F453171

General Info

Members Datasets Scaffolds Average Seq Length
485 234 485 329

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0237531|Ga0501033_0237531_156_1214
Length 352
Sequence MKPEKKLIAVRACGYSRASKEDCMAGVIDVHTHMLNHEWLELLEKHGKPRYTLAAVPGGLRAIHLDGAPFMTPVPEMFDWDQRIRNMNKAGIDVAVVSLTCPNCYWGDEAVSLRAAQTMNDEMARARKTWPDRIQFFCSLPWQHPSRALQELKRARSLGASGVMVLANIDGKPLTDEAFAPIWKAIDDEKLPVLVHPTAPPGVRDMDMAQFQLTASIGFTFDTSLAVSRMIFDGFFDRYAELKIIASHGGGALPFLIGRLDQCFDNIPACRVKVRERPSLYARRIWADSVVFTDDALAMAVRVFGSERVLYGSDYPHTIGDPIGCLARVDRLPDGVRRRVRSANAKRIFDFE

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.24
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10020822 3300005328 Bacteria 3666
2 Ga0070676_10183438 3300005328 Bacteria 1362
3 Ga0070670_100000840 3300005331 Bacteria 24010
4 Ga0070670_100009503 3300005331 Bacteria 8300
5 Ga0070670_100032213 3300005331 Bacteria 4514
6 Ga0070670_100049466 3300005331 Bacteria 3614
7 Ga0070670_100094212 3300005331 Bacteria 2575
8 Ga0070677_10000343 3300005333 Bacteria 16239
9 Ga0070677_10072179 3300005333 Bacteria 1455
10 Ga0068869_100000025 3300005334 Bacteria 63244
11 Ga0070666_10007974 3300005335 Bacteria 6548
12 Ga0070666_10040963 3300005335 Bacteria 3094
13 Ga0070666_10049446 3300005335 Bacteria 2826
14 Ga0070680_100392581 3300005336 Bacteria 1182
15 Ga0068868_100015555 3300005338 Bacteria 5630
16 Ga0068868_100106770 3300005338 Unclassified 2271
17 Ga0070660_100004883 3300005339 Bacteria 9268
18 Ga0070661_100012900 3300005344 Bacteria 5854
19 Ga0070668_100002498 3300005347 Bacteria 13540
20 Ga0070668_100002549 3300005347 Bacteria 13404
21 Ga0070668_100007175 3300005347 Bacteria 8262
22 Ga0070668_100010955 3300005347 Bacteria 6747
23 Ga0070668_100031144 3300005347 Bacteria 4058
24 Ga0070668_100047702 3300005347 Bacteria 3293
25 Ga0070669_100009220 3300005353 Bacteria 7032
26 Ga0070669_100018043 3300005353 Bacteria 5040
27 Ga0070669_100028306 3300005353 Bacteria 4036
28 Ga0070675_100003678 3300005354 Bacteria 11653
29 Ga0070675_100012472 3300005354 Bacteria 6659
30 Ga0070675_100039898 3300005354 Bacteria 3832
31 Ga0070675_100128481 3300005354 Bacteria 2158
32 Ga0070671_100002054 3300005355 Bacteria 15515
33 Ga0070671_100064224 3300005355 Unclassified 3058
34 Ga0070674_100005249 3300005356 Bacteria 7458
35 Ga0070674_100005784 3300005356 Bacteria 7177
36 Ga0070674_100272642 3300005356 Archaea 1338
37 Ga0070673_100001140 3300005364 Bacteria 15254
38 Ga0070673_100031620 3300005364 Bacteria 3975
39 Ga0070673_100095172 3300005364 Bacteria 2443
40 Ga0070673_100127837 3300005364 Bacteria 2128
41 Ga0070659_100048704 3300005366 Bacteria 3330
42 Ga0070667_100001812 3300005367 Bacteria 19031
43 Ga0070667_100015613 3300005367 Bacteria 6279
44 Ga0070667_100287845 3300005367 Bacteria 1477
45 Ga0070714_100000451 3300005435 Bacteria 29894
46 Ga0070714_100076562 3300005435 Bacteria 2905
47 Ga0070713_100000031 3300005436 Bacteria 88727
48 Ga0070705_100007589 3300005440 Bacteria 5344
49 Ga0070705_100195006 3300005440 Bacteria 1384
50 Ga0070700_100074267 3300005441 Bacteria 2178
51 Ga0070694_100133039 3300005444 Bacteria 1799
52 Ga0070708_100000522 3300005445 Bacteria 28901
53 Ga0070663_100022191 3300005455 Bacteria 4239
54 Ga0070663_100036791 3300005455 Bacteria 3403
55 Ga0070678_100028874 3300005456 Bacteria 3790
56 Ga0070678_100160650 3300005456 Bacteria 1820
57 Ga0070678_100303083 3300005456 Unclassified 1358
58 Ga0070662_100021446 3300005457 Bacteria 4411
59 Ga0070662_100026838 3300005457 Bacteria 3992
60 Ga0070662_100223291 3300005457 Bacteria 1504
61 Ga0070681_10019661 3300005458 Bacteria 6763
62 Ga0068867_100001753 3300005459 Bacteria 15109
63 Ga0068867_100008998 3300005459 Bacteria 7044
64 Ga0068867_100018231 3300005459 Bacteria 4988
65 Ga0070706_100187081 3300005467 Unclassified 1935
66 Ga0070707_100258289 3300005468 Unclassified 1695
67 Ga0070707_100434766 3300005468 Unclassified 1273
68 Ga0070698_100009043 3300005471 Bacteria 10708
69 Ga0070698_100356689 3300005471 Bacteria 1394
70 Ga0070699_100017245 3300005518 Bacteria 6201
71 Ga0070699_100116640 3300005518 Bacteria 2347
72 Ga0070679_100001739 3300005530 Bacteria 19624
73 Ga0070679_100146716 3300005530 Bacteria 2337
74 Ga0070684_100051130 3300005535 Bacteria 3590
75 Ga0070684_100054509 3300005535 Bacteria 3484
76 Ga0070697_100007116 3300005536 Bacteria 8698
77 Ga0070697_100034545 3300005536 Bacteria 4077
78 Ga0070697_100124782 3300005536 Bacteria 2156
79 Ga0068853_100004289 3300005539 Bacteria 11022
80 Ga0068853_100005040 3300005539 Bacteria 10302
81 Ga0070672_100012855 3300005543 Bacteria 5897
82 Ga0070672_100013375 3300005543 Bacteria 5796
83 Ga0070672_100030863 3300005543 Bacteria 4030
84 Ga0070672_100046623 3300005543 Bacteria 3359
85 Ga0070672_100177471 3300005543 Unclassified 1774
86 Ga0070686_100065353 3300005544 Bacteria 2363
87 Ga0070695_100055361 3300005545 Bacteria 2556
88 Ga0070695_100084120 3300005545 Bacteria 2110
89 Ga0070696_100012859 3300005546 Bacteria 5618
90 Ga0070696_100140187 3300005546 Bacteria 1767
91 Ga0070665_100008185 3300005548 Bacteria 10589
92 Ga0070665_100024239 3300005548 Bacteria 6110
93 Ga0070665_100035193 3300005548 Bacteria 5035
94 Ga0070665_100119224 3300005548 Bacteria 2641
95 Ga0070665_100213823 3300005548 Bacteria 1929
96 Ga0070704_100139120 3300005549 Bacteria 1893
97 Ga0068855_100007056 3300005563 Bacteria 13626
98 Ga0068855_100142621 3300005563 Bacteria 2729
99 Ga0070664_100000262 3300005564 Bacteria 37939
100 Ga0070664_100266647 3300005564 Unclassified 1542
101 Ga0068857_100001952 3300005577 Bacteria 16647
102 Ga0068857_100006645 3300005577 Bacteria 9937
103 Ga0068854_100127619 3300005578 Bacteria 1939
104 Ga0068856_100007834 3300005614 Bacteria 10431
105 Ga0068856_100015908 3300005614 Bacteria 7272
106 Ga0068856_100192882 3300005614 Bacteria 2051
107 Ga0070702_100025695 3300005615 Bacteria 3158
108 Ga0068852_100131958 3300005616 Bacteria 2301
109 Ga0068852_100407131 3300005616 Unclassified 1339
110 Ga0068859_100000330 3300005617 Bacteria 47242
111 Ga0068859_100032436 3300005617 Bacteria 5247
112 Ga0068859_100075446 3300005617 Bacteria 3412
113 Ga0068864_100001602 3300005618 Bacteria 18660
114 Ga0068864_100003579 3300005618 Bacteria 12843
115 Ga0068864_100032118 3300005618 Bacteria 4458
116 Ga0068866_10168048 3300005718 Unclassified 1285
117 Ga0068861_100000777 3300005719 Bacteria 19173
118 Ga0068861_100012323 3300005719 Bacteria 5963
119 Ga0068861_100066502 3300005719 Bacteria 2779
120 Ga0068861_100069776 3300005719 Bacteria 2719
121 Ga0068851_10001153 3300005834 Bacteria 11457
122 Ga0068851_10082506 3300005834 Unclassified 1681
123 Ga0068870_10022663 3300005840 Bacteria 3088
124 Ga0068870_10078514 3300005840 Unclassified 1818
125 Ga0068870_10209808 3300005840 Unclassified 1186
126 Ga0068863_100014883 3300005841 Bacteria 7473
127 Ga0068863_100019911 3300005841 Bacteria 6418
128 Ga0068863_100054314 3300005841 Bacteria 3795
129 Ga0068863_100160155 3300005841 Bacteria 2156
130 Ga0068863_100355366 3300005841 Bacteria 1427
131 Ga0068858_100002918 3300005842 Bacteria 17202
132 Ga0068858_100093274 3300005842 Bacteria 2803
133 Ga0068858_100288276 3300005842 Bacteria 1564
134 Ga0068858_100321960 3300005842 Bacteria 1478
135 Ga0068858_100535031 3300005842 Unclassified 1134
136 Ga0068860_100002326 3300005843 Bacteria 19958
137 Ga0068860_100013607 3300005843 Bacteria 7975
138 Ga0068860_100019078 3300005843 Bacteria 6657
139 Ga0068860_100036880 3300005843 Bacteria 4681
140 Ga0068860_100037773 3300005843 Bacteria 4622
141 Ga0068860_100196532 3300005843 Bacteria 1953
142 Ga0068860_100212110 3300005843 Bacteria 1878
143 Ga0068862_100004250 3300005844 Bacteria 12129
144 Ga0068862_100023570 3300005844 Bacteria 5157
145 Ga0068862_100028486 3300005844 Bacteria 4704
146 Ga0081455_10293125 3300005937 Bacteria 1170
147 Ga0081539_10000521 3300005985 Bacteria 80101
148 Ga0070715_10054888 3300006163 Unclassified 1727
149 Ga0097621_100002336 3300006237 Bacteria 12996
150 Ga0097621_100003701 3300006237 Bacteria 10579
151 Ga0097621_100008390 3300006237 Bacteria 7435
152 Ga0097621_100026548 3300006237 Bacteria 4544
153 Ga0068871_100003284 3300006358 Bacteria 11094
154 Ga0068871_100042885 3300006358 Bacteria 3635
155 Ga0075428_100117321 3300006844 Bacteria 2899
156 Ga0075430_100024465 3300006846 Bacteria 5138
157 Ga0075430_100081693 3300006846 Bacteria 2707
158 Ga0075431_100024247 3300006847 Bacteria 6214
159 Ga0075431_100082592 3300006847 Bacteria 3317
160 Ga0075433_10085475 3300006852 Bacteria 2785
161 Ga0075434_100010242 3300006871 Bacteria 8780
162 Ga0075429_100010719 3300006880 Bacteria 7927
163 Ga0075429_100184852 3300006880 Bacteria 1826
164 Ga0068865_100003924 3300006881 Bacteria 8928
165 Ga0068865_100027370 3300006881 Bacteria 3766
166 Ga0068865_100055339 3300006881 Bacteria 2760
167 Ga0068865_100124463 3300006881 Bacteria 1922
168 Ga0075436_100003776 3300006914 Bacteria 10388
169 Ga0075436_100052273 3300006914 Bacteria 2820
170 Ga0097620_100000330 3300006931 Bacteria 47242
171 Ga0097620_100032436 3300006931 Bacteria 5247
172 Ga0097620_100075447 3300006931 Bacteria 3412
173 Ga0075435_100000996 3300007076 Bacteria 17936
174 Ga0075435_100005730 3300007076 Bacteria 8714
175 Ga0075435_100067205 3300007076 Unclassified 2918
176 Ga0075435_100297959 3300007076 Bacteria 1379
177 Ga0099794_10036244 3300007265 Bacteria 2331
178 Ga0105240_10003200 3300009093 Bacteria 25701
179 Ga0111539_10061100 3300009094 Bacteria 4464
180 Ga0105245_10067157 3300009098 Bacteria 3247
181 Ga0114129_10698016 3300009147 Unclassified 1304
182 Ga0105243_10039506 3300009148 Bacteria 3679
183 Ga0105241_10082934 3300009174 Bacteria 2514
184 Ga0105242_10000684 3300009176 Bacteria 26626
185 Ga0105242_10021200 3300009176 Bacteria 5099
186 Ga0105248_10008280 3300009177 Bacteria 11422
187 Ga0105248_10025672 3300009177 Bacteria 6552
188 Ga0105248_10098280 3300009177 Bacteria 3298
189 Ga0105248_10185673 3300009177 Bacteria 2343
190 Ga0105248_10568814 3300009177 Unclassified 1279
191 Ga0105238_10000670 3300009551 Bacteria 35955
192 Ga0105249_10004775 3300009553 Bacteria 11693
193 Ga0105249_10081199 3300009553 Bacteria 3013
194 Ga0157373_10021603 3300013100 Bacteria 4673
195 Ga0157371_10115313 3300013102 Bacteria 1908
196 Ga0157370_10003353 3300013104 Bacteria 18859
197 Ga0157369_10001648 3300013105 Bacteria 27252
198 Ga0157378_10009398 3300013297 Bacteria 8518
199 Ga0157378_10016068 3300013297 Bacteria 6555
200 Ga0157378_10126288 3300013297 Bacteria 2363
201 Ga0157378_10277947 3300013297 Bacteria 1613
202 Ga0163162_10008337 3300013306 Bacteria 10109
203 Ga0163162_10013531 3300013306 Bacteria 7967
204 Ga0157372_10000841 3300013307 Bacteria 33273
205 Ga0157375_10012622 3300013308 Bacteria 7497
206 Ga0157375_10031440 3300013308 Bacteria 5019
207 Ga0157375_10055865 3300013308 Bacteria 3894
208 Ga0157375_10057559 3300013308 Unclassified 3843
209 Ga0157375_10264262 3300013308 Bacteria 1882
210 Ga0163163_10001202 3300014325 Bacteria 21901
211 Ga0163163_10003372 3300014325 Bacteria 13559
212 Ga0163163_10056492 3300014325 Bacteria 3880
213 Ga0163163_10248877 3300014325 Bacteria 1828
214 Ga0157380_10026158 3300014326 Bacteria 4430
215 Ga0157380_10127804 3300014326 Unclassified 2163
216 Ga0157379_10000522 3300014968 Bacteria 31120
217 Ga0157379_10160113 3300014968 Bacteria 2032
218 Ga0157376_10210716 3300014969 Bacteria 1794
219 Ga0157376_10419395 3300014969 Unclassified 1298
220 Ga0163161_10009380 3300017792 Bacteria 6775
221 Ga0163161_10217757 3300017792 Bacteria 1477
222 Ga0207697_10031196 3300025315 Bacteria 2181
223 Ga0207656_10063126 3300025321 Unclassified 1630
224 Ga0207682_10000198 3300025893 Bacteria 27362
225 Ga0207682_10049757 3300025893 Bacteria 1731
226 Ga0207642_10056312 3300025899 Bacteria 1803
227 Ga0207688_10156661 3300025901 Bacteria 1348
228 Ga0207680_10004517 3300025903 Bacteria 6600
229 Ga0207680_10016093 3300025903 Bacteria 3918
230 Ga0207680_10046950 3300025903 Bacteria 2556
231 Ga0207680_10087743 3300025903 Bacteria 1970
232 Ga0207645_10000676 3300025907 Bacteria 28210
233 Ga0207645_10009493 3300025907 Bacteria 6724
234 Ga0207645_10019774 3300025907 Bacteria 4411
235 Ga0207645_10211080 3300025907 Bacteria 1279
236 Ga0207643_10040898 3300025908 Bacteria 2611
237 Ga0207684_10035403 3300025910 Bacteria 4240
238 Ga0207654_10115508 3300025911 Bacteria 1677
239 Ga0207707_10037480 3300025912 Bacteria 4238
240 Ga0207707_10058016 3300025912 Bacteria 3369
241 Ga0207695_10020136 3300025913 Bacteria 7652
242 Ga0207663_10274584 3300025916 Unclassified 1250
243 Ga0207660_10076123 3300025917 Bacteria 2453
244 Ga0207657_10006985 3300025919 Bacteria 11623
245 Ga0207649_10005550 3300025920 Bacteria 6823
246 Ga0207652_10003366 3300025921 Bacteria 13201
247 Ga0207652_10085287 3300025921 Bacteria 2768
248 Ga0207681_10005688 3300025923 Bacteria 7657
249 Ga0207681_10014951 3300025923 Bacteria 4835
250 Ga0207681_10031449 3300025923 Bacteria 3466
251 Ga0207681_10036993 3300025923 Bacteria 3224
252 Ga0207694_10002194 3300025924 Bacteria 16036
253 Ga0207650_10004678 3300025925 Bacteria 9354
254 Ga0207650_10035053 3300025925 Bacteria 3642
255 Ga0207650_10082189 3300025925 Bacteria 2445
256 Ga0207650_10237930 3300025925 Unclassified 1471
257 Ga0207650_10319076 3300025925 Bacteria 1272
258 Ga0207659_10005942 3300025926 Bacteria 7448
259 Ga0207659_10059462 3300025926 Bacteria 2747
260 Ga0207659_10172293 3300025926 Unclassified 1708
261 Ga0207687_10044351 3300025927 Bacteria 3068
262 Ga0207700_10000084 3300025928 Bacteria 58386
263 Ga0207664_10033440 3300025929 Bacteria 3950
264 Ga0207664_10042020 3300025929 Bacteria 3566
265 Ga0207644_10019180 3300025931 Bacteria 4637
266 Ga0207644_10052129 3300025931 Unclassified 2940
267 Ga0207690_10033726 3300025932 Bacteria 3294
268 Ga0207706_10007454 3300025933 Bacteria 10119
269 Ga0207706_10185923 3300025933 Bacteria 1824
270 Ga0207686_10009300 3300025934 Bacteria 5332
271 Ga0207686_10245881 3300025934 Unclassified 1304
272 Ga0207709_10017317 3300025935 Bacteria 4020
273 Ga0207704_10005159 3300025938 Bacteria 6016
274 Ga0207704_10021005 3300025938 Bacteria 3468
275 Ga0207704_10059504 3300025938 Bacteria 2359
276 Ga0207704_10322187 3300025938 Bacteria 1193
277 Ga0207691_10000243 3300025940 Bacteria 53649
278 Ga0207691_10004761 3300025940 Bacteria 13124
279 Ga0207691_10030957 3300025940 Bacteria 4997
280 Ga0207691_10033363 3300025940 Bacteria 4793
281 Ga0207691_10042871 3300025940 Bacteria 4171
282 Ga0207691_10176529 3300025940 Bacteria 1868
283 Ga0207691_10222557 3300025940 Unclassified 1636
284 Ga0207711_10015861 3300025941 Bacteria 6250
285 Ga0207711_10032403 3300025941 Bacteria 4419
286 Ga0207689_10000072 3300025942 Bacteria 82171
287 Ga0207689_10002822 3300025942 Bacteria 16042
288 Ga0207661_10120700 3300025944 Bacteria 2231
289 Ga0207661_10162670 3300025944 Bacteria 1937
290 Ga0207661_10331133 3300025944 Bacteria 1371
291 Ga0207679_10007525 3300025945 Bacteria 6912
292 Ga0207679_10237250 3300025945 Unclassified 1543
293 Ga0207667_10005160 3300025949 Bacteria 15954
294 Ga0207667_10063560 3300025949 Bacteria 3857
295 Ga0207651_10012672 3300025960 Bacteria 4784
296 Ga0207651_10178584 3300025960 Archaea 1682
297 Ga0207668_10005128 3300025972 Bacteria 7706
298 Ga0207668_10014856 3300025972 Bacteria 4827
299 Ga0207668_10035335 3300025972 Bacteria 3326
300 Ga0207668_10195831 3300025972 Unclassified 1605
301 Ga0207668_10208249 3300025972 Bacteria 1562
302 Ga0207640_10122576 3300025981 Bacteria 1865
303 Ga0207658_10007396 3300025986 Bacteria 7489
304 Ga0207658_10019572 3300025986 Bacteria 4681
305 Ga0207658_10032041 3300025986 Bacteria 3738
306 Ga0207658_10190237 3300025986 Unclassified 1705
307 Ga0207677_10031104 3300026023 Bacteria 3416
308 Ga0207703_10000588 3300026035 Bacteria 36998
309 Ga0207703_10078396 3300026035 Bacteria 2745
310 Ga0207639_10021685 3300026041 Bacteria 4617
311 Ga0207639_10411839 3300026041 Bacteria 1220
312 Ga0207678_10020859 3300026067 Bacteria 5743
313 Ga0207678_10176375 3300026067 Bacteria 1825
314 Ga0207678_10311786 3300026067 Bacteria 1353
315 Ga0207708_10014098 3300026075 Bacteria 5973
316 Ga0207708_10202619 3300026075 Bacteria 1584
317 Ga0207702_10011568 3300026078 Bacteria 7353
318 Ga0207702_10255715 3300026078 Bacteria 1647
319 Ga0207641_10005320 3300026088 Bacteria 10990
320 Ga0207641_10035898 3300026088 Bacteria 4134
321 Ga0207641_10082260 3300026088 Unclassified 2797
322 Ga0207641_10104082 3300026088 Bacteria 2505
323 Ga0207641_10122339 3300026088 Bacteria 2324
324 Ga0207641_10190972 3300026088 Bacteria 1883
325 Ga0207641_10394644 3300026088 Unclassified 1327
326 Ga0207648_10000476 3300026089 Bacteria 44737
327 Ga0207648_10003505 3300026089 Bacteria 16438
328 Ga0207648_10004321 3300026089 Bacteria 14629
329 Ga0207648_10125215 3300026089 Bacteria 2260
330 Ga0207648_10284326 3300026089 Bacteria 1480
331 Ga0207648_10354104 3300026089 Bacteria 1324
332 Ga0207648_10386733 3300026089 Bacteria 1266
333 Ga0207676_10008380 3300026095 Bacteria 7347
334 Ga0207676_10013905 3300026095 Bacteria 5777
335 Ga0207676_10015881 3300026095 Bacteria 5445
336 Ga0207676_10197808 3300026095 Unclassified 1773
337 Ga0207674_10000020 3300026116 Bacteria 162474
338 Ga0207674_10007698 3300026116 Bacteria 12542
339 Ga0207675_100000846 3300026118 Bacteria 30438
340 Ga0207675_100001565 3300026118 Bacteria 22938
341 Ga0207675_100030212 3300026118 Bacteria 5046
342 Ga0207675_100072628 3300026118 Bacteria 3218
343 Ga0207675_100091631 3300026118 Bacteria 2858
344 Ga0207675_100241124 3300026118 Unclassified 1747
345 Ga0207683_10000308 3300026121 Bacteria 44216
346 Ga0207683_10017509 3300026121 Bacteria 6108
347 Ga0207683_10068917 3300026121 Bacteria 3124
348 Ga0207683_10109422 3300026121 Bacteria 2473
349 Ga0207698_10136796 3300026142 Bacteria 2103
350 Ga0207698_10177789 3300026142 Bacteria 1881
351 Ga0209995_1003334 3300027471 Bacteria 2559
352 Ga0209970_1006292 3300027614 Bacteria 1944
353 Ga0209588_1062638 3300027671 Bacteria 1202
354 Ga0209971_1007674 3300027682 Bacteria 2561
355 Ga0209998_10030586 3300027717 Bacteria 1190
356 Ga0268266_10056421 3300028379 Bacteria 3379
357 Ga0268265_10005063 3300028380 Bacteria 9044
358 Ga0268265_10017961 3300028380 Bacteria 4894
359 Ga0268265_10101735 3300028380 Bacteria 2322
360 Ga0268264_10000593 3300028381 Bacteria 43940
361 Ga0268264_10011874 3300028381 Bacteria 7175
362 Ga0268264_10036052 3300028381 Bacteria 4072
363 Ga0268264_10044155 3300028381 Bacteria 3696
364 Ga0268264_10237662 3300028381 Bacteria 1686
365 Ga0268264_10357642 3300028381 Bacteria 1392
366 Ga0307408_100010521 3300031548 Bacteria 6099
367 Ga0307405_10006379 3300031731 Bacteria 5797
368 Ga0307413_10015135 3300031824 Bacteria 3944
369 Ga0307410_10003556 3300031852 Bacteria 7845
370 Ga0307407_10011402 3300031903 Bacteria 4229
371 Ga0307412_10016159 3300031911 Bacteria 4439
372 Ga0307409_100010606 3300031995 Bacteria 5742
373 Ga0307409_100502546 3300031995 Bacteria 1181
374 Ga0307416_100041793 3300032002 Bacteria 3573
375 Ga0307416_100150969 3300032002 Bacteria 2131
376 Ga0307411_10005803 3300032005 Bacteria 6114
377 Ga0307415_100002355 3300032126 Bacteria 9398
378 Ga0307507_10052242 3300033179 Bacteria 3921
379 Ga0373936_0017551 3300035113 Bacteria 2757
380 Ga0373936_0094079 3300035113 Bacteria 1259
381 Ga0373956_0037445 3300035119 Bacteria 2144
382 Ga0373943_0020691 3300035170 Bacteria 3036
383 Ga0373942_0003671 3300035207 Bacteria 3600
384 Ga0373931_0032743 3300035691 Bacteria 2691
385 Ga0373931_0209253 3300035691 Bacteria 1169
386 Ga0373935_0007224 3300035692 Bacteria 6635
387 Ga0373935_0031265 3300035692 Bacteria 3303
388 Ga0373927_0018026 3300035695 Bacteria 4643
389 Ga0373927_0040742 3300035695 Bacteria 3013
390 Ga0373933_0012380 3300035724 Bacteria 4711
391 Ga0373937_0078527 3300036401 Bacteria 3050
392 Ga0373937_0105286 3300036401 Bacteria 2621
393 Ga0373937_0121903 3300036401 Bacteria 2430
394 Ga0373937_0142725 3300036401 Bacteria 2241
395 Ga0373937_0182532 3300036401 Bacteria 1971
396 Ga0373925_0002246 3300037068 Bacteria 15638
397 Ga0373925_0034718 3300037068 Bacteria 3718
398 Ga0373925_0084662 3300037068 Bacteria 2416
399 Ga0373925_0217136 3300037068 Bacteria 1525
400 Ga0436360_1171664 3300039438 Bacteria 1204
401 Ga0439461_0000816 3300041410 Bacteria 4599
402 Ga0439441_000133 3300042001 Bacteria 6237
403 Ga0439434_0014388 3300042435 Bacteria 2353
404 Ga0439435_0000222 3300042436 Bacteria 8087
405 Ga0439435_0007845 3300042436 Bacteria 2460
406 Ga0439444_0003774 3300042437 Bacteria 2161
407 Ga0439460_0007270 3300042461 Bacteria 2763
408 Ga0439460_0008593 3300042461 Bacteria 2581
409 Ga0451576_0066861 3300045051 Bacteria 3741
410 Ga0451576_0142537 3300045051 Bacteria 2499
411 Ga0466967_0002352 3300045976 Bacteria 11705
412 Ga0495580_0071642 3300046472 Bacteria 2421
413 Ga0495652_0158925 3300046529 Bacteria 1757
414 Ga0495586_0077253 3300046535 Bacteria 1825
415 Ga0496102_0006283 3300048905 Bacteria 10129
416 Ga0496109_0125424 3300048912 Bacteria 2394
417 Ga0496109_0155317 3300048912 Bacteria 2143
418 Ga0496110_0078728 3300048913 Bacteria 2935
419 Ga0496111_0216714 3300048914 Bacteria 1422
420 Ga0496112_0019850 3300048915 Bacteria 6359
421 Ga0501031_0117106 3300049568 Bacteria 1741
422 Ga0501033_0237531 3300049570 Bacteria 1293
423 Ga0501036_0060808 3300049572 Bacteria 3199
424 Ga0501037_0272737 3300049573 Bacteria 1180
425 Ga0501038_0023127 3300049574 Bacteria 5561
426 Ga0501038_0133101 3300049574 Bacteria 2039
427 Ga0501038_0286329 3300049574 Unclassified 1296
428 Ga0501039_0013237 3300049575 Bacteria 6307
429 Ga0501039_0073764 3300049575 Bacteria 2651
430 Ga0501040_0080524 3300049576 Bacteria 2256
431 Ga0501040_0128685 3300049576 Bacteria 1779
432 Ga0501040_0175319 3300049576 Bacteria 1519
433 Ga0501041_0019570 3300049577 Bacteria 4043
434 Ga0501041_0141983 3300049577 Bacteria 1497
435 Ga0501042_0010164 3300049578 Bacteria 6297
436 Ga0501042_0028096 3300049578 Bacteria 3959
437 Ga0501042_0234957 3300049578 Bacteria 1323
438 Ga0501043_0088323 3300049579 Bacteria 2436
439 Ga0501046_0113655 3300049580 Bacteria 2066
440 Ga0501048_0081201 3300049582 Bacteria 2287
441 Ga0501048_0315267 3300049582 Bacteria 1114
442 Ga0501069_0061640 3300049585 Bacteria 2095
443 Ga0501071_0074857 3300049587 Bacteria 2471
444 Ga0501072_0000694 3300049588 Bacteria 24389
445 Ga0501072_0015257 3300049588 Bacteria 5889
446 Ga0501072_0058881 3300049588 Bacteria 3028
447 Ga0501072_0147911 3300049588 Bacteria 1873
448 Ga0501074_0181969 3300049590 Bacteria 1499
449 Ga0501075_0002986 3300049591 Bacteria 11313
450 Ga0501075_0010150 3300049591 Bacteria 6609
451 Ga0501075_0044831 3300049591 Bacteria 3318
452 Ga0501076_0002670 3300049592 Bacteria 12307
453 Ga0501076_0009683 3300049592 Bacteria 7117
454 Ga0501076_0057578 3300049592 Bacteria 3086
455 Ga0501077_0011324 3300049593 Bacteria 5570
456 Ga0501079_0003783 3300049741 Bacteria 11174
457 Ga0501079_0059319 3300049741 Bacteria 2952
458 Ga0501079_0123655 3300049741 Bacteria 2012
459 Ga0501080_0006239 3300049742 Bacteria 10695
460 Ga0501080_0278840 3300049742 Bacteria 1520
461 Ga0501081_0035003 3300049743 Bacteria 3418
462 Ga0501081_0038545 3300049743 Bacteria 3266
463 Ga0501035_0088424 3300049822 Bacteria 2730
464 Ga0501045_0013057 3300049824 Bacteria 5857
465 Ga0501045_0019724 3300049824 Bacteria 4810
466 Ga0501045_0263792 3300049824 Unclassified 1282
467 nmdc:mga05p37_80176_c1 3300050507 Bacteria 4021
468 nmdc:mga09592_36057_c1 3300050508 Bacteria 4143
469 nmdc:mga09592_87513_c1 3300050508 Bacteria 2660
470 nmdc:mga0qj67_41166_c1 3300050509 Bacteria 3633
471 nmdc:mga0qj67_58465_c1 3300050509 Bacteria 3057
472 nmdc:mga0qj67_81623_c1 3300050509 Bacteria 2593
473 nmdc:mga06r32_17940_c1 3300050510 Bacteria 6471
474 nmdc:mga06r32_20475_c1 3300050510 Bacteria 6092
475 nmdc:mga08y16_345144_c1 3300050511 Bacteria 1530
476 nmdc:mga0n895_12787_c1 3300050512 Bacteria 7539
477 nmdc:mga0n895_25548_c1 3300050512 Bacteria 5582
478 nmdc:mga0rr50_11752_c1 3300050513 Bacteria 5619
479 nmdc:mga0a205_111320_c1 3300050515 Bacteria 2637
480 nmdc:mga0a205_78468_c1 3300050515 Bacteria 3190
481 Ga0495601_0143568 3300053077 Bacteria 1558
482 Ga0501084_0268837 3300054114 Unclassified 1439
483 Ga0590071_002250 3300059421 Bacteria 4892
484 Ga0501082_0056775 3300060353 Bacteria 3373
485 Ga0530510_0000247 3300061734 Bacteria 33846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_1171664 Ga0436360_1171664_24_896 281
2 3300009177 Ga0105248_10568814 Ga0105248_105688142 318
3 3300042437 Ga0439444_0003774 Ga0439444_0003774_33_989 318
4 3300049573 Ga0501037_0272737 Ga0501037_0272737_195_1151 318
5 3300049578 Ga0501042_0010164 Ga0501042_0010164_13_972 318
6 3300049578 Ga0501042_0234957 Ga0501042_0234957_344_1300 318
7 3300049592 Ga0501076_0009683 Ga0501076_0009683_6133_7089 318
8 3300050509 nmdc:mga0qj67_58465_c1 nmdc:mga0qj67_58465_c1_2035_2994 318
9 3300045051 Ga0451576_0142537 Ga0451576_0142537_127_1113 321
10 3300005444 Ga0070694_100133039 Ga0070694_1001330392 325
11 3300049574 Ga0501038_0133101 Ga0501038_0133101_832_1812 325
12 3300006163 Ga0070715_10054888 Ga0070715_100548882 326
13 3300036401 Ga0373937_0182532 Ga0373937_0182532_167_1150 327
14 3300046529 Ga0495652_0158925 Ga0495652_0158925_256_1239 327
15 3300049574 Ga0501038_0286329 Ga0501038_0286329_254_1237 327
16 3300049588 Ga0501072_0058881 Ga0501072_0058881_1474_2457 327
17 3300049590 Ga0501074_0181969 Ga0501074_0181969_147_1130 327
18 3300049592 Ga0501076_0002670 Ga0501076_0002670_9514_10497 327
19 3300049743 Ga0501081_0038545 Ga0501081_0038545_882_1865 327
20 3300054114 Ga0501084_0268837 Ga0501084_0268837_329_1312 327
21 3300005328 Ga0070676_10183438 Ga0070676_101834381 328
22 3300005336 Ga0070680_100392581 Ga0070680_1003925811 328
23 3300005353 Ga0070669_100028306 Ga0070669_1000283063 328
24 3300005356 Ga0070674_100005784 Ga0070674_1000057845 328
25 3300005435 Ga0070714_100076562 Ga0070714_1000765622 328
26 3300005436 Ga0070713_100000031 Ga0070713_10000003158 328
27 3300005440 Ga0070705_100007589 Ga0070705_1000075894 328
28 3300005441 Ga0070700_100074267 Ga0070700_1000742672 328
29 3300005456 Ga0070678_100160650 Ga0070678_1001606502 328
30 3300005459 Ga0068867_100008998 Ga0068867_1000089985 328
31 3300005467 Ga0070706_100187081 Ga0070706_1001870812 328
32 3300005468 Ga0070707_100258289 Ga0070707_1002582891 328
33 3300005468 Ga0070707_100434766 Ga0070707_1004347661 328
34 3300005471 Ga0070698_100009043 Ga0070698_10000904313 328
35 3300005471 Ga0070698_100356689 Ga0070698_1003566892 328
36 3300005518 Ga0070699_100017245 Ga0070699_1000172452 328
37 3300005536 Ga0070697_100007116 Ga0070697_1000071169 328
38 3300005536 Ga0070697_100034545 Ga0070697_1000345452 328
39 3300005536 Ga0070697_100124782 Ga0070697_1001247822 328
40 3300005543 Ga0070672_100046623 Ga0070672_1000466234 328
41 3300005545 Ga0070695_100084120 Ga0070695_1000841202 328
42 3300005546 Ga0070696_100012859 Ga0070696_1000128593 328
43 3300005546 Ga0070696_100140187 Ga0070696_1001401872 328
44 3300005549 Ga0070704_100139120 Ga0070704_1001391202 328
45 3300005614 Ga0068856_100192882 Ga0068856_1001928822 328
46 3300005615 Ga0070702_100025695 Ga0070702_1000256952 328
47 3300005617 Ga0068859_100075446 Ga0068859_1000754463 328
48 3300005719 Ga0068861_100012323 Ga0068861_1000123233 328
49 3300005842 Ga0068858_100321960 Ga0068858_1003219602 328
50 3300005843 Ga0068860_100036880 Ga0068860_1000368803 328
51 3300005843 Ga0068860_100196532 Ga0068860_1001965321 328
52 3300005844 Ga0068862_100023570 Ga0068862_1000235702 328
53 3300005985 Ga0081539_10000521 Ga0081539_1000052169 328
54 3300006846 Ga0075430_100024465 Ga0075430_1000244652 328
55 3300006846 Ga0075430_100081693 Ga0075430_1000816932 328
56 3300006847 Ga0075431_100024247 Ga0075431_1000242477 328
57 3300006847 Ga0075431_100082592 Ga0075431_1000825923 328
58 3300006871 Ga0075434_100010242 Ga0075434_1000102427 328
59 3300006880 Ga0075429_100010719 Ga0075429_1000107198 328
60 3300006880 Ga0075429_100184852 Ga0075429_1001848522 328
61 3300006881 Ga0068865_100003924 Ga0068865_1000039244 328
62 3300006914 Ga0075436_100003776 Ga0075436_1000037767 328
63 3300006914 Ga0075436_100052273 Ga0075436_1000522732 328
64 3300006931 Ga0097620_100075447 Ga0097620_1000754473 328
65 3300007076 Ga0075435_100000996 Ga0075435_10000099614 328
66 3300007076 Ga0075435_100297959 Ga0075435_1002979592 328
67 3300007265 Ga0099794_10036244 Ga0099794_100362442 328
68 3300009094 Ga0111539_10061100 Ga0111539_100611003 328
69 3300009098 Ga0105245_10067157 Ga0105245_100671571 328
70 3300009147 Ga0114129_10698016 Ga0114129_106980161 328
71 3300009176 Ga0105242_10000684 Ga0105242_1000068420 328
72 3300013297 Ga0157378_10016068 Ga0157378_100160687 328
73 3300013297 Ga0157378_10277947 Ga0157378_102779472 328
74 3300013306 Ga0163162_10008337 Ga0163162_100083379 328
75 3300013308 Ga0157375_10031440 Ga0157375_100314406 328
76 3300014326 Ga0157380_10026158 Ga0157380_100261583 328
77 3300017792 Ga0163161_10217757 Ga0163161_102177572 328
78 3300025907 Ga0207645_10211080 Ga0207645_102110801 328
79 3300025910 Ga0207684_10035403 Ga0207684_100354032 328
80 3300025916 Ga0207663_10274584 Ga0207663_102745841 328
81 3300025923 Ga0207681_10014951 Ga0207681_100149513 328
82 3300025927 Ga0207687_10044351 Ga0207687_100443511 328
83 3300025928 Ga0207700_10000084 Ga0207700_100000842 328
84 3300025929 Ga0207664_10042020 Ga0207664_100420204 328
85 3300025934 Ga0207686_10009300 Ga0207686_100093004 328
86 3300025938 Ga0207704_10005159 Ga0207704_100051591 328
87 3300025940 Ga0207691_10030957 Ga0207691_100309574 328
88 3300026035 Ga0207703_10078396 Ga0207703_100783961 328
89 3300026075 Ga0207708_10014098 Ga0207708_100140984 328
90 3300026078 Ga0207702_10255715 Ga0207702_102557151 328
91 3300026088 Ga0207641_10190972 Ga0207641_101909722 328
92 3300026089 Ga0207648_10000476 Ga0207648_1000047631 328
93 3300026118 Ga0207675_100000846 Ga0207675_1000008463 328
94 3300026121 Ga0207683_10068917 Ga0207683_100689172 328
95 3300027671 Ga0209588_1062638 Ga0209588_10626381 328
96 3300028380 Ga0268265_10017961 Ga0268265_100179612 328
97 3300028381 Ga0268264_10036052 Ga0268264_100360523 328
98 3300033179 Ga0307507_10052242 Ga0307507_100522422 328
99 3300035113 Ga0373936_0017551 Ga0373936_0017551_691_1680 328
100 3300035113 Ga0373936_0094079 Ga0373936_0094079_188_1174 328
101 3300035170 Ga0373943_0020691 Ga0373943_0020691_928_1914 328
102 3300035207 Ga0373942_0003671 Ga0373942_0003671_1324_2310 328
103 3300035691 Ga0373931_0209253 Ga0373931_0209253_153_1139 328
104 3300035692 Ga0373935_0007224 Ga0373935_0007224_3532_4521 328
105 3300035692 Ga0373935_0031265 Ga0373935_0031265_556_1542 328
106 3300035695 Ga0373927_0018026 Ga0373927_0018026_1657_2646 328
107 3300036401 Ga0373937_0078527 Ga0373937_0078527_1006_1995 328
108 3300036401 Ga0373937_0142725 Ga0373937_0142725_506_1492 328
109 3300037068 Ga0373925_0002246 Ga0373925_0002246_2411_3397 328
110 3300037068 Ga0373925_0034718 Ga0373925_0034718_2167_3156 328
111 3300037068 Ga0373925_0084662 Ga0373925_0084662_511_1497 328
112 3300042001 Ga0439441_000133 Ga0439441_000133_1688_2677 328
113 3300045051 Ga0451576_0066861 Ga0451576_0066861_2648_3637 328
114 3300045976 Ga0466967_0002352 Ga0466967_0002352_8263_9252 328
115 3300046535 Ga0495586_0077253 Ga0495586_0077253_829_1815 328
116 3300049570 Ga0501033_0237531 Ga0501033_0237531_156_1214 328
117 3300049572 Ga0501036_0060808 Ga0501036_0060808_1800_2858 328
118 3300049575 Ga0501039_0013237 Ga0501039_0013237_4734_5792 328
119 3300049576 Ga0501040_0128685 Ga0501040_0128685_100_1158 328
120 3300049577 Ga0501041_0141983 Ga0501041_0141983_193_1251 328
121 3300049580 Ga0501046_0113655 Ga0501046_0113655_207_1265 328
122 3300049582 Ga0501048_0081201 Ga0501048_0081201_738_1796 328
123 3300049585 Ga0501069_0061640 Ga0501069_0061640_614_1600 328
124 3300049588 Ga0501072_0015257 Ga0501072_0015257_889_1947 328
125 3300049591 Ga0501075_0010150 Ga0501075_0010150_5307_6365 328
126 3300049592 Ga0501076_0057578 Ga0501076_0057578_1778_2836 328
127 3300049741 Ga0501079_0123655 Ga0501079_0123655_351_1409 328
128 3300049742 Ga0501080_0278840 Ga0501080_0278840_128_1117 328
129 3300049743 Ga0501081_0035003 Ga0501081_0035003_1859_2917 328
130 3300049822 Ga0501035_0088424 Ga0501035_0088424_184_1242 328
131 3300049824 Ga0501045_0013057 Ga0501045_0013057_760_1818 328
132 3300049824 Ga0501045_0263792 Ga0501045_0263792_18_1004 328
133 3300050507 nmdc:mga05p37_80176_c1 nmdc:mga05p37_80176_c1_1653_2642 328
134 3300050508 nmdc:mga09592_87513_c1 nmdc:mga09592_87513_c1_456_1445 328
135 3300050510 nmdc:mga06r32_17940_c1 nmdc:mga06r32_17940_c1_4631_5620 328
136 3300050511 nmdc:mga08y16_345144_c1 nmdc:mga08y16_345144_c1_418_1407 328
137 3300050512 nmdc:mga0n895_25548_c1 nmdc:mga0n895_25548_c1_2733_3719 328
138 3300053077 Ga0495601_0143568 Ga0495601_0143568_145_1131 328
139 3300005328 Ga0070676_10020822 Ga0070676_100208224 329
140 3300005331 Ga0070670_100000840 Ga0070670_1000008408 329
141 3300005331 Ga0070670_100009503 Ga0070670_1000095039 329
142 3300005331 Ga0070670_100032213 Ga0070670_1000322131 329
143 3300005331 Ga0070670_100049466 Ga0070670_1000494664 329
144 3300005331 Ga0070670_100094212 Ga0070670_1000942121 329
145 3300005333 Ga0070677_10000343 Ga0070677_100003438 329
146 3300005333 Ga0070677_10072179 Ga0070677_100721792 329
147 3300005334 Ga0068869_100000025 Ga0068869_10000002544 329
148 3300005335 Ga0070666_10007974 Ga0070666_100079745 329
149 3300005335 Ga0070666_10040963 Ga0070666_100409632 329
150 3300005335 Ga0070666_10049446 Ga0070666_100494462 329
151 3300005338 Ga0068868_100015555 Ga0068868_1000155551 329
152 3300005338 Ga0068868_100106770 Ga0068868_1001067702 329
153 3300005339 Ga0070660_100004883 Ga0070660_1000048834 329
154 3300005344 Ga0070661_100012900 Ga0070661_1000129002 329
155 3300005347 Ga0070668_100002498 Ga0070668_10000249814 329
156 3300005347 Ga0070668_100002549 Ga0070668_10000254911 329
157 3300005347 Ga0070668_100007175 Ga0070668_1000071757 329
158 3300005347 Ga0070668_100010955 Ga0070668_1000109557 329
159 3300005347 Ga0070668_100031144 Ga0070668_1000311443 329
160 3300005347 Ga0070668_100047702 Ga0070668_1000477022 329
161 3300005353 Ga0070669_100009220 Ga0070669_1000092202 329
162 3300005353 Ga0070669_100018043 Ga0070669_1000180432 329
163 3300005354 Ga0070675_100003678 Ga0070675_1000036782 329
164 3300005354 Ga0070675_100012472 Ga0070675_1000124727 329
165 3300005354 Ga0070675_100039898 Ga0070675_1000398984 329
166 3300005354 Ga0070675_100128481 Ga0070675_1001284812 329
167 3300005355 Ga0070671_100002054 Ga0070671_1000020542 329
168 3300005355 Ga0070671_100064224 Ga0070671_1000642242 329
169 3300005356 Ga0070674_100005249 Ga0070674_1000052498 329
170 3300005356 Ga0070674_100272642 Ga0070674_1002726422 329
171 3300005364 Ga0070673_100001140 Ga0070673_10000114010 329
172 3300005364 Ga0070673_100031620 Ga0070673_1000316204 329
173 3300005364 Ga0070673_100095172 Ga0070673_1000951722 329
174 3300005364 Ga0070673_100127837 Ga0070673_1001278372 329
175 3300005366 Ga0070659_100048704 Ga0070659_1000487042 329
176 3300005367 Ga0070667_100001812 Ga0070667_1000018125 329
177 3300005367 Ga0070667_100015613 Ga0070667_1000156132 329
178 3300005367 Ga0070667_100287845 Ga0070667_1002878452 329
179 3300005435 Ga0070714_100000451 Ga0070714_10000045127 329
180 3300005440 Ga0070705_100195006 Ga0070705_1001950062 329
181 3300005445 Ga0070708_100000522 Ga0070708_1000005221 329
182 3300005455 Ga0070663_100022191 Ga0070663_1000221914 329
183 3300005455 Ga0070663_100036791 Ga0070663_1000367913 329
184 3300005456 Ga0070678_100028874 Ga0070678_1000288743 329
185 3300005456 Ga0070678_100303083 Ga0070678_1003030832 329
186 3300005457 Ga0070662_100021446 Ga0070662_1000214464 329
187 3300005457 Ga0070662_100026838 Ga0070662_1000268384 329
188 3300005457 Ga0070662_100223291 Ga0070662_1002232912 329
189 3300005458 Ga0070681_10019661 Ga0070681_100196617 329
190 3300005459 Ga0068867_100001753 Ga0068867_1000017536 329
191 3300005459 Ga0068867_100018231 Ga0068867_1000182314 329
192 3300005518 Ga0070699_100116640 Ga0070699_1001166402 329
193 3300005530 Ga0070679_100001739 Ga0070679_10000173917 329
194 3300005530 Ga0070679_100146716 Ga0070679_1001467162 329
195 3300005535 Ga0070684_100051130 Ga0070684_1000511303 329
196 3300005535 Ga0070684_100054509 Ga0070684_1000545093 329
197 3300005539 Ga0068853_100004289 Ga0068853_1000042892 329
198 3300005539 Ga0068853_100005040 Ga0068853_1000050408 329
199 3300005543 Ga0070672_100012855 Ga0070672_1000128554 329
200 3300005543 Ga0070672_100013375 Ga0070672_1000133755 329
201 3300005543 Ga0070672_100030863 Ga0070672_1000308632 329
202 3300005543 Ga0070672_100177471 Ga0070672_1001774712 329
203 3300005544 Ga0070686_100065353 Ga0070686_1000653533 329
204 3300005545 Ga0070695_100055361 Ga0070695_1000553612 329
205 3300005548 Ga0070665_100008185 Ga0070665_1000081854 329
206 3300005548 Ga0070665_100024239 Ga0070665_1000242396 329
207 3300005548 Ga0070665_100035193 Ga0070665_1000351935 329
208 3300005548 Ga0070665_100119224 Ga0070665_1001192243 329
209 3300005548 Ga0070665_100213823 Ga0070665_1002138232 329
210 3300005563 Ga0068855_100007056 Ga0068855_10000705614 329
211 3300005563 Ga0068855_100142621 Ga0068855_1001426212 329
212 3300005564 Ga0070664_100000262 Ga0070664_10000026223 329
213 3300005564 Ga0070664_100266647 Ga0070664_1002666472 329
214 3300005577 Ga0068857_100001952 Ga0068857_10000195220 329
215 3300005577 Ga0068857_100006645 Ga0068857_1000066456 329
216 3300005578 Ga0068854_100127619 Ga0068854_1001276192 329
217 3300005614 Ga0068856_100007834 Ga0068856_10000783413 329
218 3300005614 Ga0068856_100015908 Ga0068856_1000159087 329
219 3300005616 Ga0068852_100131958 Ga0068852_1001319582 329
220 3300005616 Ga0068852_100407131 Ga0068852_1004071312 329
221 3300005617 Ga0068859_100000330 Ga0068859_10000033019 329
222 3300005617 Ga0068859_100032436 Ga0068859_1000324364 329
223 3300005618 Ga0068864_100001602 Ga0068864_1000016025 329
224 3300005618 Ga0068864_100003579 Ga0068864_1000035796 329
225 3300005618 Ga0068864_100032118 Ga0068864_1000321183 329
226 3300005718 Ga0068866_10168048 Ga0068866_101680482 329
227 3300005719 Ga0068861_100000777 Ga0068861_1000007774 329
228 3300005719 Ga0068861_100066502 Ga0068861_1000665022 329
229 3300005719 Ga0068861_100069776 Ga0068861_1000697763 329
230 3300005834 Ga0068851_10001153 Ga0068851_100011533 329
231 3300005834 Ga0068851_10082506 Ga0068851_100825063 329
232 3300005840 Ga0068870_10022663 Ga0068870_100226632 329
233 3300005840 Ga0068870_10078514 Ga0068870_100785142 329
234 3300005840 Ga0068870_10209808 Ga0068870_102098082 329
235 3300005841 Ga0068863_100014883 Ga0068863_1000148837 329
236 3300005841 Ga0068863_100019911 Ga0068863_1000199117 329
237 3300005841 Ga0068863_100054314 Ga0068863_1000543142 329
238 3300005841 Ga0068863_100160155 Ga0068863_1001601552 329
239 3300005841 Ga0068863_100355366 Ga0068863_1003553662 329
240 3300005842 Ga0068858_100002918 Ga0068858_1000029184 329
241 3300005842 Ga0068858_100093274 Ga0068858_1000932743 329
242 3300005842 Ga0068858_100288276 Ga0068858_1002882762 329
243 3300005842 Ga0068858_100535031 Ga0068858_1005350311 329
244 3300005843 Ga0068860_100002326 Ga0068860_10000232610 329
245 3300005843 Ga0068860_100013607 Ga0068860_1000136075 329
246 3300005843 Ga0068860_100019078 Ga0068860_1000190783 329
247 3300005843 Ga0068860_100037773 Ga0068860_1000377733 329
248 3300005843 Ga0068860_100212110 Ga0068860_1002121102 329
249 3300005844 Ga0068862_100004250 Ga0068862_1000042504 329
250 3300005844 Ga0068862_100028486 Ga0068862_1000284864 329
251 3300005937 Ga0081455_10293125 Ga0081455_102931251 329
252 3300006237 Ga0097621_100002336 Ga0097621_10000233611 329
253 3300006237 Ga0097621_100003701 Ga0097621_1000037014 329
254 3300006237 Ga0097621_100008390 Ga0097621_1000083903 329
255 3300006237 Ga0097621_100026548 Ga0097621_1000265485 329
256 3300006358 Ga0068871_100003284 Ga0068871_1000032849 329
257 3300006358 Ga0068871_100042885 Ga0068871_1000428852 329
258 3300006844 Ga0075428_100117321 Ga0075428_1001173214 329
259 3300006852 Ga0075433_10085475 Ga0075433_100854753 329
260 3300006881 Ga0068865_100027370 Ga0068865_1000273704 329
261 3300006881 Ga0068865_100055339 Ga0068865_1000553392 329
262 3300006881 Ga0068865_100124463 Ga0068865_1001244631 329
263 3300006931 Ga0097620_100000330 Ga0097620_10000033019 329
264 3300006931 Ga0097620_100032436 Ga0097620_1000324364 329
265 3300007076 Ga0075435_100005730 Ga0075435_1000057302 329
266 3300007076 Ga0075435_100067205 Ga0075435_1000672052 329
267 3300009093 Ga0105240_10003200 Ga0105240_1000320011 329
268 3300009148 Ga0105243_10039506 Ga0105243_100395064 329
269 3300009174 Ga0105241_10082934 Ga0105241_100829342 329
270 3300009176 Ga0105242_10021200 Ga0105242_100212003 329
271 3300009177 Ga0105248_10008280 Ga0105248_100082803 329
272 3300009177 Ga0105248_10025672 Ga0105248_100256723 329
273 3300009177 Ga0105248_10098280 Ga0105248_100982802 329
274 3300009177 Ga0105248_10185673 Ga0105248_101856732 329
275 3300009551 Ga0105238_10000670 Ga0105238_1000067020 329
276 3300009553 Ga0105249_10004775 Ga0105249_100047756 329
277 3300009553 Ga0105249_10081199 Ga0105249_100811992 329
278 3300013100 Ga0157373_10021603 Ga0157373_100216033 329
279 3300013102 Ga0157371_10115313 Ga0157371_101153132 329
280 3300013104 Ga0157370_10003353 Ga0157370_100033537 329
281 3300013105 Ga0157369_10001648 Ga0157369_1000164817 329
282 3300013297 Ga0157378_10009398 Ga0157378_100093985 329
283 3300013297 Ga0157378_10126288 Ga0157378_101262882 329
284 3300013306 Ga0163162_10013531 Ga0163162_100135315 329
285 3300013307 Ga0157372_10000841 Ga0157372_1000084119 329
286 3300013308 Ga0157375_10012622 Ga0157375_100126223 329
287 3300013308 Ga0157375_10055865 Ga0157375_100558654 329
288 3300013308 Ga0157375_10057559 Ga0157375_100575591 329
289 3300013308 Ga0157375_10264262 Ga0157375_102642622 329
290 3300014325 Ga0163163_10001202 Ga0163163_1000120217 329
291 3300014325 Ga0163163_10003372 Ga0163163_1000337212 329
292 3300014325 Ga0163163_10056492 Ga0163163_100564922 329
293 3300014325 Ga0163163_10248877 Ga0163163_102488772 329
294 3300014326 Ga0157380_10127804 Ga0157380_101278042 329
295 3300014968 Ga0157379_10000522 Ga0157379_1000052221 329
296 3300014968 Ga0157379_10160113 Ga0157379_101601132 329
297 3300014969 Ga0157376_10210716 Ga0157376_102107162 329
298 3300014969 Ga0157376_10419395 Ga0157376_104193951 329
299 3300017792 Ga0163161_10009380 Ga0163161_100093802 329
300 3300025315 Ga0207697_10031196 Ga0207697_100311962 329
301 3300025321 Ga0207656_10063126 Ga0207656_100631262 329
302 3300025893 Ga0207682_10000198 Ga0207682_1000019822 329
303 3300025893 Ga0207682_10049757 Ga0207682_100497572 329
304 3300025899 Ga0207642_10056312 Ga0207642_100563122 329
305 3300025901 Ga0207688_10156661 Ga0207688_101566612 329
306 3300025903 Ga0207680_10004517 Ga0207680_100045173 329
307 3300025903 Ga0207680_10016093 Ga0207680_100160933 329
308 3300025903 Ga0207680_10046950 Ga0207680_100469502 329
309 3300025903 Ga0207680_10087743 Ga0207680_100877432 329
310 3300025907 Ga0207645_10000676 Ga0207645_1000067622 329
311 3300025907 Ga0207645_10009493 Ga0207645_100094935 329
312 3300025907 Ga0207645_10019774 Ga0207645_100197741 329
313 3300025908 Ga0207643_10040898 Ga0207643_100408983 329
314 3300025911 Ga0207654_10115508 Ga0207654_101155082 329
315 3300025912 Ga0207707_10037480 Ga0207707_100374805 329
316 3300025912 Ga0207707_10058016 Ga0207707_100580164 329
317 3300025913 Ga0207695_10020136 Ga0207695_1002013611 329
318 3300025917 Ga0207660_10076123 Ga0207660_100761232 329
319 3300025919 Ga0207657_10006985 Ga0207657_100069854 329
320 3300025920 Ga0207649_10005550 Ga0207649_100055503 329
321 3300025921 Ga0207652_10003366 Ga0207652_100033663 329
322 3300025921 Ga0207652_10085287 Ga0207652_100852874 329
323 3300025923 Ga0207681_10005688 Ga0207681_100056885 329
324 3300025923 Ga0207681_10031449 Ga0207681_100314493 329
325 3300025923 Ga0207681_10036993 Ga0207681_100369933 329
326 3300025924 Ga0207694_10002194 Ga0207694_100021943 329
327 3300025925 Ga0207650_10004678 Ga0207650_100046789 329
328 3300025925 Ga0207650_10035053 Ga0207650_100350533 329
329 3300025925 Ga0207650_10082189 Ga0207650_100821893 329
330 3300025925 Ga0207650_10237930 Ga0207650_102379302 329
331 3300025925 Ga0207650_10319076 Ga0207650_103190762 329
332 3300025926 Ga0207659_10005942 Ga0207659_100059425 329
333 3300025926 Ga0207659_10059462 Ga0207659_100594622 329
334 3300025926 Ga0207659_10172293 Ga0207659_101722932 329
335 3300025929 Ga0207664_10033440 Ga0207664_100334407 329
336 3300025931 Ga0207644_10019180 Ga0207644_100191805 329
337 3300025931 Ga0207644_10052129 Ga0207644_100521292 329
338 3300025932 Ga0207690_10033726 Ga0207690_100337265 329
339 3300025933 Ga0207706_10007454 Ga0207706_100074549 329
340 3300025933 Ga0207706_10185923 Ga0207706_101859232 329
341 3300025934 Ga0207686_10245881 Ga0207686_102458811 329
342 3300025935 Ga0207709_10017317 Ga0207709_100173171 329
343 3300025938 Ga0207704_10021005 Ga0207704_100210052 329
344 3300025938 Ga0207704_10059504 Ga0207704_100595042 329
345 3300025938 Ga0207704_10322187 Ga0207704_103221871 329
346 3300025940 Ga0207691_10000243 Ga0207691_1000024322 329
347 3300025940 Ga0207691_10004761 Ga0207691_1000476112 329
348 3300025940 Ga0207691_10033363 Ga0207691_100333633 329
349 3300025940 Ga0207691_10042871 Ga0207691_100428712 329
350 3300025940 Ga0207691_10176529 Ga0207691_101765292 329
351 3300025940 Ga0207691_10222557 Ga0207691_102225572 329
352 3300025941 Ga0207711_10015861 Ga0207711_100158615 329
353 3300025941 Ga0207711_10032403 Ga0207711_100324034 329
354 3300025942 Ga0207689_10000072 Ga0207689_1000007212 329
355 3300025942 Ga0207689_10002822 Ga0207689_100028226 329
356 3300025944 Ga0207661_10120700 Ga0207661_101207002 329
357 3300025944 Ga0207661_10162670 Ga0207661_101626702 329
358 3300025944 Ga0207661_10331133 Ga0207661_103311332 329
359 3300025945 Ga0207679_10007525 Ga0207679_100075259 329
360 3300025945 Ga0207679_10237250 Ga0207679_102372502 329
361 3300025949 Ga0207667_10005160 Ga0207667_100051603 329
362 3300025949 Ga0207667_10063560 Ga0207667_100635604 329
363 3300025960 Ga0207651_10012672 Ga0207651_100126725 329
364 3300025960 Ga0207651_10178584 Ga0207651_101785842 329
365 3300025972 Ga0207668_10005128 Ga0207668_100051284 329
366 3300025972 Ga0207668_10014856 Ga0207668_100148564 329
367 3300025972 Ga0207668_10035335 Ga0207668_100353352 329
368 3300025972 Ga0207668_10195831 Ga0207668_101958312 329
369 3300025972 Ga0207668_10208249 Ga0207668_102082492 329
370 3300025981 Ga0207640_10122576 Ga0207640_101225762 329
371 3300025986 Ga0207658_10007396 Ga0207658_100073965 329
372 3300025986 Ga0207658_10019572 Ga0207658_100195722 329
373 3300025986 Ga0207658_10032041 Ga0207658_100320413 329
374 3300025986 Ga0207658_10190237 Ga0207658_101902372 329
375 3300026023 Ga0207677_10031104 Ga0207677_100311042 329
376 3300026035 Ga0207703_10000588 Ga0207703_1000058831 329
377 3300026041 Ga0207639_10021685 Ga0207639_100216854 329
378 3300026041 Ga0207639_10411839 Ga0207639_104118392 329
379 3300026067 Ga0207678_10020859 Ga0207678_100208596 329
380 3300026067 Ga0207678_10176375 Ga0207678_101763752 329
381 3300026067 Ga0207678_10311786 Ga0207678_103117862 329
382 3300026075 Ga0207708_10202619 Ga0207708_102026191 329
383 3300026078 Ga0207702_10011568 Ga0207702_100115685 329
384 3300026088 Ga0207641_10005320 Ga0207641_100053204 329
385 3300026088 Ga0207641_10035898 Ga0207641_100358983 329
386 3300026088 Ga0207641_10082260 Ga0207641_100822602 329
387 3300026088 Ga0207641_10104082 Ga0207641_101040823 329
388 3300026088 Ga0207641_10122339 Ga0207641_101223392 329
389 3300026088 Ga0207641_10394644 Ga0207641_103946442 329
390 3300026089 Ga0207648_10003505 Ga0207648_1000350512 329
391 3300026089 Ga0207648_10004321 Ga0207648_1000432111 329
392 3300026089 Ga0207648_10125215 Ga0207648_101252152 329
393 3300026089 Ga0207648_10284326 Ga0207648_102843262 329
394 3300026089 Ga0207648_10354104 Ga0207648_103541042 329
395 3300026089 Ga0207648_10386733 Ga0207648_103867332 329
396 3300026095 Ga0207676_10008380 Ga0207676_100083805 329
397 3300026095 Ga0207676_10013905 Ga0207676_100139055 329
398 3300026095 Ga0207676_10015881 Ga0207676_100158815 329
399 3300026095 Ga0207676_10197808 Ga0207676_101978082 329
400 3300026116 Ga0207674_10000020 Ga0207674_1000002089 329
401 3300026116 Ga0207674_10007698 Ga0207674_100076985 329
402 3300026118 Ga0207675_100001565 Ga0207675_1000015656 329
403 3300026118 Ga0207675_100030212 Ga0207675_1000302124 329
404 3300026118 Ga0207675_100072628 Ga0207675_1000726282 329
405 3300026118 Ga0207675_100091631 Ga0207675_1000916311 329
406 3300026118 Ga0207675_100241124 Ga0207675_1002411241 329
407 3300026121 Ga0207683_10000308 Ga0207683_1000030822 329
408 3300026121 Ga0207683_10017509 Ga0207683_100175095 329
409 3300026121 Ga0207683_10109422 Ga0207683_101094222 329
410 3300026142 Ga0207698_10136796 Ga0207698_101367962 329
411 3300026142 Ga0207698_10177789 Ga0207698_101777892 329
412 3300027471 Ga0209995_1003334 Ga0209995_10033343 329
413 3300027614 Ga0209970_1006292 Ga0209970_10062922 329
414 3300027682 Ga0209971_1007674 Ga0209971_10076742 329
415 3300027717 Ga0209998_10030586 Ga0209998_100305862 329
416 3300028379 Ga0268266_10056421 Ga0268266_100564213 329
417 3300028380 Ga0268265_10005063 Ga0268265_100050635 329
418 3300028380 Ga0268265_10101735 Ga0268265_101017353 329
419 3300028381 Ga0268264_10000593 Ga0268264_1000059315 329
420 3300028381 Ga0268264_10011874 Ga0268264_100118745 329
421 3300028381 Ga0268264_10044155 Ga0268264_100441554 329
422 3300028381 Ga0268264_10237662 Ga0268264_102376622 329
423 3300028381 Ga0268264_10357642 Ga0268264_103576422 329
424 3300031548 Ga0307408_100010521 Ga0307408_1000105216 329
425 3300031731 Ga0307405_10006379 Ga0307405_100063794 329
426 3300031824 Ga0307413_10015135 Ga0307413_100151353 329
427 3300031852 Ga0307410_10003556 Ga0307410_100035567 329
428 3300031903 Ga0307407_10011402 Ga0307407_100114023 329
429 3300031911 Ga0307412_10016159 Ga0307412_100161593 329
430 3300031995 Ga0307409_100010606 Ga0307409_1000106066 329
431 3300031995 Ga0307409_100502546 Ga0307409_1005025461 329
432 3300032002 Ga0307416_100041793 Ga0307416_1000417933 329
433 3300032002 Ga0307416_100150969 Ga0307416_1001509693 329
434 3300032005 Ga0307411_10005803 Ga0307411_100058036 329
435 3300032126 Ga0307415_100002355 Ga0307415_1000023558 329
436 3300035119 Ga0373956_0037445 Ga0373956_0037445_374_1366 329
437 3300035691 Ga0373931_0032743 Ga0373931_0032743_246_1238 329
438 3300035695 Ga0373927_0040742 Ga0373927_0040742_1403_2395 329
439 3300035724 Ga0373933_0012380 Ga0373933_0012380_1696_2688 329
440 3300036401 Ga0373937_0105286 Ga0373937_0105286_1089_2081 329
441 3300036401 Ga0373937_0121903 Ga0373937_0121903_1207_2196 329
442 3300037068 Ga0373925_0217136 Ga0373925_0217136_430_1422 329
443 3300041410 Ga0439461_0000816 Ga0439461_0000816_534_1526 329
444 3300042435 Ga0439434_0014388 Ga0439434_0014388_214_1206 329
445 3300042436 Ga0439435_0000222 Ga0439435_0000222_3061_4053 329
446 3300042436 Ga0439435_0007845 Ga0439435_0007845_651_1643 329
447 3300042461 Ga0439460_0007270 Ga0439460_0007270_712_1704 329
448 3300042461 Ga0439460_0008593 Ga0439460_0008593_1218_2210 329
449 3300046472 Ga0495580_0071642 Ga0495580_0071642_131_1123 329
450 3300048905 Ga0496102_0006283 Ga0496102_0006283_8805_9794 329
451 3300048912 Ga0496109_0125424 Ga0496109_0125424_883_1872 329
452 3300048912 Ga0496109_0155317 Ga0496109_0155317_175_1164 329
453 3300048913 Ga0496110_0078728 Ga0496110_0078728_1512_2501 329
454 3300048914 Ga0496111_0216714 Ga0496111_0216714_394_1383 329
455 3300048915 Ga0496112_0019850 Ga0496112_0019850_2972_3961 329
456 3300049568 Ga0501031_0117106 Ga0501031_0117106_669_1661 329
457 3300049574 Ga0501038_0023127 Ga0501038_0023127_3389_4381 329
458 3300049575 Ga0501039_0073764 Ga0501039_0073764_302_1294 329
459 3300049576 Ga0501040_0080524 Ga0501040_0080524_12_1004 329
460 3300049576 Ga0501040_0175319 Ga0501040_0175319_136_1128 329
461 3300049577 Ga0501041_0019570 Ga0501041_0019570_1467_2459 329
462 3300049578 Ga0501042_0028096 Ga0501042_0028096_1620_2612 329
463 3300049579 Ga0501043_0088323 Ga0501043_0088323_1226_2218 329
464 3300049582 Ga0501048_0315267 Ga0501048_0315267_58_1050 329
465 3300049587 Ga0501071_0074857 Ga0501071_0074857_1431_2423 329
466 3300049588 Ga0501072_0000694 Ga0501072_0000694_5578_6570 329
467 3300049588 Ga0501072_0147911 Ga0501072_0147911_284_1276 329
468 3300049591 Ga0501075_0002986 Ga0501075_0002986_8939_9931 329
469 3300049591 Ga0501075_0044831 Ga0501075_0044831_1778_2770 329
470 3300049593 Ga0501077_0011324 Ga0501077_0011324_3557_4549 329
471 3300049741 Ga0501079_0003783 Ga0501079_0003783_3578_4570 329
472 3300049741 Ga0501079_0059319 Ga0501079_0059319_1649_2641 329
473 3300049742 Ga0501080_0006239 Ga0501080_0006239_9136_10128 329
474 3300049824 Ga0501045_0019724 Ga0501045_0019724_2229_3221 329
475 3300050508 nmdc:mga09592_36057_c1 nmdc:mga09592_36057_c1_340_1332 329
476 3300050509 nmdc:mga0qj67_41166_c1 nmdc:mga0qj67_41166_c1_631_1623 329
477 3300050509 nmdc:mga0qj67_81623_c1 nmdc:mga0qj67_81623_c1_917_1909 329
478 3300050510 nmdc:mga06r32_20475_c1 nmdc:mga06r32_20475_c1_918_1910 329
479 3300050512 nmdc:mga0n895_12787_c1 nmdc:mga0n895_12787_c1_3048_4037 329
480 3300050513 nmdc:mga0rr50_11752_c1 nmdc:mga0rr50_11752_c1_1545_2534 329
481 3300050515 nmdc:mga0a205_111320_c1 nmdc:mga0a205_111320_c1_1215_2204 329
482 3300050515 nmdc:mga0a205_78468_c1 nmdc:mga0a205_78468_c1_1401_2390 329
483 3300059421 Ga0590071_002250 Ga0590071_002250_21_1013 329
484 3300060353 Ga0501082_0056775 Ga0501082_0056775_1432_2424 329
485 3300061734 Ga0530510_0000247 Ga0530510_0000247_29546_30538 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

28

351

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofc-assembly1.cif.gz_A 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase 0.8988 6 329
4ign-assembly2.cif.gz_B 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd 0.8976 6 329
4lal-assembly2.cif.gz_D crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil 0.897 4 328
4lal-assembly1.cif.gz_B crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil 0.8888 4 328
4lam-assembly1.cif.gz_B crystal structure of cordyceps militaris idcase d323n mutant in complex with 5-carboxyl-uracil 0.8861 4 329
ID Description Score Start End Superfamily
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.897 4 328 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8937 4 329 3.20.20.140
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8841 4 328 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8834 4 329 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8803 3 328 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A536UHX2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.991 237 329 GO:0016787
AF-A0A536UKK4-F1-model_v4 Amidohydrolase 0.9873 4 329 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A1F4EXH1-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase 0.9858 3 291 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A536YIW6-F1-model_v4 Amidohydrolase 0.9832 92 329 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A4Q3N836-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase 0.983 4 179 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
93.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map