F453084

General Info

Members Datasets Scaffolds Average Seq Length
485 254 970 240

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10061166|Ga0105240_100611663
Length 266
Sequence MLRLIGYGYNGRTVADLALERLRKDSAVARQLIDLSMAVHNKMMTFPRVVPPSLTMQESWEEFAERVGAAKHGVNWLTAHYRIEIGDHIGTHMDSLRHMRDDACGPEGIPLEYCYGDAVCLDFRHLPKGAGITVADAKKALCGIKYSLKPRDIVLIHTGAGKIQDSEAYLTDHVGMTSEATEWFLDQGIVMMGIDAVTFDPPIWAMFERKQFWESHRVMLKREYYHLENLTNLDQVPPSGFRVSVFPIKWVHTTAAPVRAVAIIEN

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
205 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
206 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
207 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
232 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 4.54
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 9.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10061166 3300009093 Bacteria 4693
2 JGI25406J46586_10017463 3300003203 Bacteria 2966
3 JGI25407J50210_10051405 3300003373 Bacteria 1044
4 JGI25407J50210_10056306 3300003373 Bacteria 991
5 Ga0058863_10028331 3300004799 Bacteria 5320
6 Ga0058862_12859427 3300004803 Unclassified 1972
7 Ga0065704_10079817 3300005289 Bacteria 4073
8 Ga0065715_10007828 3300005293 Unclassified 2588
9 Ga0065715_10044809 3300005293 Bacteria 1387
10 Ga0065715_10107197 3300005293 Bacteria 2784
11 Ga0070658_10171382 3300005327 Bacteria 1823
12 Ga0070676_10188115 3300005328 Bacteria 1346
13 Ga0070683_100004194 3300005329 Bacteria 11821
14 Ga0070683_100076573 3300005329 Unclassified 3127
15 Ga0070683_100666034 3300005329 Bacteria 996
16 Ga0070670_100113657 3300005331 Bacteria 2334
17 Ga0070670_100293983 3300005331 Bacteria 1420
18 Ga0068869_100655240 3300005334 Bacteria 892
19 Ga0070680_100200162 3300005336 Bacteria 1684
20 Ga0070682_100223907 3300005337 Bacteria 1341
21 Ga0070660_100032039 3300005339 Plasmid 3953
22 Ga0070660_100177285 3300005339 Bacteria 1724
23 Ga0070660_100336899 3300005339 Bacteria 1241
24 Ga0070687_100206995 3300005343 Bacteria 1193
25 Ga0070661_100015543 3300005344 Bacteria 5371
26 Ga0070661_100132291 3300005344 Bacteria 1875
27 Ga0070661_100192571 3300005344 Bacteria 1556
28 Ga0070669_100011494 3300005353 Bacteria 6283
29 Ga0070675_100248147 3300005354 Unclassified 1557
30 Ga0070675_100284984 3300005354 Bacteria 1453
31 Ga0070675_100601890 3300005354 Archaea 997
32 Ga0070671_100131170 3300005355 Bacteria 2111
33 Ga0070674_100169966 3300005356 Bacteria 1661
34 Ga0070673_100002123 3300005364 Bacteria 12002
35 Ga0070673_100469677 3300005364 Unclassified 1134
36 Ga0070673_100680070 3300005364 Bacteria 944
37 Ga0070659_100009871 3300005366 Bacteria 7020
38 Ga0070659_100109995 3300005366 Bacteria 2224
39 Ga0070659_100139913 3300005366 Bacteria 1970
40 Ga0070709_10072786 3300005434 Bacteria 2223
41 Ga0070713_100046622 3300005436 Plasmid 3557
42 Ga0070701_10044791 3300005438 Bacteria 2268
43 Ga0070711_100013930 3300005439 Bacteria 5058
44 Ga0070711_100183404 3300005439 Unclassified 1603
45 Ga0070700_100210792 3300005441 Bacteria 1371
46 Ga0070663_100093347 3300005455 Bacteria 2233
47 Ga0070663_100106008 3300005455 Bacteria 2105
48 Ga0070663_100275122 3300005455 Bacteria 1340
49 Ga0070663_100345416 3300005455 Bacteria 1203
50 Ga0070663_100605077 3300005455 Unclassified 922
51 Ga0070662_100046220 3300005457 Bacteria 3128
52 Ga0070662_100155635 3300005457 Bacteria 1784
53 Ga0070662_100229732 3300005457 Bacteria 1484
54 Ga0070681_10026341 3300005458 Bacteria 5845
55 Ga0070707_100353498 3300005468 Bacteria 1427
56 Ga0070699_100117663 3300005518 Bacteria 2336
57 Ga0070699_100522656 3300005518 Bacteria 1079
58 Ga0070679_100132159 3300005530 Bacteria 2477
59 Ga0070684_100000070 3300005535 Bacteria 65257
60 Ga0070684_100008130 3300005535 Bacteria 8187
61 Ga0070684_100092128 3300005535 Bacteria 2696
62 Ga0070684_100278877 3300005535 Bacteria 1531
63 Ga0070697_100227058 3300005536 Bacteria 1592
64 Ga0068853_100007155 3300005539 Bacteria 8928
65 Ga0068853_100386581 3300005539 Bacteria 1307
66 Ga0070672_100138317 3300005543 Bacteria 2007
67 Ga0070686_100030435 3300005544 Bacteria 3292
68 Ga0070695_100075584 3300005545 Bacteria 2217
69 Ga0070695_100196392 3300005545 Bacteria 1439
70 Ga0070696_100208450 3300005546 Bacteria 1462
71 Ga0070704_100218988 3300005549 Bacteria 1547
72 Ga0068855_100176442 3300005563 Bacteria 2418
73 Ga0068855_100238827 3300005563 Bacteria 2031
74 Ga0070664_100006402 3300005564 Bacteria 9496
75 Ga0070664_100070248 3300005564 Bacteria 2998
76 Ga0070664_100728311 3300005564 Bacteria 925
77 Ga0068857_100121853 3300005577 Archaea 2348
78 Ga0068854_100150241 3300005578 Bacteria 1795
79 Ga0068854_100470267 3300005578 Bacteria 1054
80 Ga0068856_100426121 3300005614 Unclassified 1347
81 Ga0068856_100496170 3300005614 Bacteria 1242
82 Ga0070702_100018975 3300005615 Bacteria 3576
83 Ga0070702_100063934 3300005615 Bacteria 2151
84 Ga0068852_100054877 3300005616 Bacteria 3437
85 Ga0068852_100131677 3300005616 Bacteria 2304
86 Ga0068859_100219798 3300005617 Bacteria 1987
87 Ga0068866_10297331 3300005718 Bacteria 1007
88 Ga0068861_100759246 3300005719 Bacteria 907
89 Ga0068861_100886134 3300005719 Unclassified 844
90 Ga0068870_10149378 3300005840 Bacteria 1375
91 Ga0068858_100096237 3300005842 Bacteria 2759
92 Ga0068860_100171199 3300005843 Bacteria 2098
93 Ga0068862_100581106 3300005844 Unclassified 1073
94 Ga0081455_10057498 3300005937 Bacteria 3295
95 Ga0081455_10112317 3300005937 Bacteria 2163
96 Ga0081538_10002816 3300005981 Bacteria 16644
97 Ga0081538_10003024 3300005981 Bacteria 16014
98 Ga0081538_10008126 3300005981 Bacteria 8955
99 Ga0081538_10009202 3300005981 Bacteria 8277
100 Ga0081538_10013192 3300005981 Bacteria 6559
101 Ga0081538_10024680 3300005981 Bacteria 4275
102 Ga0081538_10033024 3300005981 Bacteria 3453
103 Ga0081538_10047452 3300005981 Bacteria 2633
104 Ga0081538_10057231 3300005981 Bacteria 2275
105 Ga0081538_10057253 3300005981 Bacteria 2274
106 Ga0081538_10095677 3300005981 Bacteria 1516
107 Ga0081539_10015338 3300005985 Bacteria 5577
108 Ga0075364_10028242 3300006051 Bacteria 3591
109 Ga0075432_10081844 3300006058 Bacteria 1172
110 Ga0070712_100001501 3300006175 Bacteria 14243
111 Ga0070712_100407924 3300006175 Bacteria 1123
112 Ga0070712_100556304 3300006175 Unclassified 967
113 Ga0075367_10016268 3300006178 Bacteria 4062
114 Ga0097621_100089208 3300006237 Bacteria 2577
115 Ga0068871_100551887 3300006358 Bacteria 1044
116 Ga0075428_100005592 3300006844 Bacteria 13957
117 Ga0075428_100006153 3300006844 Bacteria 13357
118 Ga0075428_100010204 3300006844 Bacteria 10426
119 Ga0075428_100063892 3300006844 Bacteria 4030
120 Ga0075428_100467314 3300006844 Bacteria 1351
121 Ga0075430_100001554 3300006846 Bacteria 18766
122 Ga0075430_100002705 3300006846 Bacteria 14808
123 Ga0075430_100119620 3300006846 Bacteria 2196
124 Ga0075430_100415374 3300006846 Unclassified 1111
125 Ga0075431_100001540 3300006847 Bacteria 21359
126 Ga0075431_100024116 3300006847 Bacteria 6229
127 Ga0075431_100025366 3300006847 Bacteria 6077
128 Ga0075431_100097536 3300006847 Bacteria 3035
129 Ga0075433_10033932 3300006852 Bacteria 4379
130 Ga0075433_10181131 3300006852 Bacteria 1875
131 Ga0075433_10355718 3300006852 Bacteria 1294
132 Ga0075434_100381204 3300006871 Unclassified 1431
133 Ga0075429_100021381 3300006880 Bacteria 5609
134 Ga0075429_100023383 3300006880 Bacteria 5363
135 Ga0075429_100184872 3300006880 Bacteria 1826
136 Ga0068865_100531659 3300006881 Bacteria 985
137 Ga0068865_100796156 3300006881 Unclassified 815
138 Ga0097620_100219796 3300006931 Bacteria 1987
139 Ga0075435_100187222 3300007076 Bacteria 1751
140 Ga0105240_10187949 3300009093 Unclassified 2431
141 Ga0105240_11056659 3300009093 Bacteria 866
142 Ga0111539_10005059 3300009094 Bacteria 17123
143 Ga0111539_10007337 3300009094 Bacteria 14119
144 Ga0111539_10038200 3300009094 Bacteria 5792
145 Ga0111539_10084040 3300009094 Unclassified 3743
146 Ga0111539_10087330 3300009094 Bacteria 3664
147 Ga0111539_10153427 3300009094 Bacteria 2695
148 Ga0111539_10204506 3300009094 Bacteria 2302
149 Ga0105245_10033607 3300009098 Bacteria 4547
150 Ga0105245_10194467 3300009098 Bacteria 1945
151 Ga0105245_10534224 3300009098 Bacteria 1193
152 Ga0105247_10012419 3300009101 Bacteria 5116
153 Ga0105247_10130057 3300009101 Bacteria 1640
154 Ga0105247_10453163 3300009101 Bacteria 925
155 Ga0114129_10003172 3300009147 Bacteria 23067
156 Ga0114129_10011732 3300009147 Bacteria 12469
157 Ga0114129_10030521 3300009147 Bacteria 7627
158 Ga0114129_10060435 3300009147 Bacteria 5298
159 Ga0114129_10126911 3300009147 Bacteria 3507
160 Ga0114129_10306913 3300009147 Bacteria 2113
161 Ga0105241_10001678 3300009174 Bacteria 16835
162 Ga0105242_10118718 3300009176 Bacteria 2266
163 Ga0105237_10212108 3300009545 Bacteria 1936
164 Ga0105237_10626262 3300009545 Bacteria 1083
165 Ga0105238_10025936 3300009551 Bacteria 5975
166 Ga0105238_10046164 3300009551 Bacteria 4398
167 Ga0105249_10004448 3300009553 Bacteria 12124
168 Ga0105239_11558852 3300010375 Bacteria 764
169 Ga0105246_10078111 3300011119 Bacteria 2350
170 Ga0105246_10107994 3300011119 Bacteria 2039
171 Ga0157371_10472965 3300013102 Bacteria 923
172 Ga0157370_10065027 3300013104 Bacteria 3451
173 Ga0157369_10013747 3300013105 Bacteria 9150
174 Ga0157378_10051032 3300013297 Bacteria 3680
175 Ga0157378_10996196 3300013297 Unclassified 872
176 Ga0157372_10047180 3300013307 Bacteria 4785
177 Ga0157372_10234667 3300013307 Bacteria 2127
178 Ga0157372_10350987 3300013307 Bacteria 1719
179 Ga0157375_10076407 3300013308 Bacteria 3376
180 Ga0157375_11388147 3300013308 Bacteria 827
181 Ga0163163_10073208 3300014325 Bacteria 3417
182 Ga0163163_10081781 3300014325 Bacteria 3233
183 Ga0157380_10276195 3300014326 Bacteria 1535
184 Ga0157380_10385493 3300014326 Bacteria 1324
185 Ga0157377_10585963 3300014745 Unclassified 793
186 Ga0157379_10021380 3300014968 Bacteria 5727
187 Ga0157376_10288884 3300014969 Bacteria 1547
188 Ga0206351_10303326 3300020077 Unclassified 1050
189 Ga0206352_10844691 3300020078 Unclassified 2875
190 Ga0206350_10500959 3300020080 Bacteria 1077
191 Ga0206350_10859385 3300020080 Unclassified 2994
192 Ga0213874_10001271 3300021377 Bacteria 5216
193 Ga0213876_10051363 3300021384 Unclassified 2179
194 Ga0213876_10070145 3300021384 Bacteria 1851
195 Ga0213875_10000268 3300021388 Bacteria 51367
196 Ga0213875_10030348 3300021388 Bacteria 2559
197 Ga0224712_10062866 3300022467 Bacteria 1484
198 Ga0207697_10020734 3300025315 Bacteria 2690
199 Ga0207710_10007212 3300025900 Bacteria 4713
200 Ga0207710_10107803 3300025900 Bacteria 1320
201 Ga0207647_10001954 3300025904 Bacteria 15737
202 Ga0207647_10330397 3300025904 Bacteria 865
203 Ga0207699_10092180 3300025906 Bacteria 1904
204 Ga0207645_10165024 3300025907 Unclassified 1450
205 Ga0207645_10171434 3300025907 Bacteria 1422
206 Ga0207643_10051109 3300025908 Bacteria 2346
207 Ga0207705_10000619 3300025909 Bacteria 29672
208 Ga0207705_10218084 3300025909 Bacteria 1448
209 Ga0207705_10587677 3300025909 Unclassified 866
210 Ga0207654_10018695 3300025911 Bacteria 3642
211 Ga0207707_10116257 3300025912 Unclassified 2337
212 Ga0207707_10431253 3300025912 Bacteria 1129
213 Ga0207671_10489023 3300025914 Bacteria 981
214 Ga0207693_10005520 3300025915 Bacteria 10526
215 Ga0207693_10302613 3300025915 Bacteria 1252
216 Ga0207693_10483234 3300025915 Unclassified 967
217 Ga0207663_10014525 3300025916 Unclassified 4315
218 Ga0207660_10096502 3300025917 Unclassified 2201
219 Ga0207660_10395331 3300025917 Bacteria 1113
220 Ga0207660_10580034 3300025917 Bacteria 913
221 Ga0207662_10056896 3300025918 Bacteria 2336
222 Ga0207657_10014541 3300025919 Bacteria 7674
223 Ga0207657_10102955 3300025919 Bacteria 2367
224 Ga0207657_10193867 3300025919 Bacteria 1637
225 Ga0207657_10339506 3300025919 Bacteria 1186
226 Ga0207649_10006906 3300025920 Bacteria 6170
227 Ga0207652_10008987 3300025921 Bacteria 8052
228 Ga0207681_10028628 3300025923 Bacteria 3610
229 Ga0207681_10161137 3300025923 Bacteria 1691
230 Ga0207694_10006835 3300025924 Bacteria 8663
231 Ga0207694_10009952 3300025924 Bacteria 7173
232 Ga0207650_10033820 3300025925 Bacteria 3705
233 Ga0207659_10076531 3300025926 Bacteria 2460
234 Ga0207659_10204229 3300025926 Archaea 1580
235 Ga0207687_10005997 3300025927 Bacteria 8041
236 Ga0207687_10113040 3300025927 Bacteria 2019
237 Ga0207690_10020979 3300025932 Unclassified 4045
238 Ga0207706_10111934 3300025933 Bacteria 2402
239 Ga0207686_10038973 3300025934 Bacteria 2880
240 Ga0207709_10012935 3300025935 Bacteria 4601
241 Ga0207709_10485712 3300025935 Unclassified 961
242 Ga0207669_10192011 3300025937 Bacteria 1474
243 Ga0207704_10233515 3300025938 Bacteria 1369
244 Ga0207665_10210647 3300025939 Bacteria 1419
245 Ga0207665_10260545 3300025939 Bacteria 1284
246 Ga0207691_10093314 3300025940 Bacteria 2695
247 Ga0207661_10014496 3300025944 Bacteria 5779
248 Ga0207661_10368493 3300025944 Bacteria 1298
249 Ga0207661_10445792 3300025944 Bacteria 1178
250 Ga0207679_10065259 3300025945 Bacteria 2723
251 Ga0207679_10098136 3300025945 Bacteria 2284
252 Ga0207679_10307023 3300025945 Bacteria 1369
253 Ga0207667_10049210 3300025949 Bacteria 4453
254 Ga0207667_10477375 3300025949 Unclassified 1266
255 Ga0207651_10007669 3300025960 Bacteria 5763
256 Ga0207712_10087241 3300025961 Unclassified 2288
257 Ga0207712_10092505 3300025961 Bacteria 2230
258 Ga0207668_10127983 3300025972 Bacteria 1935
259 Ga0207640_10071996 3300025981 Bacteria 2330
260 Ga0207640_10268195 3300025981 Bacteria 1334
261 Ga0207658_10400456 3300025986 Bacteria 1206
262 Ga0207703_10068324 3300026035 Bacteria 2928
263 Ga0207639_10031789 3300026041 Bacteria 3881
264 Ga0207639_10189822 3300026041 Bacteria 1754
265 Ga0207678_10000682 3300026067 Bacteria 31067
266 Ga0207678_10127757 3300026067 Bacteria 2168
267 Ga0207678_10393807 3300026067 Unclassified 1199
268 Ga0207708_10020522 3300026075 Bacteria 4983
269 Ga0207708_10089069 3300026075 Bacteria 2378
270 Ga0207708_10236496 3300026075 Bacteria 1468
271 Ga0207708_10327405 3300026075 Unclassified 1252
272 Ga0207648_10308020 3300026089 Bacteria 1421
273 Ga0207676_10043795 3300026095 Bacteria 3448
274 Ga0207674_10029119 3300026116 Bacteria 5820
275 Ga0207675_100035396 3300026118 Bacteria 4658
276 Ga0207675_100557619 3300026118 Bacteria 1145
277 Ga0207683_10234568 3300026121 Bacteria 1673
278 Ga0207683_10253519 3300026121 Bacteria 1606
279 Ga0207698_10039623 3300026142 Bacteria 3493
280 Ga0207698_10784021 3300026142 Bacteria 954
281 Ga0207428_10008253 3300027907 Bacteria 9419
282 Ga0207428_10245383 3300027907 Bacteria 1337
283 Ga0207428_10284856 3300027907 Unclassified 1226
284 Ga0207428_10369175 3300027907 Bacteria 1054
285 Ga0268266_10429460 3300028379 Bacteria 1253
286 Ga0268265_10092854 3300028380 Bacteria 2417
287 Ga0268265_10195261 3300028380 Archaea 1751
288 Ga0268265_10257997 3300028380 Bacteria 1548
289 Ga0268264_10143115 3300028381 Bacteria 2135
290 Ga0307408_100154826 3300031548 Unclassified 1813
291 Ga0265314_10274352 3300031711 Bacteria 957
292 Ga0307405_10032412 3300031731 Bacteria 3089
293 Ga0307405_10062070 3300031731 Bacteria 2365
294 Ga0307413_10273905 3300031824 Bacteria 1265
295 Ga0307410_10085921 3300031852 Bacteria 2221
296 Ga0307410_10118903 3300031852 Bacteria 1924
297 Ga0307406_10348677 3300031901 Bacteria 1156
298 Ga0307406_10454718 3300031901 Bacteria 1028
299 Ga0307407_10444908 3300031903 Bacteria 939
300 Ga0307409_100135965 3300031995 Bacteria 2109
301 Ga0307409_100315744 3300031995 Bacteria 1460
302 Ga0307409_100732984 3300031995 Bacteria 991
303 Ga0307416_100060314 3300032002 Bacteria 3089
304 Ga0307416_100068693 3300032002 Bacteria 2929
305 Ga0307416_100145990 3300032002 Bacteria 2160
306 Ga0307416_100228095 3300032002 Bacteria 1793
307 Ga0307416_100575535 3300032002 Bacteria 1203
308 Ga0307416_100628180 3300032002 Bacteria 1157
309 Ga0307416_100745991 3300032002 Bacteria 1071
310 Ga0307411_10622599 3300032005 Bacteria 931
311 Ga0307415_100267162 3300032126 Bacteria 1399
312 Ga0307415_100550647 3300032126 Bacteria 1018
313 Ga0307415_100592607 3300032126 Bacteria 985
314 Ga0373943_0110209 3300035170 Bacteria 1451
315 Ga0373962_0087116 3300035242 Bacteria 957
316 Ga0373931_0021395 3300035691 Bacteria 3245
317 Ga0395900_0078069 3300037418 Bacteria 3402
318 Ga0395900_0757925 3300037418 Bacteria 901
319 Ga0395898_0141117 3300037466 Bacteria 2306
320 Ga0395905_0289897 3300037471 Bacteria 1523
321 Ga0436364_0798736 3300037853 Bacteria 130922
322 Ga0436364_1011676 3300037853 Bacteria 13377
323 Ga0395901_0068810 3300038443 Bacteria 3688
324 Ga0395901_0369828 3300038443 Bacteria 1477
325 Ga0395901_0461513 3300038443 Bacteria 1298
326 Ga0436365_0122524 3300039437 Bacteria 6633
327 Ga0436365_0336833 3300039437 Bacteria 21259
328 Ga0436365_1371573 3300039437 Bacteria 21290
329 Ga0436363_0161552 3300039450 Bacteria 8112
330 Ga0436363_1549297 3300039450 Bacteria 5541
331 Ga0439460_0009416 3300042461 Bacteria 2481
332 Ga0466963_0001318 3300044694 Bacteria 13208
333 Ga0466963_0019329 3300044694 Bacteria 4270
334 Ga0466964_0040860 3300044706 Bacteria 1874
335 Ga0466960_0361823 3300044901 Bacteria 829
336 Ga0466959_0047371 3300045049 Bacteria 3162
337 Ga0466959_0070871 3300045049 Bacteria 2525
338 Ga0451576_0037162 3300045051 Bacteria 5159
339 Ga0466958_0004448 3300045836 Bacteria 7400
340 Ga0466967_0108405 3300045976 Bacteria 2548
341 Ga0466967_0129909 3300045976 Bacteria 2337
342 Ga0466967_0240065 3300045976 Bacteria 1728
343 Ga0466967_0550649 3300045976 Bacteria 1135
344 Ga0466967_0611302 3300045976 Bacteria 1076
345 Ga0495580_0022699 3300046472 Bacteria 4614
346 Ga0495582_0106662 3300046473 Bacteria 1572
347 Ga0495666_0183499 3300046526 Bacteria 966
348 Ga0495665_0083826 3300046531 Bacteria 1676
349 Ga0495658_0315156 3300046683 Bacteria 991
350 Ga0495604_0100761 3300047317 Bacteria 2123
351 Ga0496100_0043150 3300048903 Unclassified 2884
352 Ga0496101_0024580 3300048904 Bacteria 4170
353 Ga0496101_0226194 3300048904 Bacteria 1453
354 Ga0496102_0002943 3300048905 Bacteria 14446
355 Ga0496102_0112946 3300048905 Bacteria 2534
356 Ga0496102_0545003 3300048905 Unclassified 1083
357 Ga0496102_0804704 3300048905 Unclassified 862
358 Ga0496103_0014108 3300048906 Bacteria 4743
359 Ga0496103_0294191 3300048906 Bacteria 1044
360 Ga0496104_0018632 3300048907 Archaea 6336
361 Ga0496104_0025114 3300048907 Bacteria 5490
362 Ga0496104_0110070 3300048907 Bacteria 2640
363 Ga0496105_0187439 3300048908 Unclassified 1693
364 Ga0496106_0057099 3300048909 Bacteria 2951
365 Ga0496107_0101633 3300048910 Bacteria 2108
366 Ga0496108_0010796 3300048911 Bacteria 7414
367 Ga0496108_0198970 3300048911 Bacteria 1738
368 Ga0496109_0001879 3300048912 Bacteria 17401
369 Ga0496110_0000355 3300048913 Bacteria 30703
370 Ga0496110_0163406 3300048913 Bacteria 2018
371 Ga0496112_0005358 3300048915 Bacteria 11081
372 Ga0496113_0752853 3300048916 Unclassified 776
373 Ga0501291_041127 3300049514 Bacteria 813
374 Ga0501294_009836 3300049517 Bacteria 941
375 Ga0501296_014857 3300049519 Unclassified 958
376 Ga0501299_003373 3300049522 Unclassified 2309
377 Ga0501299_042512 3300049522 Bacteria 916
378 Ga0501031_0059479 3300049568 Bacteria 2490
379 Ga0501031_0068374 3300049568 Bacteria 2314
380 Ga0501031_0125868 3300049568 Bacteria 1674
381 Ga0501032_0072712 3300049569 Bacteria 2291
382 Ga0501033_0083612 3300049570 Bacteria 2339
383 Ga0501033_0135738 3300049570 Unclassified 1780
384 Ga0501034_0188429 3300049571 Bacteria 2025
385 Ga0501034_0210703 3300049571 Bacteria 1899
386 Ga0501036_0030124 3300049572 Bacteria 4584
387 Ga0501037_0027169 3300049573 Bacteria 4227
388 Ga0501037_0242967 3300049573 Bacteria 1262
389 Ga0501038_0090310 3300049574 Bacteria 2567
390 Ga0501038_0100306 3300049574 Bacteria 2413
391 Ga0501038_0220730 3300049574 Bacteria 1512
392 Ga0501039_0010435 3300049575 Bacteria 7078
393 Ga0501039_0081352 3300049575 Bacteria 2521
394 Ga0501039_0509945 3300049575 Bacteria 944
395 Ga0501040_0032040 3300049576 Bacteria 3556
396 Ga0501040_0102787 3300049576 Bacteria 1994
397 Ga0501042_0011759 3300049578 Bacteria 5913
398 Ga0501042_0077030 3300049578 Bacteria 2387
399 Ga0501042_0439206 3300049578 Bacteria 946
400 Ga0501042_0627200 3300049578 Bacteria 782
401 Ga0501043_0027097 3300049579 Bacteria 4498
402 Ga0501046_0067988 3300049580 Bacteria 2773
403 Ga0501046_0237784 3300049580 Bacteria 1344
404 Ga0501047_0095350 3300049581 Plasmid 2854
405 Ga0501047_0156972 3300049581 Bacteria 2148
406 Ga0501048_0015289 3300049582 Bacteria 5667
407 Ga0501067_0022662 3300049583 Bacteria 3476
408 Ga0501067_0027370 3300049583 Bacteria 3158
409 Ga0501069_0159402 3300049585 Bacteria 1299
410 Ga0501070_0056996 3300049586 Bacteria 3238
411 Ga0501070_0118306 3300049586 Bacteria 2190
412 Ga0501071_0014403 3300049587 Bacteria 5409
413 Ga0501071_0024662 3300049587 Bacteria 4207
414 Ga0501071_0063618 3300049587 Bacteria 2675
415 Ga0501071_0088399 3300049587 Bacteria 2273
416 Ga0501071_0208753 3300049587 Bacteria 1468
417 Ga0501072_0075363 3300049588 Bacteria 2669
418 Ga0501072_0104211 3300049588 Bacteria 2255
419 Ga0501072_0149034 3300049588 Bacteria 1865
420 Ga0501073_0017154 3300049589 Bacteria 5244
421 Ga0501074_0015943 3300049590 Bacteria 5465
422 Ga0501075_0045523 3300049591 Bacteria 3293
423 Ga0501075_0233073 3300049591 Archaea 1404
424 Ga0501076_0062118 3300049592 Bacteria 2974
425 Ga0501076_0259950 3300049592 Bacteria 1421
426 Ga0501207_015754 3300049654 Bacteria 1167
427 Ga0501209_066432 3300049656 Bacteria 1017
428 Ga0501217_011378 3300049661 Bacteria 1968
429 Ga0501079_0040143 3300049741 Bacteria 3610
430 Ga0501079_0206581 3300049741 Bacteria 1534
431 Ga0501079_0426298 3300049741 Bacteria 1041
432 Ga0501080_0126176 3300049742 Bacteria 2370
433 Ga0501080_0640431 3300049742 Bacteria 941
434 Ga0501081_0038109 3300049743 Bacteria 3282
435 Ga0501081_0121721 3300049743 Bacteria 1859
436 Ga0501081_0132424 3300049743 Bacteria 1782
437 Ga0501081_0372902 3300049743 Bacteria 1054
438 Ga0501083_0038693 3300049744 Bacteria 3241
439 Ga0501035_0082635 3300049822 Bacteria 2834
440 Ga0501044_0072963 3300049823 Plasmid 3489
441 Ga0501044_0219643 3300049823 Bacteria 1851
442 Ga0501045_0022944 3300049824 Bacteria 4472
443 nmdc:mga0k408_205621_c1 3300050493 Bacteria 1175
444 nmdc:mga06z11_203162_c1 3300050494 Bacteria 1152
445 nmdc:mga05p37_1006074_c1 3300050507 Bacteria 885
446 nmdc:mga05p37_228320_c1 3300050507 Bacteria 2244
447 nmdc:mga05p37_348028_c1 3300050507 Bacteria 1745
448 nmdc:mga05p37_40298_c1 3300050507 Bacteria 5735
449 nmdc:mga05p37_4787_c1 3300050507 Bacteria 15816
450 nmdc:mga05p37_5624_c1 3300050507 Bacteria 14729
451 nmdc:mga05p37_92665_c1 3300050507 Bacteria 3723
452 nmdc:mga09592_23249_c1 3300050508 Bacteria 5118
453 nmdc:mga09592_28739_c1 3300050508 Bacteria 4622
454 nmdc:mga09592_379819_c1 3300050508 Unclassified 1222
455 nmdc:mga0qj67_16862_c1 3300050509 Bacteria 5548
456 nmdc:mga0qj67_7463_c1 3300050509 Bacteria 8077
457 nmdc:mga06r32_18024_c1 3300050510 Bacteria 6456
458 nmdc:mga06r32_19111_c1 3300050510 Bacteria 6285
459 nmdc:mga08y16_17272_c1 3300050511 Bacteria 7596
460 nmdc:mga08y16_226640_c1 3300050511 Bacteria 1934
461 nmdc:mga08y16_267881_c1 3300050511 Archaea 1764
462 nmdc:mga08y16_408216_c1 3300050511 Unclassified 1389
463 nmdc:mga08y16_449360_c1 3300050511 Bacteria 1314
464 nmdc:mga08y16_45175_c2 3300050511 Bacteria 1183
465 nmdc:mga08y16_58976_c1 3300050511 Bacteria 4010
466 nmdc:mga08y16_754753_c1 3300050511 Unclassified 969
467 nmdc:mga08y16_949_c1 3300050511 Bacteria 28169
468 nmdc:mga0n895_275931_c1 3300050512 Bacteria 1705
469 nmdc:mga0n895_339732_c1 3300050512 Bacteria 1521
470 nmdc:mga0rr50_502548_c1 3300050513 Bacteria 1031
471 nmdc:mga0a205_12148_c2 3300050515 Bacteria 6648
472 nmdc:mga0a205_282873_c1 3300050515 Bacteria 1534
473 nmdc:mga0a205_287497_c1 3300050515 Bacteria 1519
474 nmdc:mga0a205_50898_c1 3300050515 Bacteria 3998
475 Ga0501084_0031012 3300054114 Bacteria 4471
476 Ga0501084_0085204 3300054114 Bacteria 2653
477 Ga0501084_0102365 3300054114 Bacteria 2405
478 Ga0501084_0361064 3300054114 Bacteria 1227
479 Ga0590075_012822 3300059424 Bacteria 2038
480 Ga0501082_0017281 3300060353 Bacteria 6215
481 Ga0501082_0051654 3300060353 Bacteria 3543
482 Ga0501082_0230929 3300060353 Bacteria 1610
483 Ga0530510_0034234 3300061734 Bacteria 3658
484 Ga0530510_0177152 3300061734 Bacteria 1580
485 Ga0530510_0441764 3300061734 Bacteria 983
486 Ga0105240_10061166
487 JGI25406J46586_10017463
488 JGI25407J50210_10051405
489 JGI25407J50210_10056306
490 Ga0058863_10028331
491 Ga0058862_12859427
492 Ga0065704_10079817
493 Ga0065715_10007828
494 Ga0065715_10044809
495 Ga0065715_10107197
496 Ga0070658_10171382
497 Ga0070676_10188115
498 Ga0070683_100004194
499 Ga0070683_100076573
500 Ga0070683_100666034
501 Ga0070670_100113657
502 Ga0070670_100293983
503 Ga0068869_100655240
504 Ga0070680_100200162
505 Ga0070682_100223907
506 Ga0070660_100032039
507 Ga0070660_100177285
508 Ga0070660_100336899
509 Ga0070687_100206995
510 Ga0070661_100015543
511 Ga0070661_100132291
512 Ga0070661_100192571
513 Ga0070669_100011494
514 Ga0070675_100248147
515 Ga0070675_100284984
516 Ga0070675_100601890
517 Ga0070671_100131170
518 Ga0070674_100169966
519 Ga0070673_100002123
520 Ga0070673_100469677
521 Ga0070673_100680070
522 Ga0070659_100009871
523 Ga0070659_100109995
524 Ga0070659_100139913
525 Ga0070709_10072786
526 Ga0070713_100046622
527 Ga0070701_10044791
528 Ga0070711_100013930
529 Ga0070711_100183404
530 Ga0070700_100210792
531 Ga0070663_100093347
532 Ga0070663_100106008
533 Ga0070663_100275122
534 Ga0070663_100345416
535 Ga0070663_100605077
536 Ga0070662_100046220
537 Ga0070662_100155635
538 Ga0070662_100229732
539 Ga0070681_10026341
540 Ga0070707_100353498
541 Ga0070699_100117663
542 Ga0070699_100522656
543 Ga0070679_100132159
544 Ga0070684_100000070
545 Ga0070684_100008130
546 Ga0070684_100092128
547 Ga0070684_100278877
548 Ga0070697_100227058
549 Ga0068853_100007155
550 Ga0068853_100386581
551 Ga0070672_100138317
552 Ga0070686_100030435
553 Ga0070695_100075584
554 Ga0070695_100196392
555 Ga0070696_100208450
556 Ga0070704_100218988
557 Ga0068855_100176442
558 Ga0068855_100238827
559 Ga0070664_100006402
560 Ga0070664_100070248
561 Ga0070664_100728311
562 Ga0068857_100121853
563 Ga0068854_100150241
564 Ga0068854_100470267
565 Ga0068856_100426121
566 Ga0068856_100496170
567 Ga0070702_100018975
568 Ga0070702_100063934
569 Ga0068852_100054877
570 Ga0068852_100131677
571 Ga0068859_100219798
572 Ga0068866_10297331
573 Ga0068861_100759246
574 Ga0068861_100886134
575 Ga0068870_10149378
576 Ga0068858_100096237
577 Ga0068860_100171199
578 Ga0068862_100581106
579 Ga0081455_10057498
580 Ga0081455_10112317
581 Ga0081538_10002816
582 Ga0081538_10003024
583 Ga0081538_10008126
584 Ga0081538_10009202
585 Ga0081538_10013192
586 Ga0081538_10024680
587 Ga0081538_10033024
588 Ga0081538_10047452
589 Ga0081538_10057231
590 Ga0081538_10057253
591 Ga0081538_10095677
592 Ga0081539_10015338
593 Ga0075364_10028242
594 Ga0075432_10081844
595 Ga0070712_100001501
596 Ga0070712_100407924
597 Ga0070712_100556304
598 Ga0075367_10016268
599 Ga0097621_100089208
600 Ga0068871_100551887
601 Ga0075428_100005592
602 Ga0075428_100006153
603 Ga0075428_100010204
604 Ga0075428_100063892
605 Ga0075428_100467314
606 Ga0075430_100001554
607 Ga0075430_100002705
608 Ga0075430_100119620
609 Ga0075430_100415374
610 Ga0075431_100001540
611 Ga0075431_100024116
612 Ga0075431_100025366
613 Ga0075431_100097536
614 Ga0075433_10033932
615 Ga0075433_10181131
616 Ga0075433_10355718
617 Ga0075434_100381204
618 Ga0075429_100021381
619 Ga0075429_100023383
620 Ga0075429_100184872
621 Ga0068865_100531659
622 Ga0068865_100796156
623 Ga0097620_100219796
624 Ga0075435_100187222
625 Ga0105240_10187949
626 Ga0105240_11056659
627 Ga0111539_10005059
628 Ga0111539_10007337
629 Ga0111539_10038200
630 Ga0111539_10084040
631 Ga0111539_10087330
632 Ga0111539_10153427
633 Ga0111539_10204506
634 Ga0105245_10033607
635 Ga0105245_10194467
636 Ga0105245_10534224
637 Ga0105247_10012419
638 Ga0105247_10130057
639 Ga0105247_10453163
640 Ga0114129_10003172
641 Ga0114129_10011732
642 Ga0114129_10030521
643 Ga0114129_10060435
644 Ga0114129_10126911
645 Ga0114129_10306913
646 Ga0105241_10001678
647 Ga0105242_10118718
648 Ga0105237_10212108
649 Ga0105237_10626262
650 Ga0105238_10025936
651 Ga0105238_10046164
652 Ga0105249_10004448
653 Ga0105239_11558852
654 Ga0105246_10078111
655 Ga0105246_10107994
656 Ga0157371_10472965
657 Ga0157370_10065027
658 Ga0157369_10013747
659 Ga0157378_10051032
660 Ga0157378_10996196
661 Ga0157372_10047180
662 Ga0157372_10234667
663 Ga0157372_10350987
664 Ga0157375_10076407
665 Ga0157375_11388147
666 Ga0163163_10073208
667 Ga0163163_10081781
668 Ga0157380_10276195
669 Ga0157380_10385493
670 Ga0157377_10585963
671 Ga0157379_10021380
672 Ga0157376_10288884
673 Ga0206351_10303326
674 Ga0206352_10844691
675 Ga0206350_10500959
676 Ga0206350_10859385
677 Ga0213874_10001271
678 Ga0213876_10051363
679 Ga0213876_10070145
680 Ga0213875_10000268
681 Ga0213875_10030348
682 Ga0224712_10062866
683 Ga0207697_10020734
684 Ga0207710_10007212
685 Ga0207710_10107803
686 Ga0207647_10001954
687 Ga0207647_10330397
688 Ga0207699_10092180
689 Ga0207645_10165024
690 Ga0207645_10171434
691 Ga0207643_10051109
692 Ga0207705_10000619
693 Ga0207705_10218084
694 Ga0207705_10587677
695 Ga0207654_10018695
696 Ga0207707_10116257
697 Ga0207707_10431253
698 Ga0207671_10489023
699 Ga0207693_10005520
700 Ga0207693_10302613
701 Ga0207693_10483234
702 Ga0207663_10014525
703 Ga0207660_10096502
704 Ga0207660_10395331
705 Ga0207660_10580034
706 Ga0207662_10056896
707 Ga0207657_10014541
708 Ga0207657_10102955
709 Ga0207657_10193867
710 Ga0207657_10339506
711 Ga0207649_10006906
712 Ga0207652_10008987
713 Ga0207681_10028628
714 Ga0207681_10161137
715 Ga0207694_10006835
716 Ga0207694_10009952
717 Ga0207650_10033820
718 Ga0207659_10076531
719 Ga0207659_10204229
720 Ga0207687_10005997
721 Ga0207687_10113040
722 Ga0207690_10020979
723 Ga0207706_10111934
724 Ga0207686_10038973
725 Ga0207709_10012935
726 Ga0207709_10485712
727 Ga0207669_10192011
728 Ga0207704_10233515
729 Ga0207665_10210647
730 Ga0207665_10260545
731 Ga0207691_10093314
732 Ga0207661_10014496
733 Ga0207661_10368493
734 Ga0207661_10445792
735 Ga0207679_10065259
736 Ga0207679_10098136
737 Ga0207679_10307023
738 Ga0207667_10049210
739 Ga0207667_10477375
740 Ga0207651_10007669
741 Ga0207712_10087241
742 Ga0207712_10092505
743 Ga0207668_10127983
744 Ga0207640_10071996
745 Ga0207640_10268195
746 Ga0207658_10400456
747 Ga0207703_10068324
748 Ga0207639_10031789
749 Ga0207639_10189822
750 Ga0207678_10000682
751 Ga0207678_10127757
752 Ga0207678_10393807
753 Ga0207708_10020522
754 Ga0207708_10089069
755 Ga0207708_10236496
756 Ga0207708_10327405
757 Ga0207648_10308020
758 Ga0207676_10043795
759 Ga0207674_10029119
760 Ga0207675_100035396
761 Ga0207675_100557619
762 Ga0207683_10234568
763 Ga0207683_10253519
764 Ga0207698_10039623
765 Ga0207698_10784021
766 Ga0207428_10008253
767 Ga0207428_10245383
768 Ga0207428_10284856
769 Ga0207428_10369175
770 Ga0268266_10429460
771 Ga0268265_10092854
772 Ga0268265_10195261
773 Ga0268265_10257997
774 Ga0268264_10143115
775 Ga0307408_100154826
776 Ga0265314_10274352
777 Ga0307405_10032412
778 Ga0307405_10062070
779 Ga0307413_10273905
780 Ga0307410_10085921
781 Ga0307410_10118903
782 Ga0307406_10348677
783 Ga0307406_10454718
784 Ga0307407_10444908
785 Ga0307409_100135965
786 Ga0307409_100315744
787 Ga0307409_100732984
788 Ga0307416_100060314
789 Ga0307416_100068693
790 Ga0307416_100145990
791 Ga0307416_100228095
792 Ga0307416_100575535
793 Ga0307416_100628180
794 Ga0307416_100745991
795 Ga0307411_10622599
796 Ga0307415_100267162
797 Ga0307415_100550647
798 Ga0307415_100592607
799 Ga0373943_0110209
800 Ga0373962_0087116
801 Ga0373931_0021395
802 Ga0395900_0078069
803 Ga0395900_0757925
804 Ga0395898_0141117
805 Ga0395905_0289897
806 Ga0436364_0798736
807 Ga0436364_1011676
808 Ga0395901_0068810
809 Ga0395901_0369828
810 Ga0395901_0461513
811 Ga0436365_0122524
812 Ga0436365_0336833
813 Ga0436365_1371573
814 Ga0436363_0161552
815 Ga0436363_1549297
816 Ga0439460_0009416
817 Ga0466963_0001318
818 Ga0466963_0019329
819 Ga0466964_0040860
820 Ga0466960_0361823
821 Ga0466959_0047371
822 Ga0466959_0070871
823 Ga0451576_0037162
824 Ga0466958_0004448
825 Ga0466967_0108405
826 Ga0466967_0129909
827 Ga0466967_0240065
828 Ga0466967_0550649
829 Ga0466967_0611302
830 Ga0495580_0022699
831 Ga0495582_0106662
832 Ga0495666_0183499
833 Ga0495665_0083826
834 Ga0495658_0315156
835 Ga0495604_0100761
836 Ga0496100_0043150
837 Ga0496101_0024580
838 Ga0496101_0226194
839 Ga0496102_0002943
840 Ga0496102_0112946
841 Ga0496102_0545003
842 Ga0496102_0804704
843 Ga0496103_0014108
844 Ga0496103_0294191
845 Ga0496104_0018632
846 Ga0496104_0025114
847 Ga0496104_0110070
848 Ga0496105_0187439
849 Ga0496106_0057099
850 Ga0496107_0101633
851 Ga0496108_0010796
852 Ga0496108_0198970
853 Ga0496109_0001879
854 Ga0496110_0000355
855 Ga0496110_0163406
856 Ga0496112_0005358
857 Ga0496113_0752853
858 Ga0501291_041127
859 Ga0501294_009836
860 Ga0501296_014857
861 Ga0501299_003373
862 Ga0501299_042512
863 Ga0501031_0059479
864 Ga0501031_0068374
865 Ga0501031_0125868
866 Ga0501032_0072712
867 Ga0501033_0083612
868 Ga0501033_0135738
869 Ga0501034_0188429
870 Ga0501034_0210703
871 Ga0501036_0030124
872 Ga0501037_0027169
873 Ga0501037_0242967
874 Ga0501038_0090310
875 Ga0501038_0100306
876 Ga0501038_0220730
877 Ga0501039_0010435
878 Ga0501039_0081352
879 Ga0501039_0509945
880 Ga0501040_0032040
881 Ga0501040_0102787
882 Ga0501042_0011759
883 Ga0501042_0077030
884 Ga0501042_0439206
885 Ga0501042_0627200
886 Ga0501043_0027097
887 Ga0501046_0067988
888 Ga0501046_0237784
889 Ga0501047_0095350
890 Ga0501047_0156972
891 Ga0501048_0015289
892 Ga0501067_0022662
893 Ga0501067_0027370
894 Ga0501069_0159402
895 Ga0501070_0056996
896 Ga0501070_0118306
897 Ga0501071_0014403
898 Ga0501071_0024662
899 Ga0501071_0063618
900 Ga0501071_0088399
901 Ga0501071_0208753
902 Ga0501072_0075363
903 Ga0501072_0104211
904 Ga0501072_0149034
905 Ga0501073_0017154
906 Ga0501074_0015943
907 Ga0501075_0045523
908 Ga0501075_0233073
909 Ga0501076_0062118
910 Ga0501076_0259950
911 Ga0501207_015754
912 Ga0501209_066432
913 Ga0501217_011378
914 Ga0501079_0040143
915 Ga0501079_0206581
916 Ga0501079_0426298
917 Ga0501080_0126176
918 Ga0501080_0640431
919 Ga0501081_0038109
920 Ga0501081_0121721
921 Ga0501081_0132424
922 Ga0501081_0372902
923 Ga0501083_0038693
924 Ga0501035_0082635
925 Ga0501044_0072963
926 Ga0501044_0219643
927 Ga0501045_0022944
928 nmdc:mga0k408_205621_c1
929 nmdc:mga06z11_203162_c1
930 nmdc:mga05p37_1006074_c1
931 nmdc:mga05p37_228320_c1
932 nmdc:mga05p37_348028_c1
933 nmdc:mga05p37_40298_c1
934 nmdc:mga05p37_4787_c1
935 nmdc:mga05p37_5624_c1
936 nmdc:mga05p37_92665_c1
937 nmdc:mga09592_23249_c1
938 nmdc:mga09592_28739_c1
939 nmdc:mga09592_379819_c1
940 nmdc:mga0qj67_16862_c1
941 nmdc:mga0qj67_7463_c1
942 nmdc:mga06r32_18024_c1
943 nmdc:mga06r32_19111_c1
944 nmdc:mga08y16_17272_c1
945 nmdc:mga08y16_226640_c1
946 nmdc:mga08y16_267881_c1
947 nmdc:mga08y16_408216_c1
948 nmdc:mga08y16_449360_c1
949 nmdc:mga08y16_45175_c2
950 nmdc:mga08y16_58976_c1
951 nmdc:mga08y16_754753_c1
952 nmdc:mga08y16_949_c1
953 nmdc:mga0n895_275931_c1
954 nmdc:mga0n895_339732_c1
955 nmdc:mga0rr50_502548_c1
956 nmdc:mga0a205_12148_c2
957 nmdc:mga0a205_282873_c1
958 nmdc:mga0a205_287497_c1
959 nmdc:mga0a205_50898_c1
960 Ga0501084_0031012
961 Ga0501084_0085204
962 Ga0501084_0102365
963 Ga0501084_0361064
964 Ga0590075_012822
965 Ga0501082_0017281
966 Ga0501082_0051654
967 Ga0501082_0230929
968 Ga0530510_0034234
969 Ga0530510_0177152
970 Ga0530510_0441764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

33

201

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f9x-assembly2.cif.gz_D cyclase-phosphotriesterase from ruegeria pomeroyi dss-3 0.8823 3 235
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.8772 1 238
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.8733 1 238
8f9x-assembly2.cif.gz_D cyclase-phosphotriesterase from ruegeria pomeroyi dss-3 0.8711 3 235
3krv-assembly1.cif.gz_B the structure of potential metal-dependent hydrolase with cyclase activity 0.8597 1 239
ID Description Score Start End Superfamily
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8819 3 235 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.864 3 235 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8597 1 239 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8581 3 239 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.858 3 235 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A7C2AU67-F1-model_v4 Cyclase family protein 0.9942 2 239 GO:0004061
GO:0019441
AF-A0A7V2PUS3-F1-model_v4 Cyclase family protein 0.9917 5 213 GO:0004061
GO:0019441
AF-A0A7C2AU67-F1-model_v4 Cyclase family protein 0.9859 2 239 GO:0004061
GO:0019441
AF-A0A6B1G3D3-F1-model_v4 Cyclase family protein 0.9844 3 175 GO:0004061
GO:0019441
AF-A0A845CEV2-F1-model_v4 Cyclase family protein 0.9825 1 239 GO:0004061
GO:0019441

Map