446 | Ga0068859_1000754463 | 328 |
| 48 | 3300005719 | Ga0068861_100012323 | Ga0068861_1000123233 | 328 |
| 49 | 3300005842 | Ga0068858_100321960 | Ga0068858_1003219602 | 328 |
| 50 | 3300005843 | Ga0068860_100036880 | Ga0068860_1000368803 | 328 |
| 51 | 3300005843 | Ga0068860_100196532 | Ga0068860_1001965321 | 328 |
| 52 | 3300005844 | Ga0068862_100023570 | Ga0068862_1000235702 | 328 |
| 53 | 3300005985 | Ga0081539_10000521 | Ga0081539_1000052169 | 328 |
| 54 | 3300006846 | Ga0075430_100024465 | Ga0075430_1000244652 | 328 |
| 55 | 3300006846 | Ga0075430_100081693 | Ga0075430_1000816932 | 328 |
| 56 | 3300006847 | Ga0075431_100024247 | Ga0075431_1000242477 | 328 |
| 57 | 3300006847 | Ga0075431_100082592 | Ga0075431_1000825923 | 328 |
| 58 | 3300006871 | Ga0075434_100010242 | Ga0075434_1000102427 | 328 |
| 59 | 3300006880 | Ga0075429_100010719 | Ga0075429_1000107198 | 328 |
| 60 | 3300006880 | Ga0075429_100184852 | Ga0075429_1001848522 | 328 |
| 61 | 3300006881 | Ga0068865_100003924 | Ga0068865_1000039244 | 328 |
| 62 | 3300006914 | Ga0075436_100003776 | Ga0075436_1000037767 | 328 |
| 63 | 3300006914 | Ga0075436_100052273 | Ga0075436_1000522732 | 328 |
| 64 | 3300006931 | Ga0097620_100075447 | Ga0097620_1000754473 | 328 |
| 65 | 3300007076 | Ga0075435_100000996 | Ga0075435_10000099614 | 328 |
| 66 | 3300007076 | Ga0075435_100297959 | Ga0075435_1002979592 | 328 |
| 67 | 3300007265 | Ga0099794_10036244 | Ga0099794_100362442 | 328 |
| 68 | 3300009094 | Ga0111539_10061100 | Ga0111539_100611003 | 328 |
| 69 | 3300009098 | Ga0105245_10067157 | Ga0105245_100671571 | 328 |
| 70 | 3300009147 | Ga0114129_10698016 | Ga0114129_106980161 | 328 |
| 71 | 3300009176 | Ga0105242_10000684 | Ga0105242_1000068420 | 328 |
| 72 | 3300013297 | Ga0157378_10016068 | Ga0157378_100160687 | 328 |
| 73 | 3300013297 | Ga0157378_10277947 | Ga0157378_102779472 | 328 |
| 74 | 3300013306 | Ga0163162_10008337 | Ga0163162_100083379 | 328 |
| 75 | 3300013308 | Ga0157375_10031440 | Ga0157375_100314406 | 328 |
| 76 | 3300014326 | Ga0157380_10026158 | Ga0157380_100261583 | 328 |
| 77 | 3300017792 | Ga0163161_10217757 | Ga0163161_102177572 | 328 |
| 78 | 3300025907 | Ga0207645_10211080 | Ga0207645_102110801 | 328 |
| 79 | 3300025910 | Ga0207684_10035403 | Ga0207684_100354032 | 328 |
| 80 | 3300025916 | Ga0207663_10274584 | Ga0207663_102745841 | 328 |
| 81 | 3300025923 | Ga0207681_10014951 | Ga0207681_100149513 | 328 |
| 82 | 3300025927 | Ga0207687_10044351 | Ga0207687_100443511 | 328 |
| 83 | 3300025928 | Ga0207700_10000084 | Ga0207700_100000842 | 328 |
| 84 | 3300025929 | Ga0207664_10042020 | Ga0207664_100420204 | 328 |
| 85 | 3300025934 | Ga0207686_10009300 | Ga0207686_100093004 | 328 |
| 86 | 3300025938 | Ga0207704_10005159 | Ga0207704_100051591 | 328 |
| 87 | 3300025940 | Ga0207691_10030957 | Ga0207691_100309574 | 328 |
| 88 | 3300026035 | Ga0207703_10078396 | Ga0207703_100783961 | 328 |
| 89 | 3300026075 | Ga0207708_10014098 | Ga0207708_100140984 | 328 |
| 90 | 3300026078 | Ga0207702_10255715 | Ga0207702_102557151 | 328 |
| 91 | 3300026088 | Ga0207641_10190972 | Ga0207641_101909722 | 328 |
| 92 | 3300026089 | Ga0207648_10000476 | Ga0207648_1000047631 | 328 |
| 93 | 3300026118 | Ga0207675_100000846 | Ga0207675_1000008463 | 328 |
| 94 | 3300026121 | Ga0207683_10068917 | Ga0207683_100689172 | 328 |
| 95 | 3300027671 | Ga0209588_1062638 | Ga0209588_10626381 | 328 |
| 96 | 3300028380 | Ga0268265_10017961 | Ga0268265_100179612 | 328 |
| 97 | 3300028381 | Ga0268264_10036052 | Ga0268264_100360523 | 328 |
| 98 | 3300033179 | Ga0307507_10052242 | Ga0307507_100522422 | 328 |
| 99 | 3300035113 | Ga0373936_0017551 | Ga0373936_0017551_691_1680 | 328 |
| 100 | 3300035113 | Ga0373936_0094079 | Ga0373936_0094079_188_1174 | 328 |
| 101 | 3300035170 | Ga0373943_0020691 | Ga0373943_0020691_928_1914 | 328 |
| 102 | 3300035207 | Ga0373942_0003671 | Ga0373942_0003671_1324_2310 | 328 |
| 103 | 3300035691 | Ga0373931_0209253 | Ga0373931_0209253_153_1139 | 328 |
| 104 | 3300035692 | Ga0373935_0007224 | Ga0373935_0007224_3532_4521 | 328 |
| 105 | 3300035692 | Ga0373935_0031265 | Ga0373935_0031265_556_1542 | 328 |
| 106 | 3300035695 | Ga0373927_0018026 | Ga0373927_0018026_1657_2646 | 328 |
| 107 | 3300036401 | Ga0373937_0078527 | Ga0373937_0078527_1006_1995 | 328 |
| 108 | 3300036401 | Ga0373937_0142725 | Ga0373937_0142725_506_1492 | 328 |
| 109 | 3300037068 | Ga0373925_0002246 | Ga0373925_0002246_2411_3397 | 328 |
| 110 | 3300037068 | Ga0373925_0034718 | Ga0373925_0034718_2167_3156 | 328 |
| 111 | 3300037068 | Ga0373925_0084662 | Ga0373925_0084662_511_1497 | 328 |
| 112 | 3300042001 | Ga0439441_000133 | Ga0439441_000133_1688_2677 | 328 |
| 113 | 3300045051 | Ga0451576_0066861 | Ga0451576_0066861_2648_3637 | 328 |
| 114 | 3300045976 | Ga0466967_0002352 | Ga0466967_0002352_8263_9252 | 328 |
| 115 | 3300046535 | Ga0495586_0077253 | Ga0495586_0077253_829_1815 | 328 |
| 116 | 3300049570 | Ga0501033_0237531 | Ga0501033_0237531_156_1214 | 328 |
| 117 | 3300049572 | Ga0501036_0060808 | Ga0501036_0060808_1800_2858 | 328 |
| 118 | 3300049575 | Ga0501039_0013237 | Ga0501039_0013237_4734_5792 | 328 |
| 119 | 3300049576 | Ga0501040_0128685 | Ga0501040_0128685_100_1158 | 328 |
| 120 | 3300049577 | Ga0501041_0141983 | Ga0501041_0141983_193_1251 | 328 |
| 121 | 3300049580 | Ga0501046_0113655 | Ga0501046_0113655_207_1265 | 328 |
| 122 | 3300049582 | Ga0501048_0081201 | Ga0501048_0081201_738_1796 | 328 |
| 123 | 3300049585 | Ga0501069_0061640 | Ga0501069_0061640_614_1600 | 328 |
| 124 | 3300049588 | Ga0501072_0015257 | Ga0501072_0015257_889_1947 | 328 |
| 125 | 3300049591 | Ga0501075_0010150 | Ga0501075_0010150_5307_6365 | 328 |
| 126 | 3300049592 | Ga0501076_0057578 | Ga0501076_0057578_1778_2836 | 328 |
| 127 | 3300049741 | Ga0501079_0123655 | Ga0501079_0123655_351_1409 | 328 |
| 128 | 3300049742 | Ga0501080_0278840 | Ga0501080_0278840_128_1117 | 328 |
| 129 | 3300049743 | Ga0501081_0035003 | Ga0501081_0035003_1859_2917 | 328 |
| 130 | 3300049822 | Ga0501035_0088424 | Ga0501035_0088424_184_1242 | 328 |
| 131 | 3300049824 | Ga0501045_0013057 | Ga0501045_0013057_760_1818 | 328 |
| 132 | 3300049824 | Ga0501045_0263792 | Ga0501045_0263792_18_1004 | 328 |
| 133 | 3300050507 | nmdc:mga05p37_80176_c1 | nmdc:mga05p37_80176_c1_1653_2642 | 328 |
| 134 | 3300050508 | nmdc:mga09592_87513_c1 | nmdc:mga09592_87513_c1_456_1445 | 328 |
| 135 | 3300050510 | nmdc:mga06r32_17940_c1 | nmdc:mga06r32_17940_c1_4631_5620 | 328 |
| 136 | 3300050511 | nmdc:mga08y16_345144_c1 | nmdc:mga08y16_345144_c1_418_1407 | 328 |
| 137 | 3300050512 | nmdc:mga0n895_25548_c1 | nmdc:mga0n895_25548_c1_2733_3719 | 328 |
| 138 | 3300053077 | Ga0495601_0143568 | Ga0495601_0143568_145_1131 | 328 |
| 139 | 3300005328 | Ga0070676_10020822 | Ga0070676_100208224 | 329 |
| 140 | 3300005331 | Ga0070670_100000840 | Ga0070670_1000008408 | 329 |
| 141 | 3300005331 | Ga0070670_100009503 | Ga0070670_1000095039 | 329 |
| 142 | 3300005331 | Ga0070670_100032213 | Ga0070670_1000322131 | 329 |
| 143 | 3300005331 | Ga0070670_100049466 | Ga0070670_1000494664 | 329 |
| 144 | 3300005331 | Ga0070670_100094212 | Ga0070670_1000942121 | 329 |
| 145 | 3300005333 | Ga0070677_10000343 | Ga0070677_100003438 | 329 |
| 146 | 3300005333 | Ga0070677_10072179 | Ga0070677_100721792 | 329 |
| 147 | 3300005334 | Ga0068869_100000025 | Ga0068869_10000002544 | 329 |
| 148 | 3300005335 | Ga0070666_10007974 | Ga0070666_100079745 | 329 |
| 149 | 3300005335 | Ga0070666_10040963 | Ga0070666_100409632 | 329 |
| 150 | 3300005335 | Ga0070666_10049446 | Ga0070666_100494462 | 329 |
| 151 | 3300005338 | Ga0068868_100015555 | Ga0068868_1000155551 | 329 |
| 152 | 3300005338 | Ga0068868_100106770 | Ga0068868_1001067702 | 329 |
| 153 | 3300005339 | Ga0070660_100004883 | Ga0070660_1000048834 | 329 |
| 154 | 3300005344 | Ga0070661_100012900 | Ga0070661_1000129002 | 329 |
| 155 | 3300005347 | Ga0070668_100002498 | Ga0070668_10000249814 | 329 |
| 156 | 3300005347 | Ga0070668_100002549 | Ga0070668_10000254911 | 329 |
| 157 | 3300005347 | Ga0070668_100007175 | Ga0070668_1000071757 | 329 |
| 158 | 3300005347 | Ga0070668_100010955 | Ga0070668_1000109557 | 329 |
| 159 | 3300005347 | Ga0070668_100031144 | Ga0070668_1000311443 | 329 |
| 160 | 3300005347 | Ga0070668_100047702 | Ga0070668_1000477022 | 329 |
| 161 | 3300005353 | Ga0070669_100009220 | Ga0070669_1000092202 | 329 |
| 162 | 3300005353 | Ga0070669_100018043 | Ga0070669_1000180432 | 329 |
| 163 | 3300005354 | Ga0070675_100003678 | Ga0070675_1000036782 | 329 |
| 164 | 3300005354 | Ga0070675_100012472 | Ga0070675_1000124727 | 329 |
| 165 | 3300005354 | Ga0070675_100039898 | Ga0070675_1000398984 | 329 |
| 166 | 3300005354 | Ga0070675_100128481 | Ga0070675_1001284812 | 329 |
| 167 | 3300005355 | Ga0070671_100002054 | Ga0070671_1000020542 | 329 |
| 168 | 3300005355 | Ga0070671_100064224 | Ga0070671_1000642242 | 329 |
| 169 | 3300005356 | Ga0070674_100005249 | Ga0070674_1000052498 | 329 |
| 170 | 3300005356 | Ga0070674_100272642 | Ga0070674_1002726422 | 329 |
| 171 | 3300005364 | Ga0070673_100001140 | Ga0070673_10000114010 | 329 |
| 172 | 3300005364 | Ga0070673_100031620 | Ga0070673_1000316204 | 329 |
| 173 | 3300005364 | Ga0070673_100095172 | Ga0070673_1000951722 | 329 |
| 174 | 3300005364 | Ga0070673_100127837 | Ga0070673_1001278372 | 329 |
| 175 | 3300005366 | Ga0070659_100048704 | Ga0070659_1000487042 | 329 |
| 176 | 3300005367 | Ga0070667_100001812 | Ga0070667_1000018125 | 329 |
| 177 | 3300005367 | Ga0070667_100015613 | Ga0070667_1000156132 | 329 |
| 178 | 3300005367 | Ga0070667_100287845 | Ga0070667_1002878452 | 329 |
| 179 | 3300005435 | Ga0070714_100000451 | Ga0070714_10000045127 | 329 |
| 180 | 3300005440 | Ga0070705_100195006 | Ga0070705_1001950062 | 329 |
| 181 | 3300005445 | Ga0070708_100000522 | Ga0070708_1000005221 | 329 |
| 182 | 3300005455 | Ga0070663_100022191 | Ga0070663_1000221914 | 329 |
| 183 | 3300005455 | Ga0070663_100036791 | Ga0070663_1000367913 | 329 |
| 184 | 3300005456 | Ga0070678_100028874 | Ga0070678_1000288743 | 329 |
| 185 | 3300005456 | Ga0070678_100303083 | Ga0070678_1003030832 | 329 |
| 186 | 3300005457 | Ga0070662_100021446 | Ga0070662_1000214464 | 329 |
| 187 | 3300005457 | Ga0070662_100026838 | Ga0070662_1000268384 | 329 |
| 188 | 3300005457 | Ga0070662_100223291 | Ga0070662_1002232912 | 329 |
| 189 | 3300005458 | Ga0070681_10019661 | Ga0070681_100196617 | 329 |
| 190 | 3300005459 | Ga0068867_100001753 | Ga0068867_1000017536 | 329 |
| 191 | 3300005459 | Ga0068867_100018231 | Ga0068867_1000182314 | 329 |
| 192 | 3300005518 | Ga0070699_100116640 | Ga0070699_1001166402 | 329 |
| 193 | 3300005530 | Ga0070679_100001739 | Ga0070679_10000173917 | 329 |
| 194 | 3300005530 | Ga0070679_100146716 | Ga0070679_1001467162 | 329 |
| 195 | 3300005535 | Ga0070684_100051130 | Ga0070684_1000511303 | 329 |
| 196 | 3300005535 | Ga0070684_100054509 | Ga0070684_1000545093 | 329 |
| 197 | 3300005539 | Ga0068853_100004289 | Ga0068853_1000042892 | 329 |
| 198 | 3300005539 | Ga0068853_100005040 | Ga0068853_1000050408 | 329 |
| 199 | 3300005543 | Ga0070672_100012855 | Ga0070672_1000128554 | 329 |
| 200 | 3300005543 | Ga0070672_100013375 | Ga0070672_1000133755 | 329 |
| 201 | 3300005543 | Ga0070672_100030863 | Ga0070672_1000308632 | 329 |
| 202 | 3300005543 | Ga0070672_100177471 | Ga0070672_1001774712 | 329 |
| 203 | 3300005544 | Ga0070686_100065353 | Ga0070686_1000653533 | 329 |
| 204 | 3300005545 | Ga0070695_100055361 | Ga0070695_1000553612 | 329 |
| 205 | 3300005548 | Ga0070665_100008185 | Ga0070665_1000081854 | 329 |
| 206 | 3300005548 | Ga0070665_100024239 | Ga0070665_1000242396 | 329 |
| 207 | 3300005548 | Ga0070665_100035193 | Ga0070665_1000351935 | 329 |
| 208 | 3300005548 | Ga0070665_100119224 | Ga0070665_1001192243 | 329 |
| 209 | 3300005548 | Ga0070665_100213823 | Ga0070665_1002138232 | 329 |
| 210 | 3300005563 | Ga0068855_100007056 | Ga0068855_10000705614 | 329 |
| 211 | 3300005563 | Ga0068855_100142621 | Ga0068855_1001426212 | 329 |
| 212 | 3300005564 | Ga0070664_100000262 | Ga0070664_10000026223 | 329 |
| 213 | 3300005564 | Ga0070664_100266647 | Ga0070664_1002666472 | 329 |
| 214 | 3300005577 | Ga0068857_100001952 | Ga0068857_10000195220 | 329 |
| 215 | 3300005577 | Ga0068857_100006645 | Ga0068857_1000066456 | 329 |
| 216 | 3300005578 | Ga0068854_100127619 | Ga0068854_1001276192 | 329 |
| 217 | 3300005614 | Ga0068856_100007834 | Ga0068856_10000783413 | 329 |
| 218 | 3300005614 | Ga0068856_100015908 | Ga0068856_1000159087 | 329 |
| 219 | 3300005616 | Ga0068852_100131958 | Ga0068852_1001319582 | 329 |
| 220 | 3300005616 | Ga0068852_100407131 | Ga0068852_1004071312 | 329 |
| 221 | 3300005617 | Ga0068859_100000330 | Ga0068859_10000033019 | 329 |
| 222 | 3300005617 | Ga0068859_100032436 | Ga0068859_1000324364 | 329 |
| 223 | 3300005618 | Ga0068864_100001602 | Ga0068864_1000016025 | 329 |
| 224 | 3300005618 | Ga0068864_100003579 | Ga0068864_1000035796 | 329 |
| 225 | 3300005618 | Ga0068864_100032118 | Ga0068864_1000321183 | 329 |
| 226 | 3300005718 | Ga0068866_10168048 | Ga0068866_101680482 | 329 |
| 227 | 3300005719 | Ga0068861_100000777 | Ga0068861_1000007774 | 329 |
| 228 | 3300005719 | Ga0068861_100066502 | Ga0068861_1000665022 | 329 |
| 229 | 3300005719 | Ga0068861_100069776 | Ga0068861_1000697763 | 329 |
| 230 | 3300005834 | Ga0068851_10001153 | Ga0068851_100011533 | 329 |
| 231 | 3300005834 | Ga0068851_10082506 | Ga0068851_100825063 | 329 |
| 232 | 3300005840 | Ga0068870_10022663 | Ga0068870_100226632 | 329 |
| 233 | 3300005840 | Ga0068870_10078514 | Ga0068870_100785142 | 329 |
| 234 | 3300005840 | Ga0068870_10209808 | Ga0068870_102098082 | 329 |
| 235 | 3300005841 | Ga0068863_100014883 | Ga0068863_1000148837 | 329 |
| 236 | 3300005841 | Ga0068863_100019911 | Ga0068863_1000199117 | 329 |
| 237 | 3300005841 | Ga0068863_100054314 | Ga0068863_1000543142 | 329 |
| 238 | 3300005841 | Ga0068863_100160155 | Ga0068863_1001601552 | 329 |
| 239 | 3300005841 | Ga0068863_100355366 | Ga0068863_1003553662 | 329 |
| 240 | 3300005842 | Ga0068858_100002918 | Ga0068858_1000029184 | 329 |
| 241 | 3300005842 | Ga0068858_100093274 | Ga0068858_1000932743 | 329 |
| 242 | 3300005842 | Ga0068858_100288276 | Ga0068858_1002882762 | 329 |
| 243 | 3300005842 | Ga0068858_100535031 | Ga0068858_1005350311 | 329 |
| 244 | 3300005843 | Ga0068860_100002326 | Ga0068860_10000232610 | 329 |
| 245 | 3300005843 | Ga0068860_100013607 | Ga0068860_1000136075 | 329 |
| 246 | 3300005843 | Ga0068860_100019078 | Ga0068860_1000190783 | 329 |
| 247 | 3300005843 | Ga0068860_100037773 | Ga0068860_1000377733 | 329 |
| 248 | 3300005843 | Ga0068860_100212110 | Ga0068860_1002121102 | 329 |
| 249 | 3300005844 | Ga0068862_100004250 | Ga0068862_1000042504 | 329 |
| 250 | 3300005844 | Ga0068862_100028486 | Ga0068862_1000284864 | 329 |
| 251 | 3300005937 | Ga0081455_10293125 | Ga0081455_102931251 | 329 |
| 252 | 3300006237 | Ga0097621_100002336 | Ga0097621_10000233611 | 329 |
| 253 | 3300006237 | Ga0097621_100003701 | Ga0097621_1000037014 | 329 |
| 254 | 3300006237 | Ga0097621_100008390 | Ga0097621_1000083903 | 329 |
| 255 | 3300006237 | Ga0097621_100026548 | Ga0097621_1000265485 | 329 |
| 256 | 3300006358 | Ga0068871_100003284 | Ga0068871_1000032849 | 329 |
| 257 | 3300006358 | Ga0068871_100042885 | Ga0068871_1000428852 | 329 |
| 258 | 3300006844 | Ga0075428_100117321 | Ga0075428_1001173214 | 329 |
| 259 | 3300006852 | Ga0075433_10085475 | Ga0075433_100854753 | 329 |
| 260 | 3300006881 | Ga0068865_100027370 | Ga0068865_1000273704 | 329 |
| 261 | 3300006881 | Ga0068865_100055339 | Ga0068865_1000553392 | 329 |
| 262 | 3300006881 | Ga0068865_100124463 | Ga0068865_1001244631 | 329 |
| 263 | 3300006931 | Ga0097620_100000330 | Ga0097620_10000033019 | 329 |
| 264 | 3300006931 | Ga0097620_100032436 | Ga0097620_1000324364 | 329 |
| 265 | 3300007076 | Ga0075435_100005730 | Ga0075435_1000057302 | 329 |
| 266 | 3300007076 | Ga0075435_100067205 | Ga0075435_1000672052 | 329 |
| 267 | 3300009093 | Ga0105240_10003200 | Ga0105240_1000320011 | 329 |
| 268 | 3300009148 | Ga0105243_10039506 | Ga0105243_100395064 | 329 |
| 269 | 3300009174 | Ga0105241_10082934 | Ga0105241_100829342 | 329 |
| 270 | 3300009176 | Ga0105242_10021200 | Ga0105242_100212003 | 329 |
| 271 | 3300009177 | Ga0105248_10008280 | Ga0105248_100082803 | 329 |
| 272 | 3300009177 | Ga0105248_10025672 | Ga0105248_100256723 | 329 |
| 273 | 3300009177 | Ga0105248_10098280 | Ga0105248_100982802 | 329 |
| 274 | 3300009177 | Ga0105248_10185673 | Ga0105248_101856732 | 329 |
| 275 | 3300009551 | Ga0105238_10000670 | Ga0105238_1000067020 | 329 |
| 276 | 3300009553 | Ga0105249_10004775 | Ga0105249_100047756 | 329 |
| 277 | 3300009553 | Ga0105249_10081199 | Ga0105249_100811992 | 329 |
| 278 | 3300013100 | Ga0157373_10021603 | Ga0157373_100216033 | 329 |
| 279 | 3300013102 | Ga0157371_10115313 | Ga0157371_101153132 | 329 |
| 280 | 3300013104 | Ga0157370_10003353 | Ga0157370_100033537 | 329 |
| 281 | 3300013105 | Ga0157369_10001648 | Ga0157369_1000164817 | 329 |
| 282 | 3300013297 | Ga0157378_10009398 | Ga0157378_100093985 | 329 |
| 283 | 3300013297 | Ga0157378_10126288 | Ga0157378_101262882 | 329 |
| 284 | 3300013306 | Ga0163162_10013531 | Ga0163162_100135315 | 329 |
| 285 | 3300013307 | Ga0157372_10000841 | Ga0157372_1000084119 | 329 |
| 286 | 3300013308 | Ga0157375_10012622 | Ga0157375_100126223 | 329 |
| 287 | 3300013308 | Ga0157375_10055865 | Ga0157375_100558654 | 329 |
| 288 | 3300013308 | Ga0157375_10057559 | Ga0157375_100575591 | 329 |
| 289 | 3300013308 | Ga0157375_10264262 | Ga0157375_102642622 | 329 |
| 290 | 3300014325 | Ga0163163_10001202 | Ga0163163_1000120217 | 329 |
| 291 | 3300014325 | Ga0163163_10003372 | Ga0163163_1000337212 | 329 |
| 292 | 3300014325 | Ga0163163_10056492 | Ga0163163_100564922 | 329 |
| 293 | 3300014325 | Ga0163163_10248877 | Ga0163163_102488772 | 329 |
| 294 | 3300014326 | Ga0157380_10127804 | Ga0157380_101278042 | 329 |
| 295 | 3300014968 | Ga0157379_10000522 | Ga0157379_1000052221 | 329 |
| 296 | 3300014968 | Ga0157379_10160113 | Ga0157379_101601132 | 329 |
| 297 | 3300014969 | Ga0157376_10210716 | Ga0157376_102107162 | 329 |
| 298 | 3300014969 | Ga0157376_10419395 | Ga0157376_104193951 | 329 |
| 299 | 3300017792 | Ga0163161_10009380 | Ga0163161_100093802 | 329 |
| 300 | 3300025315 | Ga0207697_10031196 | Ga0207697_100311962 | 329 |
| 301 | 3300025321 | Ga0207656_10063126 | Ga0207656_100631262 | 329 |
| 302 | 3300025893 | Ga0207682_10000198 | Ga0207682_1000019822 | 329 |
| 303 | 3300025893 | Ga0207682_10049757 | Ga0207682_100497572 | 329 |
| 304 | 3300025899 | Ga0207642_10056312 | Ga0207642_100563122 | 329 |
| 305 | 3300025901 | Ga0207688_10156661 | Ga0207688_101566612 | 329 |
| 306 | 3300025903 | Ga0207680_10004517 | Ga0207680_100045173 | 329 |
| 307 | 3300025903 | Ga0207680_10016093 | Ga0207680_100160933 | 329 |
| 308 | 3300025903 | Ga0207680_10046950 | Ga0207680_100469502 | 329 |
| 309 | 3300025903 | Ga0207680_10087743 | Ga0207680_100877432 | 329 |
| 310 | 3300025907 | Ga0207645_10000676 | Ga0207645_1000067622 | 329 |
| 311 | 3300025907 | Ga0207645_10009493 | Ga0207645_100094935 | 329 |
| 312 | 3300025907 | Ga0207645_10019774 | Ga0207645_100197741 | 329 |
| 313 | 3300025908 | Ga0207643_10040898 | Ga0207643_100408983 | 329 |
| 314 | 3300025911 | Ga0207654_10115508 | Ga0207654_101155082 | 329 |
| 315 | 3300025912 | Ga0207707_10037480 | Ga0207707_100374805 | 329 |
| 316 | 3300025912 | Ga0207707_10058016 | Ga0207707_100580164 | 329 |
| 317 | 3300025913 | Ga0207695_10020136 | Ga0207695_1002013611 | 329 |
| 318 | 3300025917 | Ga0207660_10076123 | Ga0207660_100761232 | 329 |
| 319 | 3300025919 | Ga0207657_10006985 | Ga0207657_100069854 | 329 |
| 320 | 3300025920 | Ga0207649_10005550 | Ga0207649_100055503 | 329 |
| 321 | 3300025921 | Ga0207652_10003366 | Ga0207652_100033663 | 329 |
| 322 | 3300025921 | Ga0207652_10085287 | Ga0207652_100852874 | 329 |
| 323 | 3300025923 | Ga0207681_10005688 | Ga0207681_100056885 | 329 |
| 324 | 3300025923 | Ga0207681_10031449 | Ga0207681_100314493 | 329 |
| 325 | 3300025923 | Ga0207681_10036993 | Ga0207681_100369933 | 329 |
| 326 | 3300025924 | Ga0207694_10002194 | Ga0207694_100021943 | 329 |
| 327 | 3300025925 | Ga0207650_10004678 | Ga0207650_100046789 | 329 |
| 328 | 3300025925 | Ga0207650_10035053 | Ga0207650_100350533 | 329 |
| 329 | 3300025925 | Ga0207650_10082189 | Ga0207650_100821893 | 329 |
| 330 | 3300025925 | Ga0207650_10237930 | Ga0207650_102379302 | 329 |
| 331 | 3300025925 | Ga0207650_10319076 | Ga0207650_103190762 | 329 |
| 332 | 3300025926 | Ga0207659_10005942 | Ga0207659_100059425 | 329 |
| 333 | 3300025926 | Ga0207659_10059462 | Ga0207659_100594622 | 329 |
| 334 | 3300025926 | Ga0207659_10172293 | Ga0207659_101722932 | 329 |
| 335 | 3300025929 | Ga0207664_10033440 | Ga0207664_100334407 | 329 |
| 336 | 3300025931 | Ga0207644_10019180 | Ga0207644_100191805 | 329 |
| 337 | 3300025931 | Ga0207644_10052129 | Ga0207644_100521292 | 329 |
| 338 | 3300025932 | Ga0207690_10033726 | Ga0207690_100337265 | 329 |
| 339 | 3300025933 | Ga0207706_10007454 | Ga0207706_100074549 | 329 |
| 340 | 3300025933 | Ga0207706_10185923 | Ga0207706_101859232 | 329 |
| 341 | 3300025934 | Ga0207686_10245881 | Ga0207686_102458811 | 329 |
| 342 | 3300025935 | Ga0207709_10017317 | Ga0207709_100173171 | 329 |
| 343 | 3300025938 | Ga0207704_10021005 | Ga0207704_100210052 | 329 |
| 344 | 3300025938 | Ga0207704_10059504 | Ga0207704_100595042 | 329 |
| 345 | 3300025938 | Ga0207704_10322187 | Ga0207704_103221871 | 329 |
| 346 | 3300025940 | Ga0207691_10000243 | Ga0207691_1000024322 | 329 |
| 347 | 3300025940 | Ga0207691_10004761 | Ga0207691_1000476112 | 329 |
| 348 | 3300025940 | Ga0207691_10033363 | Ga0207691_100333633 | 329 |
| 349 | 3300025940 | Ga0207691_10042871 | Ga0207691_100428712 | 329 |
| 350 | 3300025940 | Ga0207691_10176529 | Ga0207691_101765292 | 329 |
| 351 | 3300025940 | Ga0207691_10222557 | Ga0207691_102225572 | 329 |
| 352 | 3300025941 | Ga0207711_10015861 | Ga0207711_100158615 | 329 |
| 353 | 3300025941 | Ga0207711_10032403 | Ga0207711_100324034 | 329 |
| 354 | 3300025942 | Ga0207689_10000072 | Ga0207689_1000007212 | 329 |
| 355 | 3300025942 | Ga0207689_10002822 | Ga0207689_100028226 | 329 |
| 356 | 3300025944 | Ga0207661_10120700 | Ga0207661_101207002 | 329 |
| 357 | 3300025944 | Ga0207661_10162670 | Ga0207661_101626702 | 329 |
| 358 | 3300025944 | Ga0207661_10331133 | Ga0207661_103311332 | 329 |
| 359 | 3300025945 | Ga0207679_10007525 | Ga0207679_100075259 | 329 |
| 360 | 3300025945 | Ga0207679_10237250 | Ga0207679_102372502 | 329 |
| 361 | 3300025949 | Ga0207667_10005160 | Ga0207667_100051603 | 329 |
| 362 | 3300025949 | Ga0207667_10063560 | Ga0207667_100635604 | 329 |
| 363 | 3300025960 | Ga0207651_10012672 | Ga0207651_100126725 | 329 |
| 364 | 3300025960 | Ga0207651_10178584 | Ga0207651_101785842 | 329 |
| 365 | 3300025972 | Ga0207668_10005128 | Ga0207668_100051284 | 329 |
| 366 | 3300025972 | Ga0207668_10014856 | Ga0207668_100148564 | 329 |
| 367 | 3300025972 | Ga0207668_10035335 | Ga0207668_100353352 | 329 |
| 368 | 3300025972 | Ga0207668_10195831 | Ga0207668_101958312 | 329 |
| 369 | 3300025972 | Ga0207668_10208249 | Ga0207668_102082492 | 329 |
| 370 | 3300025981 | Ga0207640_10122576 | Ga0207640_101225762 | 329 |
| 371 | 3300025986 | Ga0207658_10007396 | Ga0207658_100073965 | 329 |
| 372 | 3300025986 | Ga0207658_10019572 | Ga0207658_100195722 | 329 |
| 373 | 3300025986 | Ga0207658_10032041 | Ga0207658_100320413 | 329 |
| 374 | 3300025986 | Ga0207658_10190237 | Ga0207658_101902372 | 329 |
| 375 | 3300026023 | Ga0207677_10031104 | Ga0207677_100311042 | 329 |
| 376 | 3300026035 | Ga0207703_10000588 | Ga0207703_1000058831 | 329 |
| 377 | 3300026041 | Ga0207639_10021685 | Ga0207639_100216854 | 329 |
| 378 | 3300026041 | Ga0207639_10411839 | Ga0207639_104118392 | 329 |
| 379 | 3300026067 | Ga0207678_10020859 | Ga0207678_100208596 | 329 |
| 380 | 3300026067 | Ga0207678_10176375 | Ga0207678_101763752 | 329 |
| 381 | 3300026067 | Ga0207678_10311786 | Ga0207678_103117862 | 329 |
| 382 | 3300026075 | Ga0207708_10202619 | Ga0207708_102026191 | 329 |
| 383 | 3300026078 | Ga0207702_10011568 | Ga0207702_100115685 | 329 |
| 384 | 3300026088 | Ga0207641_10005320 | Ga0207641_100053204 | 329 |
| 385 | 3300026088 | Ga0207641_10035898 | Ga0207641_100358983 | 329 |
| 386 | 3300026088 | Ga0207641_10082260 | Ga0207641_100822602 | 329 |
| 387 | 3300026088 | Ga0207641_10104082 | Ga0207641_101040823 | 329 |
| 388 | 3300026088 | Ga0207641_10122339 | Ga0207641_101223392 | 329 |
| 389 | 3300026088 | Ga0207641_10394644 | Ga0207641_103946442 | 329 |
| 390 | 3300026089 | Ga0207648_10003505 | Ga0207648_1000350512 | 329 |
| 391 | 3300026089 | Ga0207648_10004321 | Ga0207648_1000432111 | 329 |
| 392 | 3300026089 | Ga0207648_10125215 | Ga0207648_101252152 | 329 |
| 393 | 3300026089 | Ga0207648_10284326 | Ga0207648_102843262 | 329 |
| 394 | 3300026089 | Ga0207648_10354104 | Ga0207648_103541042 | 329 |
| 395 | 3300026089 | Ga0207648_10386733 | Ga0207648_103867332 | 329 |
| 396 | 3300026095 | Ga0207676_10008380 | Ga0207676_100083805 | 329 |
| 397 | 3300026095 | Ga0207676_10013905 | Ga0207676_100139055 | 329 |
| 398 | 3300026095 | Ga0207676_10015881 | Ga0207676_100158815 | 329 |
| 399 | 3300026095 | Ga0207676_10197808 | Ga0207676_101978082 | 329 |
| 400 | 3300026116 | Ga0207674_10000020 | Ga0207674_1000002089 | 329 |
| 401 | 3300026116 | Ga0207674_10007698 | Ga0207674_100076985 | 329 |
| 402 | 3300026118 | Ga0207675_100001565 | Ga0207675_1000015656 | 329 |
| 403 | 3300026118 | Ga0207675_100030212 | Ga0207675_1000302124 | 329 |
| 404 | 3300026118 | Ga0207675_100072628 | Ga0207675_1000726282 | 329 |
| 405 | 3300026118 | Ga0207675_100091631 | Ga0207675_1000916311 | 329 |
| 406 | 3300026118 | Ga0207675_100241124 | Ga0207675_1002411241 | 329 |
| 407 | 3300026121 | Ga0207683_10000308 | Ga0207683_1000030822 | 329 |
| 408 | 3300026121 | Ga0207683_10017509 | Ga0207683_100175095 | 329 |
| 409 | 3300026121 | Ga0207683_10109422 | Ga0207683_101094222 | 329 |
| 410 | 3300026142 | Ga0207698_10136796 | Ga0207698_101367962 | 329 |
| 411 | 3300026142 | Ga0207698_10177789 | Ga0207698_101777892 | 329 |
| 412 | 3300027471 | Ga0209995_1003334 | Ga0209995_10033343 | 329 |
| 413 | 3300027614 | Ga0209970_1006292 | Ga0209970_10062922 | 329 |
| 414 | 3300027682 | Ga0209971_1007674 | Ga0209971_10076742 | 329 |
| 415 | 3300027717 | Ga0209998_10030586 | Ga0209998_100305862 | 329 |
| 416 | 3300028379 | Ga0268266_10056421 | Ga0268266_100564213 | 329 |
| 417 | 3300028380 | Ga0268265_10005063 | Ga0268265_100050635 | 329 |
| 418 | 3300028380 | Ga0268265_10101735 | Ga0268265_101017353 | 329 |
| 419 | 3300028381 | Ga0268264_10000593 | Ga0268264_1000059315 | 329 |
| 420 | 3300028381 | Ga0268264_10011874 | Ga0268264_100118745 | 329 |
| 421 | 3300028381 | Ga0268264_10044155 | Ga0268264_100441554 | 329 |
| 422 | 3300028381 | Ga0268264_10237662 | Ga0268264_102376622 | 329 |
| 423 | 3300028381 | Ga0268264_10357642 | Ga0268264_103576422 | 329 |
| 424 | 3300031548 | Ga0307408_100010521 | Ga0307408_1000105216 | 329 |
| 425 | 3300031731 | Ga0307405_10006379 | Ga0307405_100063794 | 329 |
| 426 | 3300031824 | Ga0307413_10015135 | Ga0307413_100151353 | 329 |
| 427 | 3300031852 | Ga0307410_10003556 | Ga0307410_100035567 | 329 |
| 428 | 3300031903 | Ga0307407_10011402 | Ga0307407_100114023 | 329 |
| 429 | 3300031911 | Ga0307412_10016159 | Ga0307412_100161593 | 329 |
| 430 | 3300031995 | Ga0307409_100010606 | Ga0307409_1000106066 | 329 |
| 431 | 3300031995 | Ga0307409_100502546 | Ga0307409_1005025461 | 329 |
| 432 | 3300032002 | Ga0307416_100041793 | Ga0307416_1000417933 | 329 |
| 433 | 3300032002 | Ga0307416_100150969 | Ga0307416_1001509693 | 329 |
| 434 | 3300032005 | Ga0307411_10005803 | Ga0307411_100058036 | 329 |
| 435 | 3300032126 | Ga0307415_100002355 | Ga0307415_1000023558 | 329 |
| 436 | 3300035119 | Ga0373956_0037445 | Ga0373956_0037445_374_1366 | 329 |
| 437 | 3300035691 | Ga0373931_0032743 | Ga0373931_0032743_246_1238 | 329 |
| 438 | 3300035695 | Ga0373927_0040742 | Ga0373927_0040742_1403_2395 | 329 |
| 439 | 3300035724 | Ga0373933_0012380 | Ga0373933_0012380_1696_2688 | 329 |
| 440 | 3300036401 | Ga0373937_0105286 | Ga0373937_0105286_1089_2081 | 329 |
| 441 | 3300036401 | Ga0373937_0121903 | Ga0373937_0121903_1207_2196 | 329 |
| 442 | 3300037068 | Ga0373925_0217136 | Ga0373925_0217136_430_1422 | 329 |
| 443 | 3300041410 | Ga0439461_0000816 | Ga0439461_0000816_534_1526 | 329 |
| 444 | 3300042435 | Ga0439434_0014388 | Ga0439434_0014388_214_1206 | 329 |
| 445 | 3300042436 | Ga0439435_0000222 | Ga0439435_0000222_3061_4053 | 329 |
| 446 | 3300042436 | Ga0439435_0007845 | Ga0439435_0007845_651_1643 | 329 |
| 447 | 3300042461 | Ga0439460_0007270 | Ga0439460_0007270_712_1704 | 329 |
| 448 | 3300042461 | Ga0439460_0008593 | Ga0439460_0008593_1218_2210 | 329 |
| 449 | 3300046472 | Ga0495580_0071642 | Ga0495580_0071642_131_1123 | 329 |
| 450 | 3300048905 | Ga0496102_0006283 | Ga0496102_0006283_8805_9794 | 329 |
| 451 | 3300048912 | Ga0496109_0125424 | Ga0496109_0125424_883_1872 | 329 |
| 452 | 3300048912 | Ga0496109_0155317 | Ga0496109_0155317_175_1164 | 329 |
| 453 | 3300048913 | Ga0496110_0078728 | Ga0496110_0078728_1512_2501 | 329 |
| 454 | 3300048914 | Ga0496111_0216714 | Ga0496111_0216714_394_1383 | 329 |
| 455 | 3300048915 | Ga0496112_0019850 | Ga0496112_0019850_2972_3961 | 329 |
| 456 | 3300049568 | Ga0501031_0117106 | Ga0501031_0117106_669_1661 | 329 |
| 457 | 3300049574 | Ga0501038_0023127 | Ga0501038_0023127_3389_4381 | 329 |
| 458 | 3300049575 | Ga0501039_0073764 | Ga0501039_0073764_302_1294 | 329 |
| 459 | 3300049576 | Ga0501040_0080524 | Ga0501040_0080524_12_1004 | 329 |
| 460 | 3300049576 | Ga0501040_0175319 | Ga0501040_0175319_136_1128 | 329 |
| 461 | 3300049577 | Ga0501041_0019570 | Ga0501041_0019570_1467_2459 | 329 |
| 462 | 3300049578 | Ga0501042_0028096 | Ga0501042_0028096_1620_2612 | 329 |
| 463 | 3300049579 | Ga0501043_0088323 | Ga0501043_0088323_1226_2218 | 329 |
| 464 | 3300049582 | Ga0501048_0315267 | Ga0501048_0315267_58_1050 | 329 |
| 465 | 3300049587 | Ga0501071_0074857 | Ga0501071_0074857_1431_2423 | 329 |
| 466 | 3300049588 | Ga0501072_0000694 | Ga0501072_0000694_5578_6570 | 329 |
| 467 | 3300049588 | Ga0501072_0147911 | Ga0501072_0147911_284_1276 | 329 |
| 468 | 3300049591 | Ga0501075_0002986 | Ga0501075_0002986_8939_9931 | 329 |
| 469 | 3300049591 | Ga0501075_0044831 | Ga0501075_0044831_1778_2770 | 329 |
| 470 | 3300049593 | Ga0501077_0011324 | Ga0501077_0011324_3557_4549 | 329 |
| 471 | 3300049741 | Ga0501079_0003783 | Ga0501079_0003783_3578_4570 | 329 |
| 472 | 3300049741 | Ga0501079_0059319 | Ga0501079_0059319_1649_2641 | 329 |
| 473 | 3300049742 | Ga0501080_0006239 | Ga0501080_0006239_9136_10128 | 329 |
| 474 | 3300049824 | Ga0501045_0019724 | Ga0501045_0019724_2229_3221 | 329 |
| 475 | 3300050508 | nmdc:mga09592_36057_c1 | nmdc:mga09592_36057_c1_340_1332 | 329 |
| 476 | 3300050509 | nmdc:mga0qj67_41166_c1 | nmdc:mga0qj67_41166_c1_631_1623 | 329 |
| 477 | 3300050509 | nmdc:mga0qj67_81623_c1 | nmdc:mga0qj67_81623_c1_917_1909 | 329 |
| 478 | 3300050510 | nmdc:mga06r32_20475_c1 | nmdc:mga06r32_20475_c1_918_1910 | 329 |
| 479 | 3300050512 | nmdc:mga0n895_12787_c1 | nmdc:mga0n895_12787_c1_3048_4037 | 329 |
| 480 | 3300050513 | nmdc:mga0rr50_11752_c1 | nmdc:mga0rr50_11752_c1_1545_2534 | 329 |
| 481 | 3300050515 | nmdc:mga0a205_111320_c1 | nmdc:mga0a205_111320_c1_1215_2204 | 329 |
| 482 | 3300050515 | nmdc:mga0a205_78468_c1 | nmdc:mga0a205_78468_c1_1401_2390 | 329 |
| 483 | 3300059421 | Ga0590071_002250 | Ga0590071_002250_21_1013 | 329 |
| 484 | 3300060353 | Ga0501082_0056775 | Ga0501082_0056775_1432_2424 | 329 |
| 485 | 3300061734 | Ga0530510_0000247 | Ga0530510_0000247_29546_30538 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ofc-assembly1.cif.gz_A | 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase | 0.8988 | 6 | 329 |
| 4ign-assembly2.cif.gz_B | 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd | 0.8976 | 6 | 329 |
| 4lal-assembly2.cif.gz_D | crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil | 0.897 | 4 | 328 |
| 4lal-assembly1.cif.gz_B | crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil | 0.8888 | 4 | 328 |
| 4lam-assembly1.cif.gz_B | crystal structure of cordyceps militaris idcase d323n mutant in complex with 5-carboxyl-uracil | 0.8861 | 4 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lalD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.897 | 4 | 328 | 3.20.20.140 |
| 4ofcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8937 | 4 | 329 | 3.20.20.140 |
| 4lalD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8841 | 4 | 328 | 3.20.20.140 |
| 4ofcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8834 | 4 | 329 | 3.20.20.140 |
| 4eraA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8803 | 3 | 328 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536UHX2-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.991 | 237 | 329 |
GO:0016787
|
| AF-A0A536UKK4-F1-model_v4 | Amidohydrolase | 0.9873 | 4 | 329 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A1F4EXH1-F1-model_v4 | 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase | 0.9858 | 3 | 291 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A536YIW6-F1-model_v4 | Amidohydrolase | 0.9832 | 92 | 329 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A4Q3N836-F1-model_v4 | 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase | 0.983 | 4 | 179 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar