F453060

General Info

Members Datasets Scaffolds Average Seq Length
485 236 970 244

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10000778|Ga0070685_100007783
Length 225
Sequence MKIGVVTFPGSNCDYDCYRAVKDALGADAVFLWHRDHDLQLPGGFSYGDYLRAGAIAALSPIMREVKQFAAAGGPVAGICNGFQILCEAGLLPGALVRNRSLKFRSRPVHLLVERADTAFTSEYEPGQVLEIPIAHGEGCYFADPELLDALEAEGQVVFRYCTPEGLVAPAANPNGSARNVAGIINAEGNVLGMMPHPERSVDPLLGSTDGLGLFRSVAAHLARV

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 5.57
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 19.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10000778 3300005466 Bacteria 17344
2 SwRhRL2b_contig_2486931 2162886007 Unclassified 1276
3 SwRhRL2b_contig_2996233 2162886007 Unclassified 1114
4 JGI24035J26624_1000511 3300002126 Bacteria 3609
5 JGI24035J26624_1000836 3300002126 Bacteria 2911
6 JGI25404J52841_10016093 3300003659 Unclassified 1622
7 JGI25405J52794_10006305 3300003911 Bacteria 2165
8 JGI25405J52794_10006777 3300003911 Bacteria 2097
9 Ga0065704_10020294 3300005289 Bacteria 1287
10 Ga0065704_10082192 3300005289 Unclassified 3596
11 Ga0065704_10096463 3300005289 Unclassified 2440
12 Ga0065712_10000304 3300005290 Bacteria 16967
13 Ga0065712_10185254 3300005290 Bacteria 1173
14 Ga0065712_10234559 3300005290 Bacteria 1001
15 Ga0065715_10002246 3300005293 Bacteria 12324
16 Ga0065715_10004371 3300005293 Bacteria 3537
17 Ga0065715_10089061 3300005293 Bacteria 15202
18 Ga0065715_10112435 3300005293 Bacteria 2498
19 Ga0065715_10208501 3300005293 Unclassified 1325
20 Ga0065715_10215703 3300005293 Bacteria 1294
21 Ga0065707_10002803 3300005295 Unclassified 4862
22 Ga0065707_10105749 3300005295 Bacteria 2630
23 Ga0070676_10001727 3300005328 Bacteria 11113
24 Ga0070683_100026297 3300005329 Bacteria 5238
25 Ga0070690_100013074 3300005330 Bacteria 4897
26 Ga0070690_100044901 3300005330 Bacteria 2806
27 Ga0068869_100041169 3300005334 Bacteria 3307
28 Ga0070666_10122800 3300005335 Bacteria 1802
29 Ga0070682_100009308 3300005337 Bacteria 5561
30 Ga0070682_100532433 3300005337 Bacteria 916
31 Ga0068868_100008956 3300005338 Bacteria 7181
32 Ga0068868_100081026 3300005338 Bacteria 2602
33 Ga0070660_100071943 3300005339 Bacteria 2701
34 Ga0070660_100074650 3300005339 Unclassified 2654
35 Ga0070660_100080637 3300005339 Bacteria 2554
36 Ga0070689_100013738 3300005340 Bacteria 5866
37 Ga0070689_100057345 3300005340 Bacteria 3022
38 Ga0070689_100117892 3300005340 Bacteria 2118
39 Ga0070687_100034114 3300005343 Bacteria 2517
40 Ga0070687_100144555 3300005343 Bacteria 1389
41 Ga0070687_100248507 3300005343 Bacteria 1104
42 Ga0070661_100074638 3300005344 Unclassified 2498
43 Ga0070661_100230910 3300005344 Bacteria 1422
44 Ga0070668_100001884 3300005347 Bacteria 15324
45 Ga0070669_100009152 3300005353 Bacteria 7058
46 Ga0070675_100001007 3300005354 Bacteria 20224
47 Ga0070675_100002985 3300005354 Bacteria 12783
48 Ga0070675_100075666 3300005354 Bacteria 2799
49 Ga0070673_100032439 3300005364 Bacteria 3933
50 Ga0070688_100001145 3300005365 Bacteria 13255
51 Ga0070688_100007251 3300005365 Bacteria 5973
52 Ga0070688_100010993 3300005365 Bacteria 5016
53 Ga0070688_100088392 3300005365 Bacteria 2020
54 Ga0070659_100002012 3300005366 Bacteria 14526
55 Ga0070659_100039198 3300005366 Bacteria 3698
56 Ga0070667_100015772 3300005367 Bacteria 6250
57 Ga0070709_10087490 3300005434 Unclassified 2047
58 Ga0070709_10436423 3300005434 Bacteria 984
59 Ga0070714_100020395 3300005435 Bacteria 5412
60 Ga0070714_100070826 3300005435 Unclassified 3014
61 Ga0070714_100129645 3300005435 Bacteria 2253
62 Ga0070713_100083829 3300005436 Bacteria 2726
63 Ga0070713_100139223 3300005436 Bacteria 2148
64 Ga0070713_100605768 3300005436 Unclassified 1041
65 Ga0070713_100738180 3300005436 Bacteria 941
66 Ga0070710_10012023 3300005437 Unclassified 4291
67 Ga0070710_10174184 3300005437 Bacteria 1343
68 Ga0070711_100035108 3300005439 Bacteria 3349
69 Ga0070711_100203308 3300005439 Unclassified 1530
70 Ga0070705_100058969 3300005440 Bacteria 2271
71 Ga0070705_100092052 3300005440 Unclassified 1892
72 Ga0070705_100098112 3300005440 Bacteria 1843
73 Ga0070700_100005268 3300005441 Bacteria 6841
74 Ga0070694_100006488 3300005444 Bacteria 7109
75 Ga0070694_100134140 3300005444 Bacteria 1792
76 Ga0070708_100001887 3300005445 Bacteria 16088
77 Ga0070708_100022648 3300005445 Bacteria 5330
78 Ga0070708_100033442 3300005445 Bacteria 4467
79 Ga0070708_100112520 3300005445 Bacteria 2504
80 Ga0070708_100125981 3300005445 Bacteria 2367
81 Ga0070678_100173467 3300005456 Unclassified 1758
82 Ga0070662_100000551 3300005457 Bacteria 22709
83 Ga0070662_100001546 3300005457 Bacteria 14200
84 Ga0070662_100446682 3300005457 Unclassified 1073
85 Ga0070681_10011926 3300005458 Bacteria 8617
86 Ga0070681_10171468 3300005458 Bacteria 2091
87 Ga0070685_10003621 3300005466 Bacteria 7841
88 Ga0070685_10021020 3300005466 Bacteria 3542
89 Ga0070706_100002814 3300005467 Bacteria 17409
90 Ga0070706_100014767 3300005467 Bacteria 7216
91 Ga0070706_100025148 3300005467 Bacteria 5481
92 Ga0070706_100078700 3300005467 Unclassified 3052
93 Ga0070706_100094095 3300005467 Bacteria 2781
94 Ga0070706_100233512 3300005467 Bacteria 1717
95 Ga0070706_100327920 3300005467 Unclassified 1427
96 Ga0070707_100006248 3300005468 Bacteria 11089
97 Ga0070707_100009203 3300005468 Bacteria 9165
98 Ga0070707_100013255 3300005468 Bacteria 7709
99 Ga0070707_100018064 3300005468 Bacteria 6634
100 Ga0070707_100041814 3300005468 Bacteria 4387
101 Ga0070707_100103909 3300005468 Bacteria 2753
102 Ga0070707_100144878 3300005468 Bacteria 2312
103 Ga0070707_100346232 3300005468 Bacteria 1444
104 Ga0070707_100378171 3300005468 Bacteria 1376
105 Ga0070707_100494764 3300005468 Bacteria 1184
106 Ga0070707_100684312 3300005468 Unclassified 988
107 Ga0070698_100000343 3300005471 Bacteria 47990
108 Ga0070698_100001022 3300005471 Bacteria 30790
109 Ga0070698_100042082 3300005471 Bacteria 4686
110 Ga0070698_100107912 3300005471 Bacteria 2752
111 Ga0070698_100565150 3300005471 Unclassified 1077
112 Ga0070699_100030303 3300005518 Bacteria 4669
113 Ga0070699_100033854 3300005518 Bacteria 4414
114 Ga0070699_100038162 3300005518 Bacteria 4160
115 Ga0070699_100069465 3300005518 Bacteria 3061
116 Ga0070699_100231471 3300005518 Bacteria 1648
117 Ga0070699_100312255 3300005518 Unclassified 1411
118 Ga0070679_100005516 3300005530 Bacteria 11722
119 Ga0070679_100046078 3300005530 Bacteria 4345
120 Ga0070684_100002121 3300005535 Bacteria 14623
121 Ga0070684_100003818 3300005535 Bacteria 11392
122 Ga0070684_100129224 3300005535 Unclassified 2278
123 Ga0070684_100905037 3300005535 Unclassified 827
124 Ga0070697_100002323 3300005536 Bacteria 14616
125 Ga0070697_100005336 3300005536 Bacteria 9881
126 Ga0070697_100006661 3300005536 Bacteria 8958
127 Ga0070697_100010196 3300005536 Bacteria 7328
128 Ga0070697_100010987 3300005536 Bacteria 7074
129 Ga0070697_100065693 3300005536 Bacteria 2965
130 Ga0070697_100086524 3300005536 Bacteria 2586
131 Ga0070697_100180352 3300005536 Bacteria 1790
132 Ga0070697_100269719 3300005536 Unclassified 1458
133 Ga0070697_100527184 3300005536 Unclassified 1034
134 Ga0070672_100035413 3300005543 Unclassified 3795
135 Ga0070672_100114775 3300005543 Bacteria 2199
136 Ga0070686_100099512 3300005544 Bacteria 1962
137 Ga0070686_100392496 3300005544 Unclassified 1053
138 Ga0070665_100032164 3300005548 Bacteria 5279
139 Ga0070665_100048373 3300005548 Bacteria 4270
140 Ga0070665_100236949 3300005548 Bacteria 1825
141 Ga0070704_100047970 3300005549 Bacteria 2988
142 Ga0068855_100512063 3300005563 Unclassified 1303
143 Ga0070664_100219750 3300005564 Bacteria 1700
144 Ga0068859_100033934 3300005617 Bacteria 5123
145 Ga0068864_100141016 3300005618 Bacteria 2174
146 Ga0068864_100504400 3300005618 Bacteria 1164
147 Ga0068861_100122106 3300005719 Bacteria 2103
148 Ga0068863_100054878 3300005841 Bacteria 3775
149 Ga0068858_100004649 3300005842 Bacteria 13450
150 Ga0068858_100285586 3300005842 Unclassified 1572
151 Ga0068858_100345339 3300005842 Bacteria 1425
152 Ga0068860_100002246 3300005843 Bacteria 20333
153 Ga0068860_100022266 3300005843 Bacteria 6132
154 Ga0068862_100009647 3300005844 Bacteria 7979
155 Ga0081455_10000281 3300005937 Bacteria 67337
156 Ga0081455_10003189 3300005937 Bacteria 19030
157 Ga0081455_10007917 3300005937 Bacteria 11122
158 Ga0081455_10039585 3300005937 Unclassified 4165
159 Ga0081455_10135472 3300005937 Bacteria 1920
160 Ga0081455_10197440 3300005937 Bacteria 1509
161 Ga0081540_1000010 3300005983 Bacteria 193206
162 Ga0081540_1043771 3300005983 Bacteria 2292
163 Ga0081540_1045647 3300005983 Bacteria 2222
164 Ga0081539_10018957 3300005985 Bacteria 4740
165 Ga0081539_10019750 3300005985 Bacteria 4595
166 Ga0081539_10051280 3300005985 Bacteria 2327
167 Ga0081539_10087139 3300005985 Bacteria 1623
168 Ga0070717_10005229 3300006028 Bacteria 9457
169 Ga0070717_10045099 3300006028 Bacteria 3603
170 Ga0070717_10069223 3300006028 Bacteria 2938
171 Ga0070717_10077632 3300006028 Bacteria 2781
172 Ga0070717_10218211 3300006028 Unclassified 1675
173 Ga0070717_10232898 3300006028 Bacteria 1622
174 Ga0070717_10402700 3300006028 Unclassified 1229
175 Ga0070715_10012900 3300006163 Bacteria 3055
176 Ga0070716_100093712 3300006173 Bacteria 1824
177 Ga0070716_100140180 3300006173 Bacteria 1541
178 Ga0070712_100011537 3300006175 Bacteria 5606
179 Ga0070712_100096334 3300006175 Bacteria 2178
180 Ga0097621_100051472 3300006237 Bacteria 3352
181 Ga0097621_100303868 3300006237 Bacteria 1410
182 Ga0068871_100214193 3300006358 Unclassified 1667
183 Ga0075428_100453141 3300006844 Bacteria 1374
184 Ga0075433_10655545 3300006852 Bacteria 920
185 Ga0075434_100078377 3300006871 Unclassified 3300
186 Ga0075434_100552763 3300006871 Unclassified 1171
187 Ga0075436_100011276 3300006914 Bacteria 6131
188 Ga0075436_100048527 3300006914 Bacteria 2929
189 Ga0097620_100033934 3300006931 Bacteria 5123
190 Ga0105240_10076753 3300009093 Bacteria 4118
191 Ga0105240_10830209 3300009093 Bacteria 999
192 Ga0111539_10456025 3300009094 Bacteria 1489
193 Ga0105245_10033653 3300009098 Bacteria 4544
194 Ga0105247_10142634 3300009101 Bacteria 1571
195 Ga0114129_10003628 3300009147 Bacteria 21715
196 Ga0114129_10702303 3300009147 Bacteria 1300
197 Ga0105241_10042782 3300009174 Unclassified 3429
198 Ga0105241_10172801 3300009174 Bacteria 1786
199 Ga0105242_10656902 3300009176 Bacteria 1020
200 Ga0105237_10200551 3300009545 Unclassified 1995
201 Ga0105238_10841112 3300009551 Unclassified 935
202 Ga0105249_10000764 3300009553 Bacteria 28918
203 Ga0105249_10001939 3300009553 Bacteria 17967
204 Ga0099796_10035915 3300010159 Bacteria 1647
205 Ga0105239_10009019 3300010375 Bacteria 11292
206 Ga0105239_10018654 3300010375 Bacteria 7664
207 Ga0105239_10108424 3300010375 Bacteria 3077
208 Ga0105239_10241000 3300010375 Bacteria 2029
209 Ga0105246_10152057 3300011119 Unclassified 1753
210 Ga0105246_10290394 3300011119 Bacteria 1315
211 Ga0157373_10148638 3300013100 Bacteria 1648
212 Ga0157370_10071717 3300013104 Bacteria 3268
213 Ga0157370_10188722 3300013104 Bacteria 1913
214 Ga0157369_10020613 3300013105 Bacteria 7371
215 Ga0157369_10039899 3300013105 Bacteria 5129
216 Ga0157374_10009134 3300013296 Bacteria 8496
217 Ga0157374_10019009 3300013296 Bacteria 6077
218 Ga0157374_10041100 3300013296 Bacteria 4259
219 Ga0157374_10147716 3300013296 Bacteria 2284
220 Ga0157378_10005114 3300013297 Bacteria 11516
221 Ga0157378_10006027 3300013297 Bacteria 10618
222 Ga0157378_10079660 3300013297 Bacteria 2958
223 Ga0157378_10278723 3300013297 Unclassified 1611
224 Ga0157378_10484344 3300013297 Bacteria 1233
225 Ga0163162_10069988 3300013306 Unclassified 3560
226 Ga0163162_10090723 3300013306 Unclassified 3138
227 Ga0163162_10138118 3300013306 Bacteria 2549
228 Ga0157372_10003056 3300013307 Bacteria 18031
229 Ga0157372_10104974 3300013307 Unclassified 3231
230 Ga0157372_10408388 3300013307 Bacteria 1582
231 Ga0157375_10001983 3300013308 Bacteria 17679
232 Ga0157375_10093910 3300013308 Bacteria 3067
233 Ga0157375_10206111 3300013308 Bacteria 2122
234 Ga0157375_10378712 3300013308 Unclassified 1582
235 Ga0182008_10010956 3300014497 Bacteria 4836
236 Ga0157376_10005882 3300014969 Bacteria 8606
237 Ga0157376_10030263 3300014969 Unclassified 4321
238 Ga0157376_10974092 3300014969 Bacteria 870
239 Ga0182006_1010158 3300015261 Bacteria 4195
240 Ga0182005_1048143 3300015265 Bacteria 1159
241 Ga0163161_10126835 3300017792 Bacteria 1922
242 Ga0163161_10495558 3300017792 Unclassified 994
243 Ga0163161_10530465 3300017792 Bacteria 962
244 Ga0213875_10043327 3300021388 Bacteria 2114
245 Ga0207666_1000181 3300025271 Bacteria 9612
246 Ga0207673_1003574 3300025290 Unclassified 1824
247 Ga0207673_1004216 3300025290 Bacteria 1710
248 Ga0207697_10000141 3300025315 Bacteria 34858
249 Ga0207697_10000521 3300025315 Bacteria 21689
250 Ga0207697_10002550 3300025315 Bacteria 9375
251 Ga0207697_10004329 3300025315 Bacteria 6796
252 Ga0207697_10005413 3300025315 Bacteria 5935
253 Ga0207697_10217384 3300025315 Unclassified 843
254 Ga0207692_10098452 3300025898 Bacteria 1600
255 Ga0207692_10246127 3300025898 Unclassified 1070
256 Ga0207680_10084731 3300025903 Bacteria 2000
257 Ga0207647_10010011 3300025904 Bacteria 6714
258 Ga0207699_10040988 3300025906 Bacteria 2671
259 Ga0207699_10256197 3300025906 Unclassified 1208
260 Ga0207645_10003893 3300025907 Bacteria 11158
261 Ga0207645_10387349 3300025907 Bacteria 939
262 Ga0207684_10000052 3300025910 Bacteria 228510
263 Ga0207684_10003481 3300025910 Bacteria 15355
264 Ga0207684_10042597 3300025910 Bacteria 3848
265 Ga0207684_10063183 3300025910 Unclassified 3144
266 Ga0207684_10110589 3300025910 Bacteria 2352
267 Ga0207684_10117494 3300025910 Bacteria 2279
268 Ga0207684_10119500 3300025910 Bacteria 2259
269 Ga0207684_10137898 3300025910 Bacteria 2096
270 Ga0207684_10145531 3300025910 Bacteria 2038
271 Ga0207684_10155289 3300025910 Bacteria 1970
272 Ga0207684_10157151 3300025910 Bacteria 1957
273 Ga0207684_10418356 3300025910 Bacteria 1152
274 Ga0207654_10020609 3300025911 Bacteria 3498
275 Ga0207654_10127580 3300025911 Bacteria 1606
276 Ga0207707_10003117 3300025912 Bacteria 14719
277 Ga0207707_10042696 3300025912 Unclassified 3956
278 Ga0207695_10076413 3300025913 Bacteria 3405
279 Ga0207671_10122679 3300025914 Bacteria 1987
280 Ga0207693_10016748 3300025915 Bacteria 5854
281 Ga0207693_10029971 3300025915 Bacteria 4294
282 Ga0207693_10057152 3300025915 Bacteria 3059
283 Ga0207693_10619486 3300025915 Bacteria 842
284 Ga0207663_10019941 3300025916 Bacteria 3789
285 Ga0207663_10148766 3300025916 Unclassified 1640
286 Ga0207660_10014089 3300025917 Bacteria 5249
287 Ga0207660_10184874 3300025917 Bacteria 1620
288 Ga0207662_10049312 3300025918 Bacteria 2498
289 Ga0207662_10171130 3300025918 Bacteria 1393
290 Ga0207657_10037905 3300025919 Bacteria 4298
291 Ga0207657_10082060 3300025919 Bacteria 2707
292 Ga0207657_10167661 3300025919 Bacteria 1780
293 Ga0207649_10037128 3300025920 Bacteria 2940
294 Ga0207652_10006887 3300025921 Bacteria 9158
295 Ga0207652_10068000 3300025921 Unclassified 3090
296 Ga0207646_10000317 3300025922 Bacteria 65310
297 Ga0207646_10009834 3300025922 Bacteria 9416
298 Ga0207646_10021163 3300025922 Bacteria 6015
299 Ga0207646_10027286 3300025922 Bacteria 5208
300 Ga0207646_10040345 3300025922 Bacteria 4198
301 Ga0207646_10059887 3300025922 Bacteria 3400
302 Ga0207646_10064085 3300025922 Bacteria 3281
303 Ga0207646_10134598 3300025922 Unclassified 2225
304 Ga0207646_10226031 3300025922 Bacteria 1691
305 Ga0207646_10264415 3300025922 Bacteria 1555
306 Ga0207646_10430390 3300025922 Unclassified 1191
307 Ga0207681_10002301 3300025923 Bacteria 12150
308 Ga0207659_10005840 3300025926 Bacteria 7502
309 Ga0207659_10008377 3300025926 Bacteria 6413
310 Ga0207659_10011958 3300025926 Bacteria 5499
311 Ga0207687_10088750 3300025927 Unclassified 2250
312 Ga0207700_10066639 3300025928 Bacteria 2753
313 Ga0207700_10166993 3300025928 Bacteria 1832
314 Ga0207664_10123960 3300025929 Unclassified 2167
315 Ga0207664_10136931 3300025929 Bacteria 2067
316 Ga0207690_10014426 3300025932 Bacteria 4773
317 Ga0207690_10060265 3300025932 Bacteria 2575
318 Ga0207706_10000900 3300025933 Bacteria 30537
319 Ga0207706_10062603 3300025933 Unclassified 3276
320 Ga0207706_10123210 3300025933 Bacteria 2280
321 Ga0207706_10471262 3300025933 Unclassified 1085
322 Ga0207670_10012506 3300025936 Bacteria 4969
323 Ga0207670_10024336 3300025936 Bacteria 3783
324 Ga0207670_10030021 3300025936 Bacteria 3470
325 Ga0207670_10276244 3300025936 Unclassified 1308
326 Ga0207669_10124484 3300025937 Bacteria 1758
327 Ga0207665_10020708 3300025939 Bacteria 4324
328 Ga0207665_10041470 3300025939 Bacteria 3074
329 Ga0207665_10067493 3300025939 Bacteria 2436
330 Ga0207665_10178048 3300025939 Bacteria 1539
331 Ga0207691_10114577 3300025940 Unclassified 2395
332 Ga0207691_10133609 3300025940 Bacteria 2190
333 Ga0207689_10032283 3300025942 Bacteria 4357
334 Ga0207661_10011749 3300025944 Bacteria 6356
335 Ga0207661_10044421 3300025944 Unclassified 3512
336 Ga0207661_10108007 3300025944 Bacteria 2348
337 Ga0207667_10461608 3300025949 Unclassified 1290
338 Ga0207651_10174131 3300025960 Unclassified 1700
339 Ga0207712_10018180 3300025961 Bacteria 4575
340 Ga0207712_10052585 3300025961 Bacteria 2854
341 Ga0207668_10010206 3300025972 Bacteria 5668
342 Ga0207668_10401751 3300025972 Bacteria 1159
343 Ga0207658_10003126 3300025986 Bacteria 11848
344 Ga0207658_10097722 3300025986 Bacteria 2293
345 Ga0207677_10038658 3300026023 Bacteria 3131
346 Ga0207677_10119444 3300026023 Bacteria 1980
347 Ga0207677_10164551 3300026023 Bacteria 1727
348 Ga0207703_10014572 3300026035 Bacteria 6134
349 Ga0207678_10028626 3300026067 Unclassified 4862
350 Ga0207678_10228172 3300026067 Bacteria 1594
351 Ga0207708_10013283 3300026075 Bacteria 6149
352 Ga0207641_10009767 3300026088 Bacteria 7901
353 Ga0207641_10324397 3300026088 Bacteria 1461
354 Ga0207641_10523446 3300026088 Bacteria 1154
355 Ga0207648_10140886 3300026089 Bacteria 2125
356 Ga0207676_10059081 3300026095 Unclassified 3027
357 Ga0207676_10140318 3300026095 Unclassified 2068
358 Ga0207675_100100495 3300026118 Unclassified 2725
359 Ga0207675_100164615 3300026118 Bacteria 2117
360 Ga0207683_10206399 3300026121 Unclassified 1787
361 Ga0268266_10020041 3300028379 Bacteria 5700
362 Ga0268266_10020684 3300028379 Bacteria 5609
363 Ga0268266_10163657 3300028379 Bacteria 2014
364 Ga0268264_10005799 3300028381 Bacteria 10469
365 Ga0268264_10619369 3300028381 Bacteria 1068
366 Ga0265332_10020064 3300031238 Bacteria 2951
367 Ga0265327_10079240 3300031251 Bacteria 1626
368 Ga0307414_10340983 3300032004 Bacteria 1283
369 Ga0307411_10405690 3300032005 Bacteria 1128
370 Ga0307415_100096152 3300032126 Bacteria 2158
371 Ga0316583_10067907 3300032133 Bacteria 1248
372 Ga0373959_0000139 3300034820 Bacteria 16056
373 Ga0373923_0076685 3300035111 Bacteria 1444
374 Ga0373945_0108019 3300035116 Bacteria 1095
375 Ga0373954_0299938 3300035118 Bacteria 793
376 Ga0373956_0128258 3300035119 Unclassified 1187
377 Ga0373943_0045182 3300035170 Bacteria 2146
378 Ga0373943_0109320 3300035170 Bacteria 1456
379 Ga0373946_0071965 3300035171 Bacteria 1496
380 Ga0373946_0238624 3300035171 Bacteria 883
381 Ga0373935_0002468 3300035692 Bacteria 10578
382 Ga0373947_0031746 3300035725 Unclassified 3110
383 Ga0373947_0036129 3300035725 Bacteria 2929
384 Ga0373947_0090786 3300035725 Unclassified 1905
385 Ga0373937_0108833 3300036401 Unclassified 2577
386 Ga0373937_0220521 3300036401 Bacteria 1785
387 Ga0373937_0366433 3300036401 Bacteria 1366
388 Ga0373937_0654941 3300036401 Bacteria 996
389 Ga0373925_0032155 3300037068 Bacteria 3860
390 Ga0373925_0404676 3300037068 Bacteria 1113
391 Ga0395899_0093400 3300037312 Unclassified 2178
392 Ga0395900_0004886 3300037418 Bacteria 14115
393 Ga0395900_0117993 3300037418 Bacteria 2723
394 Ga0395900_0495783 3300037418 Bacteria 1172
395 Ga0395900_0546118 3300037418 Bacteria 1104
396 Ga0395900_0713328 3300037418 Bacteria 936
397 Ga0395898_0003960 3300037466 Bacteria 16321
398 Ga0395898_0094317 3300037466 Bacteria 2876
399 Ga0395898_0315825 3300037466 Bacteria 1491
400 Ga0395905_0015181 3300037471 Bacteria 7328
401 Ga0395905_0570660 3300037471 Bacteria 1033
402 Ga0436364_1548325 3300037853 Bacteria 2389
403 Ga0395901_0005337 3300038443 Bacteria 12984
404 Ga0395901_0027721 3300038443 Bacteria 5824
405 Ga0395901_0037789 3300038443 Bacteria 4993
406 Ga0395901_0311268 3300038443 Unclassified 1631
407 Ga0395901_0408988 3300038443 Bacteria 1393
408 Ga0436363_0528150 3300039450 Bacteria 3132
409 Ga0451800_0403742 3300041459 Unclassified 771
410 Ga0439455_0009613 3300042012 Bacteria 2105
411 Ga0439440_0061665 3300042993 Bacteria 959
412 Ga0466969_0052867 3300044656 Bacteria 1995
413 Ga0466965_0058888 3300044683 Bacteria 1916
414 Ga0466961_0012234 3300044693 Bacteria 5487
415 Ga0451576_0047803 3300045051 Bacteria 4497
416 Ga0495592_0030219 3300046454 Bacteria 4098
417 Ga0495629_0243708 3300046459 Unclassified 1237
418 Ga0495651_0208292 3300046462 Unclassified 1363
419 Ga0495651_0291208 3300046462 Bacteria 1099
420 Ga0495653_0387031 3300046463 Bacteria 892
421 Ga0495580_0425306 3300046472 Unclassified 893
422 Ga0495664_0058256 3300046477 Bacteria 2298
423 Ga0495594_0145291 3300046499 Bacteria 1346
424 Ga0495608_0179742 3300046511 Bacteria 1339
425 Ga0495618_0179796 3300046514 Bacteria 1344
426 Ga0495628_0008439 3300046516 Bacteria 8836
427 Ga0495630_0188478 3300046517 Bacteria 1573
428 Ga0495643_0000178 3300046522 Bacteria 100965
429 Ga0495652_0271176 3300046529 Unclassified 1247
430 Ga0495640_0269192 3300046533 Bacteria 1063
431 Ga0495586_0079519 3300046535 Bacteria 1800
432 Ga0495587_0026645 3300046536 Bacteria 3524
433 Ga0495667_0148523 3300046559 Unclassified 1509
434 Ga0495634_0039577 3300046642 Unclassified 3210
435 Ga0495634_0122236 3300046642 Unclassified 1667
436 Ga0495635_0251309 3300046663 Unclassified 1192
437 Ga0495657_0175197 3300046675 Bacteria 1319
438 Ga0495613_0103107 3300046689 Bacteria 2060
439 Ga0495581_0154230 3300047315 Unclassified 1342
440 Ga0495604_0392007 3300047317 Bacteria 916
441 Ga0495674_0090463 3300047319 Unclassified 2615
442 Ga0495676_0189423 3300047321 Unclassified 1436
443 Ga0495680_0331382 3300047322 Bacteria 1063
444 Ga0495675_0105710 3300047444 Bacteria 1759
445 Ga0495675_0160633 3300047444 Unclassified 1384
446 Ga0495684_0033489 3300047471 Unclassified 3940
447 Ga0495602_0022802 3300048088 Bacteria 6120
448 Ga0496100_0130722 3300048903 Bacteria 1768
449 Ga0496101_0050466 3300048904 Bacteria 2995
450 Ga0496102_0081786 3300048905 Bacteria 2978
451 Ga0496102_0816422 3300048905 Bacteria 855
452 Ga0496103_0475231 3300048906 Unclassified 801
453 Ga0496104_0093380 3300048907 Bacteria 2878
454 Ga0496104_0789088 3300048907 Bacteria 856
455 Ga0496105_0025997 3300048908 Unclassified 4771
456 Ga0496105_0530863 3300048908 Bacteria 921
457 Ga0496107_0098669 3300048910 Unclassified 2140
458 Ga0496108_0130844 3300048911 Bacteria 2157
459 Ga0496109_0002468 3300048912 Bacteria 15507
460 Ga0496109_0018214 3300048912 Bacteria 6167
461 Ga0496109_0048371 3300048912 Bacteria 3870
462 Ga0496109_0054202 3300048912 Bacteria 3658
463 Ga0496109_0290257 3300048912 Bacteria 1542
464 Ga0496110_0870403 3300048913 Bacteria 807
465 Ga0496112_0044340 3300048915 Bacteria 4357
466 Ga0496112_0048860 3300048915 Bacteria 4145
467 Ga0496113_0107959 3300048916 Bacteria 2163
468 Ga0496114_0020687 3300048917 Bacteria 5341
469 Ga0496114_0199909 3300048917 Unclassified 1750
470 Ga0496114_0680872 3300048917 Bacteria 903
471 Ga0496115_0001050 3300048918 Bacteria 20035
472 Ga0496115_0003638 3300048918 Bacteria 11094
473 Ga0496115_0006255 3300048918 Bacteria 8711
474 Ga0501033_0414539 3300049570 Bacteria 938
475 Ga0501036_0129306 3300049572 Bacteria 2133
476 Ga0501046_0071013 3300049580 Bacteria 2706
477 Ga0501047_0058771 3300049581 Bacteria 3714
478 Ga0501067_0149790 3300049583 Bacteria 1300
479 Ga0501076_0260892 3300049592 Bacteria 1419
480 Ga0501081_0265525 3300049743 Bacteria 1255
481 nmdc:mga05p37_67787_c1 3300050507 Bacteria 4390
482 nmdc:mga08x19_16882_c1 3300050514 Bacteria 4459
483 Ga0495601_0006286 3300053077 Bacteria 6939
484 Ga0495595_0195880 3300053084 Bacteria 1005
485 Ga0500566_0204232 3300053094 Bacteria 995
486 Ga0070685_10000778
487 SwRhRL2b_contig_2486931
488 SwRhRL2b_contig_2996233
489 JGI24035J26624_1000511
490 JGI24035J26624_1000836
491 JGI25404J52841_10016093
492 JGI25405J52794_10006305
493 JGI25405J52794_10006777
494 Ga0065704_10020294
495 Ga0065704_10082192
496 Ga0065704_10096463
497 Ga0065712_10000304
498 Ga0065712_10185254
499 Ga0065712_10234559
500 Ga0065715_10002246
501 Ga0065715_10004371
502 Ga0065715_10089061
503 Ga0065715_10112435
504 Ga0065715_10208501
505 Ga0065715_10215703
506 Ga0065707_10002803
507 Ga0065707_10105749
508 Ga0070676_10001727
509 Ga0070683_100026297
510 Ga0070690_100013074
511 Ga0070690_100044901
512 Ga0068869_100041169
513 Ga0070666_10122800
514 Ga0070682_100009308
515 Ga0070682_100532433
516 Ga0068868_100008956
517 Ga0068868_100081026
518 Ga0070660_100071943
519 Ga0070660_100074650
520 Ga0070660_100080637
521 Ga0070689_100013738
522 Ga0070689_100057345
523 Ga0070689_100117892
524 Ga0070687_100034114
525 Ga0070687_100144555
526 Ga0070687_100248507
527 Ga0070661_100074638
528 Ga0070661_100230910
529 Ga0070668_100001884
530 Ga0070669_100009152
531 Ga0070675_100001007
532 Ga0070675_100002985
533 Ga0070675_100075666
534 Ga0070673_100032439
535 Ga0070688_100001145
536 Ga0070688_100007251
537 Ga0070688_100010993
538 Ga0070688_100088392
539 Ga0070659_100002012
540 Ga0070659_100039198
541 Ga0070667_100015772
542 Ga0070709_10087490
543 Ga0070709_10436423
544 Ga0070714_100020395
545 Ga0070714_100070826
546 Ga0070714_100129645
547 Ga0070713_100083829
548 Ga0070713_100139223
549 Ga0070713_100605768
550 Ga0070713_100738180
551 Ga0070710_10012023
552 Ga0070710_10174184
553 Ga0070711_100035108
554 Ga0070711_100203308
555 Ga0070705_100058969
556 Ga0070705_100092052
557 Ga0070705_100098112
558 Ga0070700_100005268
559 Ga0070694_100006488
560 Ga0070694_100134140
561 Ga0070708_100001887
562 Ga0070708_100022648
563 Ga0070708_100033442
564 Ga0070708_100112520
565 Ga0070708_100125981
566 Ga0070678_100173467
567 Ga0070662_100000551
568 Ga0070662_100001546
569 Ga0070662_100446682
570 Ga0070681_10011926
571 Ga0070681_10171468
572 Ga0070685_10003621
573 Ga0070685_10021020
574 Ga0070706_100002814
575 Ga0070706_100014767
576 Ga0070706_100025148
577 Ga0070706_100078700
578 Ga0070706_100094095
579 Ga0070706_100233512
580 Ga0070706_100327920
581 Ga0070707_100006248
582 Ga0070707_100009203
583 Ga0070707_100013255
584 Ga0070707_100018064
585 Ga0070707_100041814
586 Ga0070707_100103909
587 Ga0070707_100144878
588 Ga0070707_100346232
589 Ga0070707_100378171
590 Ga0070707_100494764
591 Ga0070707_100684312
592 Ga0070698_100000343
593 Ga0070698_100001022
594 Ga0070698_100042082
595 Ga0070698_100107912
596 Ga0070698_100565150
597 Ga0070699_100030303
598 Ga0070699_100033854
599 Ga0070699_100038162
600 Ga0070699_100069465
601 Ga0070699_100231471
602 Ga0070699_100312255
603 Ga0070679_100005516
604 Ga0070679_100046078
605 Ga0070684_100002121
606 Ga0070684_100003818
607 Ga0070684_100129224
608 Ga0070684_100905037
609 Ga0070697_100002323
610 Ga0070697_100005336
611 Ga0070697_100006661
612 Ga0070697_100010196
613 Ga0070697_100010987
614 Ga0070697_100065693
615 Ga0070697_100086524
616 Ga0070697_100180352
617 Ga0070697_100269719
618 Ga0070697_100527184
619 Ga0070672_100035413
620 Ga0070672_100114775
621 Ga0070686_100099512
622 Ga0070686_100392496
623 Ga0070665_100032164
624 Ga0070665_100048373
625 Ga0070665_100236949
626 Ga0070704_100047970
627 Ga0068855_100512063
628 Ga0070664_100219750
629 Ga0068859_100033934
630 Ga0068864_100141016
631 Ga0068864_100504400
632 Ga0068861_100122106
633 Ga0068863_100054878
634 Ga0068858_100004649
635 Ga0068858_100285586
636 Ga0068858_100345339
637 Ga0068860_100002246
638 Ga0068860_100022266
639 Ga0068862_100009647
640 Ga0081455_10000281
641 Ga0081455_10003189
642 Ga0081455_10007917
643 Ga0081455_10039585
644 Ga0081455_10135472
645 Ga0081455_10197440
646 Ga0081540_1000010
647 Ga0081540_1043771
648 Ga0081540_1045647
649 Ga0081539_10018957
650 Ga0081539_10019750
651 Ga0081539_10051280
652 Ga0081539_10087139
653 Ga0070717_10005229
654 Ga0070717_10045099
655 Ga0070717_10069223
656 Ga0070717_10077632
657 Ga0070717_10218211
658 Ga0070717_10232898
659 Ga0070717_10402700
660 Ga0070715_10012900
661 Ga0070716_100093712
662 Ga0070716_100140180
663 Ga0070712_100011537
664 Ga0070712_100096334
665 Ga0097621_100051472
666 Ga0097621_100303868
667 Ga0068871_100214193
668 Ga0075428_100453141
669 Ga0075433_10655545
670 Ga0075434_100078377
671 Ga0075434_100552763
672 Ga0075436_100011276
673 Ga0075436_100048527
674 Ga0097620_100033934
675 Ga0105240_10076753
676 Ga0105240_10830209
677 Ga0111539_10456025
678 Ga0105245_10033653
679 Ga0105247_10142634
680 Ga0114129_10003628
681 Ga0114129_10702303
682 Ga0105241_10042782
683 Ga0105241_10172801
684 Ga0105242_10656902
685 Ga0105237_10200551
686 Ga0105238_10841112
687 Ga0105249_10000764
688 Ga0105249_10001939
689 Ga0099796_10035915
690 Ga0105239_10009019
691 Ga0105239_10018654
692 Ga0105239_10108424
693 Ga0105239_10241000
694 Ga0105246_10152057
695 Ga0105246_10290394
696 Ga0157373_10148638
697 Ga0157370_10071717
698 Ga0157370_10188722
699 Ga0157369_10020613
700 Ga0157369_10039899
701 Ga0157374_10009134
702 Ga0157374_10019009
703 Ga0157374_10041100
704 Ga0157374_10147716
705 Ga0157378_10005114
706 Ga0157378_10006027
707 Ga0157378_10079660
708 Ga0157378_10278723
709 Ga0157378_10484344
710 Ga0163162_10069988
711 Ga0163162_10090723
712 Ga0163162_10138118
713 Ga0157372_10003056
714 Ga0157372_10104974
715 Ga0157372_10408388
716 Ga0157375_10001983
717 Ga0157375_10093910
718 Ga0157375_10206111
719 Ga0157375_10378712
720 Ga0182008_10010956
721 Ga0157376_10005882
722 Ga0157376_10030263
723 Ga0157376_10974092
724 Ga0182006_1010158
725 Ga0182005_1048143
726 Ga0163161_10126835
727 Ga0163161_10495558
728 Ga0163161_10530465
729 Ga0213875_10043327
730 Ga0207666_1000181
731 Ga0207673_1003574
732 Ga0207673_1004216
733 Ga0207697_10000141
734 Ga0207697_10000521
735 Ga0207697_10002550
736 Ga0207697_10004329
737 Ga0207697_10005413
738 Ga0207697_10217384
739 Ga0207692_10098452
740 Ga0207692_10246127
741 Ga0207680_10084731
742 Ga0207647_10010011
743 Ga0207699_10040988
744 Ga0207699_10256197
745 Ga0207645_10003893
746 Ga0207645_10387349
747 Ga0207684_10000052
748 Ga0207684_10003481
749 Ga0207684_10042597
750 Ga0207684_10063183
751 Ga0207684_10110589
752 Ga0207684_10117494
753 Ga0207684_10119500
754 Ga0207684_10137898
755 Ga0207684_10145531
756 Ga0207684_10155289
757 Ga0207684_10157151
758 Ga0207684_10418356
759 Ga0207654_10020609
760 Ga0207654_10127580
761 Ga0207707_10003117
762 Ga0207707_10042696
763 Ga0207695_10076413
764 Ga0207671_10122679
765 Ga0207693_10016748
766 Ga0207693_10029971
767 Ga0207693_10057152
768 Ga0207693_10619486
769 Ga0207663_10019941
770 Ga0207663_10148766
771 Ga0207660_10014089
772 Ga0207660_10184874
773 Ga0207662_10049312
774 Ga0207662_10171130
775 Ga0207657_10037905
776 Ga0207657_10082060
777 Ga0207657_10167661
778 Ga0207649_10037128
779 Ga0207652_10006887
780 Ga0207652_10068000
781 Ga0207646_10000317
782 Ga0207646_10009834
783 Ga0207646_10021163
784 Ga0207646_10027286
785 Ga0207646_10040345
786 Ga0207646_10059887
787 Ga0207646_10064085
788 Ga0207646_10134598
789 Ga0207646_10226031
790 Ga0207646_10264415
791 Ga0207646_10430390
792 Ga0207681_10002301
793 Ga0207659_10005840
794 Ga0207659_10008377
795 Ga0207659_10011958
796 Ga0207687_10088750
797 Ga0207700_10066639
798 Ga0207700_10166993
799 Ga0207664_10123960
800 Ga0207664_10136931
801 Ga0207690_10014426
802 Ga0207690_10060265
803 Ga0207706_10000900
804 Ga0207706_10062603
805 Ga0207706_10123210
806 Ga0207706_10471262
807 Ga0207670_10012506
808 Ga0207670_10024336
809 Ga0207670_10030021
810 Ga0207670_10276244
811 Ga0207669_10124484
812 Ga0207665_10020708
813 Ga0207665_10041470
814 Ga0207665_10067493
815 Ga0207665_10178048
816 Ga0207691_10114577
817 Ga0207691_10133609
818 Ga0207689_10032283
819 Ga0207661_10011749
820 Ga0207661_10044421
821 Ga0207661_10108007
822 Ga0207667_10461608
823 Ga0207651_10174131
824 Ga0207712_10018180
825 Ga0207712_10052585
826 Ga0207668_10010206
827 Ga0207668_10401751
828 Ga0207658_10003126
829 Ga0207658_10097722
830 Ga0207677_10038658
831 Ga0207677_10119444
832 Ga0207677_10164551
833 Ga0207703_10014572
834 Ga0207678_10028626
835 Ga0207678_10228172
836 Ga0207708_10013283
837 Ga0207641_10009767
838 Ga0207641_10324397
839 Ga0207641_10523446
840 Ga0207648_10140886
841 Ga0207676_10059081
842 Ga0207676_10140318
843 Ga0207675_100100495
844 Ga0207675_100164615
845 Ga0207683_10206399
846 Ga0268266_10020041
847 Ga0268266_10020684
848 Ga0268266_10163657
849 Ga0268264_10005799
850 Ga0268264_10619369
851 Ga0265332_10020064
852 Ga0265327_10079240
853 Ga0307414_10340983
854 Ga0307411_10405690
855 Ga0307415_100096152
856 Ga0316583_10067907
857 Ga0373959_0000139
858 Ga0373923_0076685
859 Ga0373945_0108019
860 Ga0373954_0299938
861 Ga0373956_0128258
862 Ga0373943_0045182
863 Ga0373943_0109320
864 Ga0373946_0071965
865 Ga0373946_0238624
866 Ga0373935_0002468
867 Ga0373947_0031746
868 Ga0373947_0036129
869 Ga0373947_0090786
870 Ga0373937_0108833
871 Ga0373937_0220521
872 Ga0373937_0366433
873 Ga0373937_0654941
874 Ga0373925_0032155
875 Ga0373925_0404676
876 Ga0395899_0093400
877 Ga0395900_0004886
878 Ga0395900_0117993
879 Ga0395900_0495783
880 Ga0395900_0546118
881 Ga0395900_0713328
882 Ga0395898_0003960
883 Ga0395898_0094317
884 Ga0395898_0315825
885 Ga0395905_0015181
886 Ga0395905_0570660
887 Ga0436364_1548325
888 Ga0395901_0005337
889 Ga0395901_0027721
890 Ga0395901_0037789
891 Ga0395901_0311268
892 Ga0395901_0408988
893 Ga0436363_0528150
894 Ga0451800_0403742
895 Ga0439455_0009613
896 Ga0439440_0061665
897 Ga0466969_0052867
898 Ga0466965_0058888
899 Ga0466961_0012234
900 Ga0451576_0047803
901 Ga0495592_0030219
902 Ga0495629_0243708
903 Ga0495651_0208292
904 Ga0495651_0291208
905 Ga0495653_0387031
906 Ga0495580_0425306
907 Ga0495664_0058256
908 Ga0495594_0145291
909 Ga0495608_0179742
910 Ga0495618_0179796
911 Ga0495628_0008439
912 Ga0495630_0188478
913 Ga0495643_0000178
914 Ga0495652_0271176
915 Ga0495640_0269192
916 Ga0495586_0079519
917 Ga0495587_0026645
918 Ga0495667_0148523
919 Ga0495634_0039577
920 Ga0495634_0122236
921 Ga0495635_0251309
922 Ga0495657_0175197
923 Ga0495613_0103107
924 Ga0495581_0154230
925 Ga0495604_0392007
926 Ga0495674_0090463
927 Ga0495676_0189423
928 Ga0495680_0331382
929 Ga0495675_0105710
930 Ga0495675_0160633
931 Ga0495684_0033489
932 Ga0495602_0022802
933 Ga0496100_0130722
934 Ga0496101_0050466
935 Ga0496102_0081786
936 Ga0496102_0816422
937 Ga0496103_0475231
938 Ga0496104_0093380
939 Ga0496104_0789088
940 Ga0496105_0025997
941 Ga0496105_0530863
942 Ga0496107_0098669
943 Ga0496108_0130844
944 Ga0496109_0002468
945 Ga0496109_0018214
946 Ga0496109_0048371
947 Ga0496109_0054202
948 Ga0496109_0290257
949 Ga0496110_0870403
950 Ga0496112_0044340
951 Ga0496112_0048860
952 Ga0496113_0107959
953 Ga0496114_0020687
954 Ga0496114_0199909
955 Ga0496114_0680872
956 Ga0496115_0001050
957 Ga0496115_0003638
958 Ga0496115_0006255
959 Ga0501033_0414539
960 Ga0501036_0129306
961 Ga0501046_0071013
962 Ga0501047_0058771
963 Ga0501067_0149790
964 Ga0501076_0260892
965 Ga0501081_0265525
966 nmdc:mga05p37_67787_c1
967 nmdc:mga08x19_16882_c1
968 Ga0495601_0006286
969 Ga0495595_0195880
970 Ga0500566_0204232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

1

210

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9271 2 226
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8977 2 226
6lyl-assembly1.cif.gz_A crystal structure of s1052d mutant of formylglycinamidine synthetase 0.8782 2 228
3ujn-assembly1.cif.gz_A formyl glycinamide ribonucleotide amidotransferase from salmonella typhimurium : role of the atp complexation and glutaminase domain in catalytic coupling 0.875 2 228
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8744 2 228
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9578 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9568 1 228 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9514 2 228 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9497 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9483 1 228 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1Q8BNV2-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9889 69 235 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A2V6F1K3-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9822 118 232 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A2V6K3U0-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9811 103 229 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A3B8UTD0-F1-model_v4 deleted 0.9804 90 231
AF-A0A533Y5Y1-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9795 148 238 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Map