F453057

General Info

Members Datasets Scaffolds Average Seq Length
485 220 970 171

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100360233|Ga0070713_1003602332
Length 189
Sequence MTLIDRRGSLHYRGTMLSKNSRIIRHLSLFCLAAAAIPAFAQTDMKTIVLKHLKTSRDFSLKVAGQMPEASYNFKLTPPQMSFAEQMVHISQSMAAILAPFSNSKPNMAKPASMDKKDVIAFMQKSYDGAIDQISKLTPDQLSKTYSGGEGTMSGMEILMFVLDHSTHHRASAEMYLRAKGITPTEYEF

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 29.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100360233 3300005436 Bacteria 1351
2 MBSR1b_contig_5472176 2162886012 Unclassified 848
3 JGI24035J26624_1027838 3300002126 Unclassified 610
4 Ga0065715_10076238 3300005293 Unclassified 565
5 Ga0065715_10121950 3300005293 Bacteria 2217
6 Ga0065715_10228854 3300005293 Bacteria 1241
7 Ga0065707_10180299 3300005295 Bacteria 1423
8 Ga0065707_10269189 3300005295 Bacteria 1076
9 Ga0070658_10455692 3300005327 Bacteria 1102
10 Ga0070676_10070374 3300005328 Bacteria 2098
11 Ga0070683_100017554 3300005329 Bacteria 6326
12 Ga0070683_100021932 3300005329 Bacteria 5701
13 Ga0070690_100008464 3300005330 Bacteria 5926
14 Ga0070690_100108227 3300005330 Bacteria 1851
15 Ga0070670_100137019 3300005331 Unclassified 2115
16 Ga0070670_100666922 3300005331 Bacteria 934
17 Ga0070677_10010305 3300005333 Unclassified 3193
18 Ga0068869_100054590 3300005334 Bacteria 2909
19 Ga0068869_100362961 3300005334 Unclassified 1183
20 Ga0070680_100011921 3300005336 Bacteria 6744
21 Ga0068868_100013570 3300005338 Bacteria 5979
22 Ga0070660_100102276 3300005339 Bacteria 2271
23 Ga0070660_100853645 3300005339 Unclassified 767
24 Ga0070689_100039754 3300005340 Bacteria 3603
25 Ga0070689_100092201 3300005340 Unclassified 2389
26 Ga0070689_100099307 3300005340 Bacteria 2303
27 Ga0070691_10019853 3300005341 Bacteria 3102
28 Ga0070687_100011530 3300005343 Bacteria 3869
29 Ga0070661_100055814 3300005344 Bacteria 2892
30 Ga0070661_100125848 3300005344 Unclassified 1922
31 Ga0070692_10282613 3300005345 Unclassified 1006
32 Ga0070692_10534979 3300005345 Bacteria 765
33 Ga0070669_100024198 3300005353 Bacteria 4353
34 Ga0070669_100132099 3300005353 Bacteria 1916
35 Ga0070675_100182212 3300005354 Bacteria 1816
36 Ga0070675_100231384 3300005354 Bacteria 1612
37 Ga0070675_100539117 3300005354 Unclassified 1054
38 Ga0070675_101383096 3300005354 Bacteria 649
39 Ga0070671_100037828 3300005355 Bacteria 4004
40 Ga0070671_100578952 3300005355 Unclassified 969
41 Ga0070674_100016860 3300005356 Bacteria 4583
42 Ga0070673_100288118 3300005364 Bacteria 1442
43 Ga0070673_100378447 3300005364 Bacteria 1262
44 Ga0070673_100540653 3300005364 Unclassified 1057
45 Ga0070673_101075030 3300005364 Bacteria 751
46 Ga0070688_100299274 3300005365 Unclassified 1162
47 Ga0070688_100390031 3300005365 Unclassified 1028
48 Ga0070709_10747581 3300005434 Bacteria 764
49 Ga0070713_100094484 3300005436 Unclassified 2578
50 Ga0070713_100111442 3300005436 Bacteria 2386
51 Ga0070713_100240018 3300005436 Unclassified 1650
52 Ga0070713_100561117 3300005436 Unclassified 1082
53 Ga0070701_10012185 3300005438 Bacteria 3870
54 Ga0070711_100408150 3300005439 Bacteria 1104
55 Ga0070705_100201155 3300005440 Bacteria 1366
56 Ga0070700_100353716 3300005441 Unclassified 1090
57 Ga0070694_100019037 3300005444 Bacteria 4363
58 Ga0070678_100021982 3300005456 Bacteria 4216
59 Ga0070678_100085672 3300005456 Unclassified 2401
60 Ga0070678_100490673 3300005456 Unclassified 1082
61 Ga0070662_100200974 3300005457 Bacteria 1581
62 Ga0070681_10019443 3300005458 Bacteria 6798
63 Ga0068867_100006098 3300005459 Bacteria 8533
64 Ga0068867_101470584 3300005459 Unclassified 634
65 Ga0068867_101729858 3300005459 Unclassified 587
66 Ga0070707_100996142 3300005468 Unclassified 803
67 Ga0070699_100269686 3300005518 Bacteria 1523
68 Ga0070679_100006875 3300005530 Bacteria 10609
69 Ga0070684_100000896 3300005535 Bacteria 21078
70 Ga0070684_100028774 3300005535 Bacteria 4702
71 Ga0070684_100032657 3300005535 Bacteria 4438
72 Ga0070684_100061590 3300005535 Unclassified 3284
73 Ga0068853_100005709 3300005539 Bacteria 9789
74 Ga0070672_100035087 3300005543 Bacteria 3810
75 Ga0070672_100044958 3300005543 Unclassified 3413
76 Ga0070686_100004785 3300005544 Bacteria 7475
77 Ga0070686_100806565 3300005544 Unclassified 757
78 Ga0070686_100961653 3300005544 Unclassified 698
79 Ga0070693_100329734 3300005547 Bacteria 1038
80 Ga0070693_100801340 3300005547 Bacteria 698
81 Ga0070665_100035780 3300005548 Bacteria 4995
82 Ga0070665_101004946 3300005548 Unclassified 846
83 Ga0070704_100324120 3300005549 Bacteria 1292
84 Ga0068855_100002190 3300005563 Bacteria 24156
85 Ga0068855_100007763 3300005563 Bacteria 12956
86 Ga0068855_100131963 3300005563 Bacteria 2852
87 Ga0070664_100245929 3300005564 Bacteria 1607
88 Ga0070664_101156999 3300005564 Bacteria 729
89 Ga0068857_100004374 3300005577 Bacteria 11938
90 Ga0068857_101368084 3300005577 Unclassified 688
91 Ga0068854_100461358 3300005578 Unclassified 1063
92 Ga0068854_101324437 3300005578 Unclassified 649
93 Ga0068856_100001477 3300005614 Bacteria 24623
94 Ga0068856_100005705 3300005614 Bacteria 12261
95 Ga0068856_100067787 3300005614 Bacteria 3527
96 Ga0068856_100145479 3300005614 Bacteria 2378
97 Ga0068856_100324535 3300005614 Bacteria 1557
98 Ga0068856_100552891 3300005614 Unclassified 1172
99 Ga0070702_100206336 3300005615 Bacteria 1305
100 Ga0070702_100471460 3300005615 Bacteria 915
101 Ga0068852_100023869 3300005616 Bacteria 4932
102 Ga0068852_100955744 3300005616 Unclassified 875
103 Ga0068859_100049199 3300005617 Bacteria 4234
104 Ga0068859_100270693 3300005617 Bacteria 1791
105 Ga0068859_100433726 3300005617 Unclassified 1410
106 Ga0068859_101248346 3300005617 Unclassified 819
107 Ga0068864_100088960 3300005618 Bacteria 2720
108 Ga0068864_100555227 3300005618 Bacteria 1110
109 Ga0068866_10097528 3300005718 Bacteria 1615
110 Ga0068861_100207513 3300005719 Unclassified 1648
111 Ga0068851_10861438 3300005834 Unclassified 566
112 Ga0068870_10042381 3300005840 Unclassified 2370
113 Ga0068870_10073317 3300005840 Bacteria 1872
114 Ga0068863_100014694 3300005841 Bacteria 7536
115 Ga0068863_100658546 3300005841 Bacteria 1039
116 Ga0068858_100018531 3300005842 Bacteria 6517
117 Ga0068858_100126346 3300005842 Bacteria 2395
118 Ga0068858_100189374 3300005842 Bacteria 1944
119 Ga0068858_100423782 3300005842 Unclassified 1280
120 Ga0068860_100022201 3300005843 Bacteria 6144
121 Ga0068860_101333395 3300005843 Unclassified 738
122 Ga0068862_100001318 3300005844 Bacteria 23064
123 Ga0068862_100440943 3300005844 Unclassified 1226
124 Ga0075432_10327226 3300006058 Unclassified 643
125 Ga0070715_10257871 3300006163 Bacteria 914
126 Ga0097621_100007227 3300006237 Bacteria 7927
127 Ga0097621_100014049 3300006237 Bacteria 5983
128 Ga0097621_100061328 3300006237 Bacteria 3084
129 Ga0097621_100064455 3300006237 Bacteria 3013
130 Ga0097621_100101640 3300006237 Bacteria 2419
131 Ga0097621_100128952 3300006237 Unclassified 2151
132 Ga0097621_100140375 3300006237 Bacteria 2064
133 Ga0097621_100222343 3300006237 Unclassified 1646
134 Ga0097621_101801471 3300006237 Unclassified 584
135 Ga0068871_100001795 3300006358 Bacteria 14473
136 Ga0068871_100033597 3300006358 Unclassified 4064
137 Ga0068871_100081480 3300006358 Bacteria 2681
138 Ga0068871_100161447 3300006358 Unclassified 1917
139 Ga0068871_100208666 3300006358 Unclassified 1689
140 Ga0068871_100314543 3300006358 Bacteria 1377
141 Ga0068871_100445087 3300006358 Bacteria 1160
142 Ga0068871_100973119 3300006358 Unclassified 789
143 Ga0068871_101393545 3300006358 Unclassified 661
144 Ga0075430_100146025 3300006846 Bacteria 1970
145 Ga0075431_100874420 3300006847 Unclassified 869
146 Ga0075433_10004312 3300006852 Bacteria 11044
147 Ga0075434_100007944 3300006871 Bacteria 9834
148 Ga0075434_100496098 3300006871 Bacteria 1242
149 Ga0075429_100053142 3300006880 Bacteria 3525
150 Ga0068865_100092377 3300006881 Unclassified 2198
151 Ga0068865_100180649 3300006881 Unclassified 1625
152 Ga0097620_100049195 3300006931 Bacteria 4234
153 Ga0097620_100270670 3300006931 Bacteria 1791
154 Ga0097620_100433730 3300006931 Unclassified 1410
155 Ga0097620_101248310 3300006931 Unclassified 819
156 Ga0075435_100061515 3300007076 Bacteria 3046
157 Ga0075435_100077382 3300007076 Unclassified 2727
158 Ga0105240_10008912 3300009093 Bacteria 14272
159 Ga0105240_10052766 3300009093 Bacteria 5109
160 Ga0105240_10143930 3300009093 Bacteria 2847
161 Ga0105240_10355282 3300009093 Bacteria 1661
162 Ga0111539_10009213 3300009094 Bacteria 12476
163 Ga0111539_10494485 3300009094 Unclassified 1425
164 Ga0111539_11268853 3300009094 Bacteria 855
165 Ga0105245_10005015 3300009098 Bacteria 11637
166 Ga0105245_10011107 3300009098 Bacteria 7839
167 Ga0105245_10022023 3300009098 Bacteria 5593
168 Ga0105245_10050393 3300009098 Bacteria 3732
169 Ga0105245_10097060 3300009098 Bacteria 2721
170 Ga0105245_10171413 3300009098 Bacteria 2067
171 Ga0105245_10537369 3300009098 Bacteria 1190
172 Ga0105245_11108302 3300009098 Bacteria 838
173 Ga0105245_12016510 3300009098 Bacteria 630
174 Ga0105247_10050586 3300009101 Bacteria 2557
175 Ga0105243_10195513 3300009148 Bacteria 1770
176 Ga0105241_10023381 3300009174 Bacteria 4583
177 Ga0105241_10034007 3300009174 Bacteria 3828
178 Ga0105241_10062756 3300009174 Bacteria 2865
179 Ga0105241_10065179 3300009174 Unclassified 2814
180 Ga0105242_10031057 3300009176 Bacteria 4265
181 Ga0105242_10035503 3300009176 Unclassified 3997
182 Ga0105242_10086836 3300009176 Bacteria 2626
183 Ga0105242_10199013 3300009176 Unclassified 1778
184 Ga0105242_10256125 3300009176 Bacteria 1579
185 Ga0105248_10002427 3300009177 Bacteria 20684
186 Ga0105248_10015004 3300009177 Bacteria 8530
187 Ga0105248_10019966 3300009177 Bacteria 7418
188 Ga0105248_10068096 3300009177 Bacteria 3997
189 Ga0105237_10001317 3300009545 Bacteria 32923
190 Ga0105237_10024993 3300009545 Bacteria 6111
191 Ga0105237_10083555 3300009545 Bacteria 3184
192 Ga0105237_10374186 3300009545 Bacteria 1429
193 Ga0105237_10416404 3300009545 Unclassified 1349
194 Ga0105237_10551787 3300009545 Bacteria 1159
195 Ga0105237_11144067 3300009545 Unclassified 785
196 Ga0105237_11450651 3300009545 Unclassified 693
197 Ga0105238_10008673 3300009551 Bacteria 10171
198 Ga0105238_10052385 3300009551 Bacteria 4102
199 Ga0105238_10096540 3300009551 Unclassified 2942
200 Ga0105238_10104379 3300009551 Bacteria 2815
201 Ga0105238_10116351 3300009551 Bacteria 2653
202 Ga0105249_10013555 3300009553 Bacteria 7200
203 Ga0105239_10003048 3300010375 Bacteria 20831
204 Ga0105239_10042185 3300010375 Bacteria 4999
205 Ga0105239_10053806 3300010375 Bacteria 4414
206 Ga0105239_10226984 3300010375 Unclassified 2095
207 Ga0105239_10371442 3300010375 Bacteria 1616
208 Ga0105239_10476470 3300010375 Unclassified 1418
209 Ga0105246_10003902 3300011119 Bacteria 9033
210 Ga0105246_10027514 3300011119 Bacteria 3727
211 Ga0157370_10028274 3300013104 Bacteria 5518
212 Ga0157370_10070296 3300013104 Bacteria 3304
213 Ga0157369_10002275 3300013105 Bacteria 23100
214 Ga0157369_10002738 3300013105 Bacteria 21047
215 Ga0157369_10508078 3300013105 Bacteria 1247
216 Ga0157374_10024250 3300013296 Bacteria 5435
217 Ga0157374_10148513 3300013296 Bacteria 2278
218 Ga0157374_10354553 3300013296 Unclassified 1458
219 Ga0157374_10541776 3300013296 Unclassified 1171
220 Ga0157374_10895315 3300013296 Unclassified 905
221 Ga0157374_11087457 3300013296 Unclassified 820
222 Ga0157374_11718928 3300013296 Unclassified 652
223 Ga0157378_10003262 3300013297 Bacteria 14422
224 Ga0157378_10006667 3300013297 Bacteria 10088
225 Ga0157378_10328613 3300013297 Unclassified 1487
226 Ga0157378_10480826 3300013297 Unclassified 1237
227 Ga0157378_10644965 3300013297 Bacteria 1074
228 Ga0163162_10081630 3300013306 Bacteria 3304
229 Ga0163162_10359235 3300013306 Bacteria 1589
230 Ga0163162_10498238 3300013306 Bacteria 1349
231 Ga0163162_11382532 3300013306 Bacteria 801
232 Ga0163162_11770542 3300013306 Unclassified 706
233 Ga0157372_10019605 3300013307 Bacteria 7289
234 Ga0157372_10037835 3300013307 Bacteria 5323
235 Ga0157372_10072918 3300013307 Bacteria 3869
236 Ga0157375_10008895 3300013308 Bacteria 8789
237 Ga0157375_10082062 3300013308 Bacteria 3265
238 Ga0157375_10148700 3300013308 Unclassified 2476
239 Ga0157375_10233136 3300013308 Bacteria 2000
240 Ga0157375_10430976 3300013308 Bacteria 1484
241 Ga0157375_10471476 3300013308 Unclassified 1421
242 Ga0157375_10917120 3300013308 Unclassified 1019
243 Ga0157375_10976983 3300013308 Bacteria 987
244 Ga0163163_10008800 3300014325 Bacteria 8985
245 Ga0163163_10132012 3300014325 Unclassified 2538
246 Ga0163163_11029670 3300014325 Bacteria 887
247 Ga0157380_10037008 3300014326 Bacteria 3780
248 Ga0157380_11405975 3300014326 Unclassified 748
249 Ga0157377_10013748 3300014745 Bacteria 4103
250 Ga0157377_10502560 3300014745 Unclassified 847
251 Ga0157379_10003010 3300014968 Bacteria 14229
252 Ga0157379_10124281 3300014968 Unclassified 2321
253 Ga0157379_10340403 3300014968 Bacteria 1372
254 Ga0157379_10474989 3300014968 Bacteria 1157
255 Ga0157379_10628568 3300014968 Bacteria 1004
256 Ga0157376_10059103 3300014969 Bacteria 3214
257 Ga0157376_10117041 3300014969 Unclassified 2356
258 Ga0157376_10229756 3300014969 Bacteria 1723
259 Ga0157376_11055199 3300014969 Bacteria 837
260 Ga0163161_10033476 3300017792 Bacteria 3673
261 Ga0213873_10043524 3300021358 Unclassified 1165
262 Ga0213873_10076430 3300021358 Unclassified 930
263 Ga0213872_10000315 3300021361 Bacteria 41197
264 Ga0213874_10001369 3300021377 Bacteria 5039
265 Ga0213876_10022361 3300021384 Bacteria 3344
266 Ga0213875_10012264 3300021388 Bacteria 4239
267 Ga0213875_10013435 3300021388 Bacteria 4021
268 Ga0213875_10065073 3300021388 Bacteria 1704
269 Ga0213875_10080246 3300021388 Bacteria 1522
270 Ga0213875_10092653 3300021388 Bacteria 1409
271 Ga0213875_10165862 3300021388 Bacteria 1037
272 Ga0213871_10003092 3300021441 Bacteria 3163
273 Ga0207697_10012850 3300025315 Bacteria 3502
274 Ga0207697_10063443 3300025315 Unclassified 1540
275 Ga0207682_10000492 3300025893 Bacteria 18262
276 Ga0207682_10025077 3300025893 Unclassified 2364
277 Ga0207710_10069243 3300025900 Bacteria 1615
278 Ga0207688_10000727 3300025901 Bacteria 16326
279 Ga0207688_10075107 3300025901 Bacteria 1923
280 Ga0207647_10074245 3300025904 Unclassified 2048
281 Ga0207699_10581063 3300025906 Bacteria 815
282 Ga0207645_10002485 3300025907 Bacteria 14467
283 Ga0207643_10001159 3300025908 Bacteria 15659
284 Ga0207643_10053992 3300025908 Unclassified 2283
285 Ga0207705_10258666 3300025909 Bacteria 1329
286 Ga0207654_10033389 3300025911 Bacteria 2852
287 Ga0207654_10062076 3300025911 Unclassified 2188
288 Ga0207654_10117761 3300025911 Bacteria 1663
289 Ga0207654_10487297 3300025911 Unclassified 869
290 Ga0207654_11063634 3300025911 Unclassified 589
291 Ga0207707_10000761 3300025912 Bacteria 31771
292 Ga0207707_10015549 3300025912 Bacteria 6628
293 Ga0207707_10235519 3300025912 Bacteria 1593
294 Ga0207695_10002495 3300025913 Bacteria 27107
295 Ga0207695_10004086 3300025913 Bacteria 20051
296 Ga0207695_10102945 3300025913 Bacteria 2847
297 Ga0207695_10159457 3300025913 Bacteria 2188
298 Ga0207671_10267636 3300025914 Unclassified 1346
299 Ga0207671_10494273 3300025914 Unclassified 975
300 Ga0207663_10049978 3300025916 Bacteria 2597
301 Ga0207660_10131885 3300025917 Bacteria 1903
302 Ga0207662_10068160 3300025918 Bacteria 2148
303 Ga0207657_10100390 3300025919 Bacteria 2403
304 Ga0207657_10452936 3300025919 Unclassified 1007
305 Ga0207649_10148675 3300025920 Bacteria 1611
306 Ga0207649_10517591 3300025920 Unclassified 909
307 Ga0207649_11159935 3300025920 Unclassified 610
308 Ga0207652_10001347 3300025921 Bacteria 21814
309 Ga0207646_10767984 3300025922 Unclassified 860
310 Ga0207681_10007135 3300025923 Bacteria 6851
311 Ga0207681_10227075 3300025923 Unclassified 1447
312 Ga0207681_10334468 3300025923 Bacteria 1208
313 Ga0207681_10528903 3300025923 Bacteria 968
314 Ga0207681_10675451 3300025923 Unclassified 857
315 Ga0207694_10000953 3300025924 Bacteria 25560
316 Ga0207694_10013230 3300025924 Bacteria 6212
317 Ga0207694_10062148 3300025924 Unclassified 2907
318 Ga0207694_10155737 3300025924 Bacteria 1843
319 Ga0207650_10122169 3300025925 Bacteria 2029
320 Ga0207650_11064513 3300025925 Unclassified 688
321 Ga0207659_10405375 3300025926 Unclassified 1141
322 Ga0207659_11086842 3300025926 Unclassified 688
323 Ga0207687_10004364 3300025927 Bacteria 9437
324 Ga0207687_10010285 3300025927 Bacteria 6113
325 Ga0207687_10027930 3300025927 Bacteria 3788
326 Ga0207687_10252973 3300025927 Bacteria 1401
327 Ga0207687_10736054 3300025927 Bacteria 838
328 Ga0207700_10227045 3300025928 Bacteria 1586
329 Ga0207700_10299797 3300025928 Bacteria 1388
330 Ga0207700_10682665 3300025928 Bacteria 916
331 Ga0207664_10357534 3300025929 Bacteria 1293
332 Ga0207664_10851762 3300025929 Unclassified 819
333 Ga0207644_10502800 3300025931 Unclassified 1000
334 Ga0207706_10023960 3300025933 Bacteria 5476
335 Ga0207706_10115626 3300025933 Bacteria 2359
336 Ga0207706_10283334 3300025933 Bacteria 1445
337 Ga0207686_10009467 3300025934 Bacteria 5287
338 Ga0207709_10079185 3300025935 Bacteria 2112
339 Ga0207709_10210587 3300025935 Unclassified 1395
340 Ga0207670_10092503 3300025936 Bacteria 2140
341 Ga0207704_10164923 3300025938 Unclassified 1581
342 Ga0207691_10006460 3300025940 Bacteria 11327
343 Ga0207691_10040401 3300025940 Bacteria 4310
344 Ga0207711_10006203 3300025941 Bacteria 10101
345 Ga0207711_10006402 3300025941 Bacteria 9925
346 Ga0207711_10064739 3300025941 Bacteria 3158
347 Ga0207711_11621991 3300025941 Unclassified 590
348 Ga0207711_11726501 3300025941 Unclassified 569
349 Ga0207689_10001107 3300025942 Bacteria 25998
350 Ga0207689_10348386 3300025942 Bacteria 1231
351 Ga0207689_10367121 3300025942 Unclassified 1197
352 Ga0207661_10009833 3300025944 Bacteria 6869
353 Ga0207661_10129499 3300025944 Bacteria 2159
354 Ga0207661_10143682 3300025944 Bacteria 2056
355 Ga0207661_11224887 3300025944 Unclassified 690
356 Ga0207679_10009412 3300025945 Bacteria 6260
357 Ga0207679_10623065 3300025945 Bacteria 974
358 Ga0207667_10001913 3300025949 Bacteria 26146
359 Ga0207667_10016994 3300025949 Bacteria 8207
360 Ga0207667_10018865 3300025949 Bacteria 7718
361 Ga0207651_10065694 3300025960 Bacteria 2545
362 Ga0207651_10571486 3300025960 Bacteria 985
363 Ga0207712_10049499 3300025961 Unclassified 2928
364 Ga0207668_10034287 3300025972 Bacteria 3370
365 Ga0207677_10205459 3300026023 Bacteria 1569
366 Ga0207703_10197347 3300026035 Bacteria 1786
367 Ga0207703_10636286 3300026035 Unclassified 1011
368 Ga0207703_11363004 3300026035 Unclassified 682
369 Ga0207639_10006562 3300026041 Bacteria 7912
370 Ga0207639_10082096 3300026041 Bacteria 2555
371 Ga0207678_10309550 3300026067 Bacteria 1358
372 Ga0207708_10032354 3300026075 Bacteria 3972
373 Ga0207702_10011734 3300026078 Bacteria 7298
374 Ga0207702_10069131 3300026078 Bacteria 3036
375 Ga0207702_11602276 3300026078 Unclassified 644
376 Ga0207641_10111676 3300026088 Bacteria 2424
377 Ga0207641_10671291 3300026088 Bacteria 1019
378 Ga0207648_10008815 3300026089 Bacteria 9715
379 Ga0207648_10241976 3300026089 Bacteria 1607
380 Ga0207676_10513819 3300026095 Unclassified 1139
381 Ga0207674_10000682 3300026116 Bacteria 44093
382 Ga0207674_10353086 3300026116 Bacteria 1421
383 Ga0207674_10375111 3300026116 Unclassified 1375
384 Ga0207674_11075571 3300026116 Unclassified 774
385 Ga0207675_100012882 3300026118 Bacteria 7813
386 Ga0207675_100090401 3300026118 Unclassified 2879
387 Ga0207675_100456484 3300026118 Bacteria 1267
388 Ga0207683_10069132 3300026121 Unclassified 3119
389 Ga0207683_10078602 3300026121 Bacteria 2924
390 Ga0207698_10008302 3300026142 Bacteria 6558
391 Ga0209998_10055246 3300027717 Unclassified 926
392 Ga0207428_10003783 3300027907 Bacteria 14518
393 Ga0268266_10015171 3300028379 Bacteria 6615
394 Ga0268265_10096287 3300028380 Bacteria 2378
395 Ga0268265_10209403 3300028380 Bacteria 1698
396 Ga0268264_10283549 3300028381 Unclassified 1553
397 Ga0268264_10456349 3300028381 Unclassified 1239
398 Ga0265338_10196857 3300028800 Bacteria 1523
399 Ga0265332_10022601 3300031238 Unclassified 2775
400 Ga0265340_10039360 3300031247 Bacteria 2334
401 Ga0265316_10129500 3300031344 Unclassified 1902
402 Ga0265314_10001232 3300031711 Bacteria 29204
403 Ga0265314_10127373 3300031711 Unclassified 1593
404 Ga0373934_0000928 3300035086 Bacteria 10605
405 Ga0373934_0028387 3300035086 Bacteria 2180
406 Ga0373934_0193611 3300035086 Bacteria 836
407 Ga0373923_0283241 3300035111 Unclassified 781
408 Ga0373939_0259658 3300035114 Unclassified 679
409 Ga0373953_0136644 3300035117 Bacteria 1047
410 Ga0373954_0002995 3300035118 Bacteria 7123
411 Ga0373956_0047313 3300035119 Bacteria 1924
412 Ga0373957_0306447 3300035120 Bacteria 674
413 Ga0373955_0220747 3300035172 Bacteria 1132
414 Ga0373955_0230902 3300035172 Bacteria 1107
415 Ga0373955_0234677 3300035172 Unclassified 1098
416 Ga0373924_0113821 3300035410 Bacteria 1171
417 Ga0373935_0272219 3300035692 Bacteria 1190
418 Ga0373927_0172962 3300035695 Bacteria 1416
419 Ga0373933_0026618 3300035724 Bacteria 3323
420 Ga0373933_0036882 3300035724 Unclassified 2865
421 Ga0373937_0019522 3300036401 Bacteria 6065
422 Ga0373937_0168218 3300036401 Bacteria 2056
423 Ga0373937_0179754 3300036401 Bacteria 1986
424 Ga0373937_0582893 3300036401 Unclassified 1062
425 Ga0373937_1127402 3300036401 Unclassified 733
426 Ga0373925_0070171 3300037068 Bacteria 2648
427 Ga0373925_0322254 3300037068 Viruses 1251
428 Ga0436364_0356229 3300037853 Bacteria 15943
429 Ga0436364_0713301 3300037853 Bacteria 1487
430 Ga0436364_0755318 3300037853 Bacteria 1037
431 Ga0436364_0787827 3300037853 Bacteria 12605
432 Ga0436364_1128605 3300037853 Bacteria 48889
433 Ga0436364_1455492 3300037853 Bacteria 2392
434 Ga0436365_0230171 3300039437 Bacteria 2318
435 Ga0436365_0522788 3300039437 Bacteria 3540
436 Ga0436365_0912888 3300039437 Bacteria 3251
437 Ga0436365_1041088 3300039437 Unclassified 876
438 Ga0436360_0437733 3300039438 Bacteria 8911
439 Ga0436361_1020706 3300039447 Bacteria 66534
440 Ga0436363_0033107 3300039450 Bacteria 1886
441 Ga0436363_0046554 3300039450 Bacteria 872
442 Ga0436363_1596932 3300039450 Bacteria 4514
443 Ga0436362_0055550 3300039453 Unclassified 697
444 Ga0436362_0389385 3300039453 Unclassified 1294
445 Ga0436362_0660779 3300039453 Bacteria 5300
446 Ga0436362_0701711 3300039453 Bacteria 787
447 Ga0439464_0168004 3300042439 Unclassified 691
448 Ga0466969_0262237 3300044656 Unclassified 783
449 Ga0451576_0201874 3300045051 Bacteria 2076
450 Ga0495651_0169594 3300046462 Bacteria 1556
451 Ga0495651_0225858 3300046462 Bacteria 1293
452 Ga0495651_0325000 3300046462 Bacteria 1024
453 Ga0495580_0016895 3300046472 Bacteria 5470
454 Ga0495580_0045433 3300046472 Bacteria 3120
455 Ga0495580_0224980 3300046472 Bacteria 1289
456 Ga0495580_0821056 3300046472 Unclassified 602
457 Ga0495582_0275556 3300046473 Bacteria 966
458 Ga0495594_0520666 3300046499 Unclassified 675
459 Ga0495608_0093545 3300046511 Bacteria 1942
460 Ga0495652_0198666 3300046529 Bacteria 1524
461 Ga0495587_0001707 3300046536 Bacteria 14667
462 Ga0495587_0055334 3300046536 Unclassified 2337
463 Ga0495587_0212242 3300046536 Unclassified 1093
464 Ga0495645_0067700 3300046543 Bacteria 2579
465 Ga0495635_0277999 3300046663 Bacteria 1125
466 Ga0495647_0119520 3300046681 Bacteria 1107
467 Ga0495669_0074951 3300046684 Bacteria 1547
468 Ga0495674_0184087 3300047319 Bacteria 1738
469 Ga0495680_0208093 3300047322 Bacteria 1401
470 Ga0495602_0120617 3300048088 Bacteria 2110
471 Ga0495602_0482909 3300048088 Bacteria 869
472 Ga0496104_0427801 3300048907 Bacteria 1236
473 Ga0496109_0080023 3300048912 Bacteria 3011
474 Ga0496114_0639038 3300048917 Unclassified 937
475 Ga0496115_0183658 3300048918 Unclassified 1728
476 nmdc:mga06r32_327045_c1 3300050510 Bacteria 1518
477 nmdc:mga08y16_78588_c1 3300050511 Bacteria 3440
478 nmdc:mga0n895_325264_c1 3300050512 Bacteria 1558
479 nmdc:mga0n895_5514_c1 3300050512 Bacteria 10593
480 nmdc:mga0rr50_54732_c1 3300050513 Bacteria 2974
481 nmdc:mga0rr50_99720_c1 3300050513 Bacteria 2279
482 nmdc:mga08x19_158678_c1 3300050514 Unclassified 1535
483 nmdc:mga08x19_277684_c1 3300050514 Bacteria 1160
484 nmdc:mga0a205_550_c1 3300050515 Bacteria 24226
485 Ga0466962_0181867 3300061719 Bacteria 1025
486 Ga0070713_100360233
487 MBSR1b_contig_5472176
488 JGI24035J26624_1027838
489 Ga0065715_10076238
490 Ga0065715_10121950
491 Ga0065715_10228854
492 Ga0065707_10180299
493 Ga0065707_10269189
494 Ga0070658_10455692
495 Ga0070676_10070374
496 Ga0070683_100017554
497 Ga0070683_100021932
498 Ga0070690_100008464
499 Ga0070690_100108227
500 Ga0070670_100137019
501 Ga0070670_100666922
502 Ga0070677_10010305
503 Ga0068869_100054590
504 Ga0068869_100362961
505 Ga0070680_100011921
506 Ga0068868_100013570
507 Ga0070660_100102276
508 Ga0070660_100853645
509 Ga0070689_100039754
510 Ga0070689_100092201
511 Ga0070689_100099307
512 Ga0070691_10019853
513 Ga0070687_100011530
514 Ga0070661_100055814
515 Ga0070661_100125848
516 Ga0070692_10282613
517 Ga0070692_10534979
518 Ga0070669_100024198
519 Ga0070669_100132099
520 Ga0070675_100182212
521 Ga0070675_100231384
522 Ga0070675_100539117
523 Ga0070675_101383096
524 Ga0070671_100037828
525 Ga0070671_100578952
526 Ga0070674_100016860
527 Ga0070673_100288118
528 Ga0070673_100378447
529 Ga0070673_100540653
530 Ga0070673_101075030
531 Ga0070688_100299274
532 Ga0070688_100390031
533 Ga0070709_10747581
534 Ga0070713_100094484
535 Ga0070713_100111442
536 Ga0070713_100240018
537 Ga0070713_100561117
538 Ga0070701_10012185
539 Ga0070711_100408150
540 Ga0070705_100201155
541 Ga0070700_100353716
542 Ga0070694_100019037
543 Ga0070678_100021982
544 Ga0070678_100085672
545 Ga0070678_100490673
546 Ga0070662_100200974
547 Ga0070681_10019443
548 Ga0068867_100006098
549 Ga0068867_101470584
550 Ga0068867_101729858
551 Ga0070707_100996142
552 Ga0070699_100269686
553 Ga0070679_100006875
554 Ga0070684_100000896
555 Ga0070684_100028774
556 Ga0070684_100032657
557 Ga0070684_100061590
558 Ga0068853_100005709
559 Ga0070672_100035087
560 Ga0070672_100044958
561 Ga0070686_100004785
562 Ga0070686_100806565
563 Ga0070686_100961653
564 Ga0070693_100329734
565 Ga0070693_100801340
566 Ga0070665_100035780
567 Ga0070665_101004946
568 Ga0070704_100324120
569 Ga0068855_100002190
570 Ga0068855_100007763
571 Ga0068855_100131963
572 Ga0070664_100245929
573 Ga0070664_101156999
574 Ga0068857_100004374
575 Ga0068857_101368084
576 Ga0068854_100461358
577 Ga0068854_101324437
578 Ga0068856_100001477
579 Ga0068856_100005705
580 Ga0068856_100067787
581 Ga0068856_100145479
582 Ga0068856_100324535
583 Ga0068856_100552891
584 Ga0070702_100206336
585 Ga0070702_100471460
586 Ga0068852_100023869
587 Ga0068852_100955744
588 Ga0068859_100049199
589 Ga0068859_100270693
590 Ga0068859_100433726
591 Ga0068859_101248346
592 Ga0068864_100088960
593 Ga0068864_100555227
594 Ga0068866_10097528
595 Ga0068861_100207513
596 Ga0068851_10861438
597 Ga0068870_10042381
598 Ga0068870_10073317
599 Ga0068863_100014694
600 Ga0068863_100658546
601 Ga0068858_100018531
602 Ga0068858_100126346
603 Ga0068858_100189374
604 Ga0068858_100423782
605 Ga0068860_100022201
606 Ga0068860_101333395
607 Ga0068862_100001318
608 Ga0068862_100440943
609 Ga0075432_10327226
610 Ga0070715_10257871
611 Ga0097621_100007227
612 Ga0097621_100014049
613 Ga0097621_100061328
614 Ga0097621_100064455
615 Ga0097621_100101640
616 Ga0097621_100128952
617 Ga0097621_100140375
618 Ga0097621_100222343
619 Ga0097621_101801471
620 Ga0068871_100001795
621 Ga0068871_100033597
622 Ga0068871_100081480
623 Ga0068871_100161447
624 Ga0068871_100208666
625 Ga0068871_100314543
626 Ga0068871_100445087
627 Ga0068871_100973119
628 Ga0068871_101393545
629 Ga0075430_100146025
630 Ga0075431_100874420
631 Ga0075433_10004312
632 Ga0075434_100007944
633 Ga0075434_100496098
634 Ga0075429_100053142
635 Ga0068865_100092377
636 Ga0068865_100180649
637 Ga0097620_100049195
638 Ga0097620_100270670
639 Ga0097620_100433730
640 Ga0097620_101248310
641 Ga0075435_100061515
642 Ga0075435_100077382
643 Ga0105240_10008912
644 Ga0105240_10052766
645 Ga0105240_10143930
646 Ga0105240_10355282
647 Ga0111539_10009213
648 Ga0111539_10494485
649 Ga0111539_11268853
650 Ga0105245_10005015
651 Ga0105245_10011107
652 Ga0105245_10022023
653 Ga0105245_10050393
654 Ga0105245_10097060
655 Ga0105245_10171413
656 Ga0105245_10537369
657 Ga0105245_11108302
658 Ga0105245_12016510
659 Ga0105247_10050586
660 Ga0105243_10195513
661 Ga0105241_10023381
662 Ga0105241_10034007
663 Ga0105241_10062756
664 Ga0105241_10065179
665 Ga0105242_10031057
666 Ga0105242_10035503
667 Ga0105242_10086836
668 Ga0105242_10199013
669 Ga0105242_10256125
670 Ga0105248_10002427
671 Ga0105248_10015004
672 Ga0105248_10019966
673 Ga0105248_10068096
674 Ga0105237_10001317
675 Ga0105237_10024993
676 Ga0105237_10083555
677 Ga0105237_10374186
678 Ga0105237_10416404
679 Ga0105237_10551787
680 Ga0105237_11144067
681 Ga0105237_11450651
682 Ga0105238_10008673
683 Ga0105238_10052385
684 Ga0105238_10096540
685 Ga0105238_10104379
686 Ga0105238_10116351
687 Ga0105249_10013555
688 Ga0105239_10003048
689 Ga0105239_10042185
690 Ga0105239_10053806
691 Ga0105239_10226984
692 Ga0105239_10371442
693 Ga0105239_10476470
694 Ga0105246_10003902
695 Ga0105246_10027514
696 Ga0157370_10028274
697 Ga0157370_10070296
698 Ga0157369_10002275
699 Ga0157369_10002738
700 Ga0157369_10508078
701 Ga0157374_10024250
702 Ga0157374_10148513
703 Ga0157374_10354553
704 Ga0157374_10541776
705 Ga0157374_10895315
706 Ga0157374_11087457
707 Ga0157374_11718928
708 Ga0157378_10003262
709 Ga0157378_10006667
710 Ga0157378_10328613
711 Ga0157378_10480826
712 Ga0157378_10644965
713 Ga0163162_10081630
714 Ga0163162_10359235
715 Ga0163162_10498238
716 Ga0163162_11382532
717 Ga0163162_11770542
718 Ga0157372_10019605
719 Ga0157372_10037835
720 Ga0157372_10072918
721 Ga0157375_10008895
722 Ga0157375_10082062
723 Ga0157375_10148700
724 Ga0157375_10233136
725 Ga0157375_10430976
726 Ga0157375_10471476
727 Ga0157375_10917120
728 Ga0157375_10976983
729 Ga0163163_10008800
730 Ga0163163_10132012
731 Ga0163163_11029670
732 Ga0157380_10037008
733 Ga0157380_11405975
734 Ga0157377_10013748
735 Ga0157377_10502560
736 Ga0157379_10003010
737 Ga0157379_10124281
738 Ga0157379_10340403
739 Ga0157379_10474989
740 Ga0157379_10628568
741 Ga0157376_10059103
742 Ga0157376_10117041
743 Ga0157376_10229756
744 Ga0157376_11055199
745 Ga0163161_10033476
746 Ga0213873_10043524
747 Ga0213873_10076430
748 Ga0213872_10000315
749 Ga0213874_10001369
750 Ga0213876_10022361
751 Ga0213875_10012264
752 Ga0213875_10013435
753 Ga0213875_10065073
754 Ga0213875_10080246
755 Ga0213875_10092653
756 Ga0213875_10165862
757 Ga0213871_10003092
758 Ga0207697_10012850
759 Ga0207697_10063443
760 Ga0207682_10000492
761 Ga0207682_10025077
762 Ga0207710_10069243
763 Ga0207688_10000727
764 Ga0207688_10075107
765 Ga0207647_10074245
766 Ga0207699_10581063
767 Ga0207645_10002485
768 Ga0207643_10001159
769 Ga0207643_10053992
770 Ga0207705_10258666
771 Ga0207654_10033389
772 Ga0207654_10062076
773 Ga0207654_10117761
774 Ga0207654_10487297
775 Ga0207654_11063634
776 Ga0207707_10000761
777 Ga0207707_10015549
778 Ga0207707_10235519
779 Ga0207695_10002495
780 Ga0207695_10004086
781 Ga0207695_10102945
782 Ga0207695_10159457
783 Ga0207671_10267636
784 Ga0207671_10494273
785 Ga0207663_10049978
786 Ga0207660_10131885
787 Ga0207662_10068160
788 Ga0207657_10100390
789 Ga0207657_10452936
790 Ga0207649_10148675
791 Ga0207649_10517591
792 Ga0207649_11159935
793 Ga0207652_10001347
794 Ga0207646_10767984
795 Ga0207681_10007135
796 Ga0207681_10227075
797 Ga0207681_10334468
798 Ga0207681_10528903
799 Ga0207681_10675451
800 Ga0207694_10000953
801 Ga0207694_10013230
802 Ga0207694_10062148
803 Ga0207694_10155737
804 Ga0207650_10122169
805 Ga0207650_11064513
806 Ga0207659_10405375
807 Ga0207659_11086842
808 Ga0207687_10004364
809 Ga0207687_10010285
810 Ga0207687_10027930
811 Ga0207687_10252973
812 Ga0207687_10736054
813 Ga0207700_10227045
814 Ga0207700_10299797
815 Ga0207700_10682665
816 Ga0207664_10357534
817 Ga0207664_10851762
818 Ga0207644_10502800
819 Ga0207706_10023960
820 Ga0207706_10115626
821 Ga0207706_10283334
822 Ga0207686_10009467
823 Ga0207709_10079185
824 Ga0207709_10210587
825 Ga0207670_10092503
826 Ga0207704_10164923
827 Ga0207691_10006460
828 Ga0207691_10040401
829 Ga0207711_10006203
830 Ga0207711_10006402
831 Ga0207711_10064739
832 Ga0207711_11621991
833 Ga0207711_11726501
834 Ga0207689_10001107
835 Ga0207689_10348386
836 Ga0207689_10367121
837 Ga0207661_10009833
838 Ga0207661_10129499
839 Ga0207661_10143682
840 Ga0207661_11224887
841 Ga0207679_10009412
842 Ga0207679_10623065
843 Ga0207667_10001913
844 Ga0207667_10016994
845 Ga0207667_10018865
846 Ga0207651_10065694
847 Ga0207651_10571486
848 Ga0207712_10049499
849 Ga0207668_10034287
850 Ga0207677_10205459
851 Ga0207703_10197347
852 Ga0207703_10636286
853 Ga0207703_11363004
854 Ga0207639_10006562
855 Ga0207639_10082096
856 Ga0207678_10309550
857 Ga0207708_10032354
858 Ga0207702_10011734
859 Ga0207702_10069131
860 Ga0207702_11602276
861 Ga0207641_10111676
862 Ga0207641_10671291
863 Ga0207648_10008815
864 Ga0207648_10241976
865 Ga0207676_10513819
866 Ga0207674_10000682
867 Ga0207674_10353086
868 Ga0207674_10375111
869 Ga0207674_11075571
870 Ga0207675_100012882
871 Ga0207675_100090401
872 Ga0207675_100456484
873 Ga0207683_10069132
874 Ga0207683_10078602
875 Ga0207698_10008302
876 Ga0209998_10055246
877 Ga0207428_10003783
878 Ga0268266_10015171
879 Ga0268265_10096287
880 Ga0268265_10209403
881 Ga0268264_10283549
882 Ga0268264_10456349
883 Ga0265338_10196857
884 Ga0265332_10022601
885 Ga0265340_10039360
886 Ga0265316_10129500
887 Ga0265314_10001232
888 Ga0265314_10127373
889 Ga0373934_0000928
890 Ga0373934_0028387
891 Ga0373934_0193611
892 Ga0373923_0283241
893 Ga0373939_0259658
894 Ga0373953_0136644
895 Ga0373954_0002995
896 Ga0373956_0047313
897 Ga0373957_0306447
898 Ga0373955_0220747
899 Ga0373955_0230902
900 Ga0373955_0234677
901 Ga0373924_0113821
902 Ga0373935_0272219
903 Ga0373927_0172962
904 Ga0373933_0026618
905 Ga0373933_0036882
906 Ga0373937_0019522
907 Ga0373937_0168218
908 Ga0373937_0179754
909 Ga0373937_0582893
910 Ga0373937_1127402
911 Ga0373925_0070171
912 Ga0373925_0322254
913 Ga0436364_0356229
914 Ga0436364_0713301
915 Ga0436364_0755318
916 Ga0436364_0787827
917 Ga0436364_1128605
918 Ga0436364_1455492
919 Ga0436365_0230171
920 Ga0436365_0522788
921 Ga0436365_0912888
922 Ga0436365_1041088
923 Ga0436360_0437733
924 Ga0436361_1020706
925 Ga0436363_0033107
926 Ga0436363_0046554
927 Ga0436363_1596932
928 Ga0436362_0055550
929 Ga0436362_0389385
930 Ga0436362_0660779
931 Ga0436362_0701711
932 Ga0439464_0168004
933 Ga0466969_0262237
934 Ga0451576_0201874
935 Ga0495651_0169594
936 Ga0495651_0225858
937 Ga0495651_0325000
938 Ga0495580_0016895
939 Ga0495580_0045433
940 Ga0495580_0224980
941 Ga0495580_0821056
942 Ga0495582_0275556
943 Ga0495594_0520666
944 Ga0495608_0093545
945 Ga0495652_0198666
946 Ga0495587_0001707
947 Ga0495587_0055334
948 Ga0495587_0212242
949 Ga0495645_0067700
950 Ga0495635_0277999
951 Ga0495647_0119520
952 Ga0495669_0074951
953 Ga0495674_0184087
954 Ga0495680_0208093
955 Ga0495602_0120617
956 Ga0495602_0482909
957 Ga0496104_0427801
958 Ga0496109_0080023
959 Ga0496114_0639038
960 Ga0496115_0183658
961 nmdc:mga06r32_327045_c1
962 nmdc:mga08y16_78588_c1
963 nmdc:mga0n895_325264_c1
964 nmdc:mga0n895_5514_c1
965 nmdc:mga0rr50_54732_c1
966 nmdc:mga0rr50_99720_c1
967 nmdc:mga08x19_158678_c1
968 nmdc:mga08x19_277684_c1
969 nmdc:mga0a205_550_c1
970 Ga0466962_0181867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

42

189

0.93

PF12867

DinB_2

DinB superfamily

52

173

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8685 31 170
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8515 28 170
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.8398 28 171
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8212 30 171
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.82 28 170
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.832 29 170 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8291 30 162 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8116 30 162 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8061 29 170 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7994 32 162 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A317IVF9-F1-model_v4 DinB family protein 0.9817 26 171
AF-A0A162PK14-F1-model_v4 Damage-inducible protein DinB 0.9404 29 171
AF-A0A7V4YYR4-F1-model_v4 Damage-inducible protein DinB 0.939 28 171
AF-A0A2V8Y6R3-F1-model_v4 DinB-like domain-containing protein 0.9388 28 171
AF-A0A2V9AJS9-F1-model_v4 DinB-like domain-containing protein 0.9376 28 171

Map