F453052

General Info

Members Datasets Scaffolds Average Seq Length
485 285 970 156

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10003489|Ga0070709_100034896
Length 176
Sequence MKLSSLVAAAALVFAGNASAAEPINWQRYIVAETGASVDIPTSVFTEDAGKPEGAYGKQFLTSDGRANLTIESLTNEAGDSPATFLAKRNPPKDIVYKKITSRFFVVSSFRNDKIWYDRCNFAASLVNCVLINYPAAEKRGWDGIVTRISNTLASGNLQGTRSGDGDLTLGTVARR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
220 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
262 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
267 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
268 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
275 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
276 2791355199
277 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
278 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
279 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
280 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
281 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
282 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
283 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
284 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
285 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.72
Nodule 1.65
Rhizoplane 7.01
Rhizosphere 76.49
Stem 0
Stem Tuber 0
Unclassified 7.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10003489 3300005434 Bacteria 8444
2 JGI24744J21845_10068324 3300002077 Bacteria 648
3 JGI24742J22300_10023900 3300002244 Bacteria 1052
4 JGI24742J22300_10027685 3300002244 Bacteria 983
5 rootH2_10034466 3300003320 Bacteria 1400
6 rootL2_10086746 3300003322 Bacteria 1310
7 rootH1_10162573 3300003323 Bacteria 1517
8 Ga0070658_10339032 3300005327 Bacteria 1286
9 Ga0070676_10130068 3300005328 Bacteria 1591
10 Ga0070676_10512485 3300005328 Bacteria 853
11 Ga0070670_100152017 3300005331 Bacteria 2003
12 Ga0068869_100570945 3300005334 Bacteria 952
13 Ga0070680_100168641 3300005336 Bacteria 1841
14 Ga0070682_100133902 3300005337 Bacteria 1681
15 Ga0070682_100508665 3300005337 Bacteria 935
16 Ga0068868_101052269 3300005338 Bacteria 747
17 Ga0070660_100367271 3300005339 Bacteria 1187
18 Ga0070689_100023664 3300005340 Bacteria 4600
19 Ga0070689_100829187 3300005340 Bacteria 815
20 Ga0070661_100236481 3300005344 Bacteria 1405
21 Ga0070668_100067629 3300005347 Bacteria 2776
22 Ga0070668_100097917 3300005347 Bacteria 2320
23 Ga0070668_100119817 3300005347 Bacteria 2102
24 Ga0070668_100174995 3300005347 Bacteria 1749
25 Ga0070668_100366954 3300005347 Bacteria 1222
26 Ga0070668_100617355 3300005347 Bacteria 950
27 Ga0070669_100343807 3300005353 Bacteria 1210
28 Ga0070669_100495698 3300005353 Bacteria 1013
29 Ga0070675_100426299 3300005354 Bacteria 1187
30 Ga0070675_101459544 3300005354 Bacteria 631
31 Ga0070671_100289111 3300005355 Bacteria 1395
32 Ga0070674_100329125 3300005356 Bacteria 1227
33 Ga0070673_100243792 3300005364 Bacteria 1564
34 Ga0070673_100269579 3300005364 Bacteria 1489
35 Ga0070688_100147459 3300005365 Bacteria 1605
36 Ga0070659_100033769 3300005366 Bacteria 3976
37 Ga0070659_100075011 3300005366 Bacteria 2695
38 Ga0070709_10326963 3300005434 Bacteria 1127
39 Ga0070714_101464484 3300005435 Bacteria 667
40 Ga0070701_10125901 3300005438 Bacteria 1450
41 Ga0070701_10155495 3300005438 Bacteria 1320
42 Ga0070711_100208745 3300005439 Unclassified 1511
43 Ga0070700_100223469 3300005441 Bacteria 1336
44 Ga0070700_100265545 3300005441 Bacteria 1238
45 Ga0070700_100777689 3300005441 Bacteria 769
46 Ga0070694_100557484 3300005444 Bacteria 918
47 Ga0070663_100001409 3300005455 Bacteria 13140
48 Ga0070663_100151287 3300005455 Bacteria 1780
49 Ga0070663_100299658 3300005455 Bacteria 1286
50 Ga0070663_100452094 3300005455 Bacteria 1059
51 Ga0070663_100874802 3300005455 Bacteria 775
52 Ga0070678_100027690 3300005456 Bacteria 3852
53 Ga0070678_100416729 3300005456 Bacteria 1170
54 Ga0070678_100498025 3300005456 Bacteria 1074
55 Ga0070678_100717523 3300005456 Bacteria 902
56 Ga0070678_100815676 3300005456 Bacteria 848
57 Ga0070662_100017824 3300005457 Bacteria 4791
58 Ga0070662_100449074 3300005457 Bacteria 1070
59 Ga0070681_10610597 3300005458 Unclassified 1005
60 Ga0068867_100151943 3300005459 Bacteria 1819
61 Ga0068867_100795005 3300005459 Bacteria 843
62 Ga0070685_11066887 3300005466 Unclassified 609
63 Ga0070698_100362808 3300005471 Bacteria 1381
64 Ga0070679_100487893 3300005530 Bacteria 1176
65 Ga0068853_101606271 3300005539 Bacteria 630
66 Ga0070672_100202227 3300005543 Bacteria 1661
67 Ga0070686_100024111 3300005544 Bacteria 3644
68 Ga0070686_100457611 3300005544 Bacteria 982
69 Ga0070686_100860608 3300005544 Bacteria 735
70 Ga0070665_100006053 3300005548 Bacteria 12366
71 Ga0070665_100069503 3300005548 Bacteria 3529
72 Ga0070665_100163462 3300005548 Bacteria 2228
73 Ga0070665_100273893 3300005548 Bacteria 1689
74 Ga0068855_100120124 3300005563 Bacteria 3008
75 Ga0068856_100204376 3300005614 Bacteria 1990
76 Ga0068856_100647209 3300005614 Bacteria 1078
77 Ga0070702_100458185 3300005615 Bacteria 927
78 Ga0068852_100152394 3300005616 Bacteria 2151
79 Ga0068852_100422156 3300005616 Bacteria 1316
80 Ga0068859_100166048 3300005617 Bacteria 2287
81 Ga0068859_100435972 3300005617 Bacteria 1406
82 Ga0068864_100489630 3300005618 Bacteria 1181
83 Ga0068864_100528525 3300005618 Bacteria 1138
84 Ga0068866_10084497 3300005718 Bacteria 1713
85 Ga0068866_10110362 3300005718 Bacteria 1533
86 Ga0068866_11303825 3300005718 Bacteria 528
87 Ga0068861_100017176 3300005719 Bacteria 5130
88 Ga0068861_100095162 3300005719 Bacteria 2358
89 Ga0068861_100370821 3300005719 Bacteria 1262
90 Ga0068851_11015805 3300005834 Bacteria 523
91 Ga0068870_10076115 3300005840 Bacteria 1842
92 Ga0068858_100043473 3300005842 Bacteria 4165
93 Ga0068858_100131196 3300005842 Bacteria 2350
94 Ga0068858_101650795 3300005842 Bacteria 633
95 Ga0068860_101117681 3300005843 Bacteria 807
96 Ga0068862_100010027 3300005844 Bacteria 7825
97 Ga0068862_100083440 3300005844 Bacteria 2774
98 Ga0068862_100111345 3300005844 Bacteria 2403
99 Ga0068862_100449540 3300005844 Bacteria 1214
100 Ga0081455_10017631 3300005937 Bacteria 6835
101 Ga0081540_1000514 3300005983 Bacteria 37986
102 Ga0081540_1017363 3300005983 Bacteria 4458
103 Ga0070717_11478197 3300006028 Bacteria 617
104 Ga0075365_10086835 3300006038 Bacteria 2126
105 Ga0075365_10410761 3300006038 Bacteria 955
106 Ga0075365_10760996 3300006038 Bacteria 684
107 Ga0075363_100044741 3300006048 Bacteria 2346
108 Ga0075364_10095433 3300006051 Bacteria 1977
109 Ga0075432_10296288 3300006058 Bacteria 670
110 Ga0070712_101205078 3300006175 Bacteria 659
111 Ga0075362_10081977 3300006177 Bacteria 1488
112 Ga0075362_10306439 3300006177 Bacteria 789
113 Ga0075367_10057030 3300006178 Bacteria 2322
114 Ga0075367_10067593 3300006178 Bacteria 2143
115 Ga0075367_10164391 3300006178 Bacteria 1381
116 Ga0075369_10255118 3300006186 Bacteria 815
117 Ga0075366_10401228 3300006195 Bacteria 844
118 Ga0097621_100537659 3300006237 Bacteria 1062
119 Ga0097621_100901164 3300006237 Bacteria 824
120 Ga0097621_100977636 3300006237 Bacteria 791
121 Ga0075370_10101671 3300006353 Bacteria 1664
122 Ga0068865_100293395 3300006881 Bacteria 1299
123 Ga0097620_100166044 3300006931 Bacteria 2287
124 Ga0097620_100435979 3300006931 Bacteria 1406
125 Ga0075435_101230032 3300007076 Unclassified 655
126 Ga0111539_10062958 3300009094 Bacteria 4390
127 Ga0105245_10054897 3300009098 Bacteria 3578
128 Ga0105245_10098165 3300009098 Bacteria 2706
129 Ga0105245_11584595 3300009098 Bacteria 707
130 Ga0105247_10126513 3300009101 Bacteria 1661
131 Ga0105247_10170846 3300009101 Bacteria 1445
132 Ga0105243_10020372 3300009148 Bacteria 5029
133 Ga0105243_10244305 3300009148 Bacteria 1599
134 Ga0105243_10539202 3300009148 Bacteria 1113
135 Ga0105243_10893167 3300009148 Bacteria 883
136 Ga0105248_10091458 3300009177 Bacteria 3427
137 Ga0105248_10336314 3300009177 Bacteria 1700
138 Ga0105248_10767469 3300009177 Bacteria 1088
139 Ga0105237_11878371 3300009545 Bacteria 607
140 Ga0105238_10293543 3300009551 Bacteria 1608
141 Ga0105238_10603520 3300009551 Bacteria 1106
142 Ga0105238_11291433 3300009551 Bacteria 756
143 Ga0105249_10013955 3300009553 Bacteria 7101
144 Ga0105249_10172562 3300009553 Bacteria 2098
145 Ga0105249_10180815 3300009553 Bacteria 2052
146 Ga0099796_10169617 3300010159 Bacteria 870
147 Ga0105239_10457455 3300010375 Bacteria 1448
148 Ga0105239_10501932 3300010375 Bacteria 1379
149 Ga0105246_10097532 3300011119 Bacteria 2133
150 Ga0105246_10284825 3300011119 Bacteria 1327
151 Ga0157373_10768944 3300013100 Bacteria 709
152 Ga0157370_10485408 3300013104 Bacteria 1135
153 Ga0157369_10196107 3300013105 Bacteria 2120
154 Ga0157374_10469165 3300013296 Bacteria 1261
155 Ga0157374_10871479 3300013296 Bacteria 918
156 Ga0157374_11309903 3300013296 Bacteria 746
157 Ga0157374_11536718 3300013296 Unclassified 689
158 Ga0157378_10161586 3300013297 Bacteria 2095
159 Ga0157378_10211809 3300013297 Bacteria 1838
160 Ga0157378_10591868 3300013297 Bacteria 1119
161 Ga0157378_11655366 3300013297 Bacteria 686
162 Ga0163162_10060228 3300013306 Bacteria 3831
163 Ga0163162_10091341 3300013306 Bacteria 3127
164 Ga0163162_10284535 3300013306 Bacteria 1785
165 Ga0163162_10339887 3300013306 Bacteria 1634
166 Ga0163162_10815684 3300013306 Bacteria 1050
167 Ga0157375_10340054 3300013308 Bacteria 1666
168 Ga0157375_10378194 3300013308 Bacteria 1583
169 Ga0157375_10503295 3300013308 Bacteria 1375
170 Ga0157375_11875177 3300013308 Bacteria 711
171 Ga0163163_10133772 3300014325 Bacteria 2520
172 Ga0157380_10005100 3300014326 Bacteria 9174
173 Ga0157380_10164925 3300014326 Bacteria 1929
174 Ga0157380_10286295 3300014326 Bacteria 1511
175 Ga0157380_10361433 3300014326 Bacteria 1362
176 Ga0157380_11383699 3300014326 Bacteria 754
177 Ga0157380_11464275 3300014326 Bacteria 735
178 Ga0157377_10817638 3300014745 Bacteria 689
179 Ga0157379_10020802 3300014968 Bacteria 5806
180 Ga0157379_10090520 3300014968 Bacteria 2745
181 Ga0157376_10780548 3300014969 Bacteria 967
182 Ga0163161_10200052 3300017792 Bacteria 1539
183 Ga0213872_10013393 3300021361 Bacteria 3843
184 Ga0213871_10001420 3300021441 Bacteria 4006
185 Ga0209758_1065114 3300025297 Bacteria 1178
186 Ga0209257_1025719 3300025304 Bacteria 2003
187 Ga0207688_10310989 3300025901 Bacteria 965
188 Ga0207645_10439686 3300025907 Bacteria 880
189 Ga0207663_10146983 3300025916 Unclassified 1649
190 Ga0207660_10364774 3300025917 Bacteria 1159
191 Ga0207652_10173533 3300025921 Bacteria 1935
192 Ga0207681_10098777 3300025923 Bacteria 2101
193 Ga0207659_10945181 3300025926 Bacteria 741
194 Ga0207687_10137869 3300025927 Bacteria 1847
195 Ga0207687_10303804 3300025927 Bacteria 1286
196 Ga0207687_10949238 3300025927 Unclassified 737
197 Ga0207644_11774980 3300025931 Bacteria 516
198 Ga0207690_10079795 3300025932 Bacteria 2282
199 Ga0207706_10098671 3300025933 Bacteria 2569
200 Ga0207686_10266747 3300025934 Bacteria 1258
201 Ga0207709_10020993 3300025935 Bacteria 3692
202 Ga0207709_10043711 3300025935 Bacteria 2702
203 Ga0207709_10127067 3300025935 Bacteria 1731
204 Ga0207709_10329079 3300025935 Bacteria 1146
205 Ga0207709_10969272 3300025935 Bacteria 694
206 Ga0207670_10993229 3300025936 Bacteria 706
207 Ga0207669_10244348 3300025937 Bacteria 1332
208 Ga0207669_10309867 3300025937 Bacteria 1203
209 Ga0207669_10647847 3300025937 Unclassified 864
210 Ga0207704_10126441 3300025938 Bacteria 1761
211 Ga0207704_10302189 3300025938 Bacteria 1226
212 Ga0207691_10211859 3300025940 Bacteria 1683
213 Ga0207711_10051694 3300025941 Bacteria 3520
214 Ga0207711_10425619 3300025941 Bacteria 1235
215 Ga0207711_11153227 3300025941 Bacteria 716
216 Ga0207689_10012982 3300025942 Bacteria 7113
217 Ga0207689_10057685 3300025942 Bacteria 3193
218 Ga0207667_10097778 3300025949 Bacteria 3029
219 Ga0207651_10419097 3300025960 Bacteria 1143
220 Ga0207712_10126752 3300025961 Bacteria 1939
221 Ga0207668_10942952 3300025972 Bacteria 769
222 Ga0207658_10216391 3300025986 Bacteria 1609
223 Ga0207677_10255838 3300026023 Bacteria 1425
224 Ga0207677_11629845 3300026023 Bacteria 598
225 Ga0207703_10098396 3300026035 Bacteria 2474
226 Ga0207703_10302822 3300026035 Bacteria 1458
227 Ga0207703_10961301 3300026035 Bacteria 819
228 Ga0207678_10000586 3300026067 Bacteria 33284
229 Ga0207678_10099164 3300026067 Bacteria 2488
230 Ga0207678_10111118 3300026067 Bacteria 2338
231 Ga0207678_10309372 3300026067 Bacteria 1358
232 Ga0207678_11154472 3300026067 Bacteria 686
233 Ga0207708_10778108 3300026075 Bacteria 823
234 Ga0207702_11374306 3300026078 Bacteria 700
235 Ga0207641_10230366 3300026088 Bacteria 1722
236 Ga0207648_10067968 3300026089 Bacteria 3106
237 Ga0207648_10139697 3300026089 Bacteria 2135
238 Ga0207648_10206485 3300026089 Bacteria 1743
239 Ga0207675_100028097 3300026118 Bacteria 5237
240 Ga0207683_10096593 3300026121 Bacteria 2634
241 Ga0207683_10119481 3300026121 Bacteria 2365
242 Ga0207683_10130044 3300026121 Bacteria 2264
243 Ga0207683_10264906 3300026121 Bacteria 1569
244 Ga0207683_10293721 3300026121 Bacteria 1486
245 Ga0207683_10923185 3300026121 Bacteria 810
246 Ga0207698_10384763 3300026142 Bacteria 1336
247 Ga0207698_10997310 3300026142 Bacteria 848
248 Ga0207428_10187741 3300027907 Bacteria 1559
249 Ga0268266_10001600 3300028379 Bacteria 26414
250 Ga0268266_10024855 3300028379 Bacteria 5097
251 Ga0268266_10090251 3300028379 Bacteria 2685
252 Ga0268266_11146085 3300028379 Unclassified 752
253 Ga0268265_10321056 3300028380 Bacteria 1402
254 Ga0268265_11359388 3300028380 Bacteria 711
255 Ga0268264_10159548 3300028381 Bacteria 2030
256 Ga0268264_10770537 3300028381 Bacteria 960
257 Ga0307513_10103997 3300031456 Bacteria 2854
258 Ga0265314_10003461 3300031711 Bacteria 15251
259 Ga0307405_10651479 3300031731 Bacteria 866
260 Ga0307406_10594824 3300031901 Bacteria 911
261 Ga0307407_11046903 3300031903 Bacteria 632
262 Ga0307415_100335712 3300032126 Bacteria 1266
263 Ga0373951_0067282 3300035091 Bacteria 907
264 Ga0373952_0256057 3300035092 Bacteria 532
265 Ga0373923_0047916 3300035111 Bacteria 1783
266 Ga0373923_0096172 3300035111 Bacteria 1301
267 Ga0373954_0004376 3300035118 Bacteria 6075
268 Ga0373954_0206220 3300035118 Unclassified 966
269 Ga0373957_0254020 3300035120 Unclassified 740
270 Ga0373955_0070988 3300035172 Bacteria 1947
271 Ga0373962_0289135 3300035242 Bacteria 579
272 Ga0373935_0462026 3300035692 Bacteria 918
273 Ga0373927_0314742 3300035695 Bacteria 1031
274 Ga0373933_0008846 3300035724 Bacteria 5490
275 Ga0373937_0016997 3300036401 Bacteria 6470
276 Ga0373937_0776919 3300036401 Unclassified 905
277 Ga0436360_0803820 3300039438 Bacteria 3994
278 Ga0436361_0072729 3300039447 Bacteria 4629
279 Ga0436362_0927811 3300039453 Bacteria 3454
280 Ga0451789_0014638 3300041443 Unclassified 687
281 Ga0451791_0542517 3300041451 Bacteria 743
282 Ga0451793_1098934 3300041452 Bacteria 839
283 Ga0451802_0603257 3300041460 Bacteria 796
284 Ga0451807_2274282 3300041486 Bacteria 738
285 Ga0495617_099819 3300046452 Bacteria 944
286 Ga0495592_0067708 3300046454 Bacteria 2608
287 Ga0495592_0225640 3300046454 Bacteria 1250
288 Ga0495603_0454023 3300046455 Bacteria 734
289 Ga0495629_0088277 3300046459 Bacteria 2163
290 Ga0495638_0001923 3300046460 Bacteria 17878
291 Ga0495638_0142953 3300046460 Bacteria 1394
292 Ga0495651_0008826 3300046462 Bacteria 7733
293 Ga0495651_0370648 3300046462 Unclassified 941
294 Ga0495653_0051978 3300046463 Bacteria 3143
295 Ga0495639_0121448 3300046475 Bacteria 1246
296 Ga0495584_0127276 3300046491 Bacteria 1291
297 Ga0495585_0199373 3300046492 Bacteria 1020
298 Ga0495585_0244475 3300046492 Bacteria 897
299 Ga0495585_0260861 3300046492 Bacteria 862
300 Ga0495594_0029408 3300046499 Bacteria 2969
301 Ga0495594_0331005 3300046499 Bacteria 867
302 Ga0495606_0002114 3300046507 Bacteria 24120
303 Ga0495606_0002289 3300046507 Bacteria 22641
304 Ga0495606_0262766 3300046507 Unclassified 952
305 Ga0495606_0508630 3300046507 Unclassified 607
306 Ga0495608_0062737 3300046511 Bacteria 2441
307 Ga0495616_0079685 3300046513 Bacteria 1569
308 Ga0495616_0148051 3300046513 Bacteria 1064
309 Ga0495616_0170881 3300046513 Bacteria 972
310 Ga0495618_0426827 3300046514 Unclassified 807
311 Ga0495628_0213929 3300046516 Unclassified 1449
312 Ga0495628_0366476 3300046516 Bacteria 1057
313 Ga0495632_0046612 3300046519 Bacteria 2153
314 Ga0495643_0002226 3300046522 Bacteria 15763
315 Ga0495643_0243016 3300046522 Bacteria 844
316 Ga0495644_0106523 3300046523 Bacteria 1062
317 Ga0495652_0018275 3300046529 Bacteria 6253
318 Ga0495652_0139463 3300046529 Bacteria 1908
319 Ga0495640_0194240 3300046533 Unclassified 1289
320 Ga0495587_0004924 3300046536 Bacteria 8752
321 Ga0495587_0051914 3300046536 Unclassified 2422
322 Ga0495598_0002752 3300046537 Bacteria 3653
323 Ga0495598_0070205 3300046537 Bacteria 1101
324 Ga0495597_0013360 3300046542 Bacteria 3935
325 Ga0495645_0314843 3300046543 Bacteria 1018
326 Ga0495633_0051002 3300046558 Bacteria 1950
327 Ga0495633_0452409 3300046558 Bacteria 580
328 Ga0495667_0001223 3300046559 Bacteria 16826
329 Ga0495667_0233979 3300046559 Unclassified 1171
330 Ga0495656_0029790 3300046615 Bacteria 2200
331 Ga0495656_0057234 3300046615 Bacteria 1687
332 Ga0495656_0062180 3300046615 Bacteria 1632
333 Ga0495656_0413009 3300046615 Bacteria 707
334 Ga0495668_0002293 3300046616 Bacteria 16086
335 Ga0495668_0184333 3300046616 Bacteria 1143
336 Ga0495668_0255223 3300046616 Bacteria 960
337 Ga0495634_0163724 3300046642 Bacteria 1401
338 Ga0495634_0238346 3300046642 Bacteria 1117
339 Ga0495611_0017360 3300046648 Bacteria 3079
340 Ga0495625_0012535 3300046660 Bacteria 6864
341 Ga0495625_0233409 3300046660 Bacteria 1201
342 Ga0495635_0005694 3300046663 Bacteria 8683
343 Ga0495635_0376929 3300046663 Unclassified 944
344 Ga0495659_0040354 3300046664 Bacteria 1663
345 Ga0495659_0182099 3300046664 Bacteria 856
346 Ga0495588_0006266 3300046674 Bacteria 5350
347 Ga0495588_0079693 3300046674 Bacteria 1709
348 Ga0495588_0524623 3300046674 Bacteria 621
349 Ga0495657_0001003 3300046675 Bacteria 24863
350 Ga0495657_0197312 3300046675 Unclassified 1228
351 Ga0495599_0006302 3300046678 Bacteria 7148
352 Ga0495599_0120828 3300046678 Bacteria 1629
353 Ga0495623_0000922 3300046679 Bacteria 19895
354 Ga0495623_0298864 3300046679 Bacteria 890
355 Ga0495646_0330103 3300046680 Unclassified 802
356 Ga0495669_0619797 3300046684 Bacteria 526
357 Ga0495624_0468068 3300046690 Bacteria 755
358 Ga0495624_0587774 3300046690 Bacteria 664
359 Ga0495670_0249119 3300046691 Bacteria 947
360 Ga0495670_0406905 3300046691 Bacteria 735
361 Ga0495649_0004586 3300046694 Bacteria 8994
362 Ga0495589_0064911 3300046794 Bacteria 1790
363 Ga0495589_0138046 3300046794 Bacteria 1169
364 Ga0495589_0155010 3300046794 Bacteria 1093
365 Ga0495589_0217303 3300046794 Bacteria 899
366 Ga0495600_0000450 3300046809 Bacteria 21272
367 Ga0495600_0064551 3300046809 Unclassified 2393
368 Ga0495604_0015451 3300047317 Bacteria 6094
369 Ga0495636_0017728 3300047318 Bacteria 2852
370 Ga0495636_0204406 3300047318 Bacteria 903
371 Ga0495680_0032496 3300047322 Bacteria 4235
372 Ga0495680_0072935 3300047322 Bacteria 2610
373 Ga0495683_0120240 3300047323 Bacteria 1247
374 Ga0495675_0000734 3300047444 Bacteria 20461
375 Ga0495675_0079454 3300047444 Unclassified 2066
376 Ga0495677_0315074 3300047445 Bacteria 616
377 Ga0495681_0137937 3300047470 Bacteria 1033
378 Ga0495684_0009657 3300047471 Bacteria 7440
379 Ga0495686_0349725 3300047472 Unclassified 804
380 Ga0495593_0093541 3300047673 Bacteria 1547
381 Ga0495593_0206642 3300047673 Unclassified 986
382 Ga0495602_0015491 3300048088 Bacteria 7692
383 Ga0495602_0053366 3300048088 Unclassified 3581
384 Ga0495615_0205119 3300048090 Bacteria 610
385 Ga0495626_0017780 3300048091 Bacteria 3585
386 Ga0496100_0723819 3300048903 Bacteria 777
387 Ga0496100_1156217 3300048903 Bacteria 610
388 Ga0496101_0171101 3300048904 Bacteria 1670
389 Ga0496102_0298929 3300048905 Bacteria 1517
390 Ga0496102_0304519 3300048905 Bacteria 1502
391 Ga0496102_0491864 3300048905 Bacteria 1148
392 Ga0496102_0780633 3300048905 Bacteria 878
393 Ga0496104_0741229 3300048907 Bacteria 890
394 Ga0496104_0917414 3300048907 Bacteria 781
395 Ga0496104_1226131 3300048907 Unclassified 653
396 Ga0496105_0175256 3300048908 Bacteria 1757
397 Ga0496105_0782469 3300048908 Unclassified 727
398 Ga0496105_1078859 3300048908 Bacteria 597
399 Ga0496106_0269600 3300048909 Bacteria 1363
400 Ga0496108_0354218 3300048911 Bacteria 1281
401 Ga0496108_0722473 3300048911 Bacteria 863
402 Ga0496109_0151932 3300048912 Bacteria 2168
403 Ga0496109_0594694 3300048912 Bacteria 1042
404 Ga0496110_0363795 3300048913 Unclassified 1318
405 Ga0496111_0194145 3300048914 Unclassified 1509
406 Ga0496111_0292744 3300048914 Bacteria 1207
407 Ga0496112_0000079 3300048915 Bacteria 64101
408 Ga0496112_0047461 3300048915 Bacteria 4213
409 Ga0496112_0283983 3300048915 Bacteria 1602
410 Ga0496112_0292088 3300048915 Bacteria 1576
411 Ga0496112_1240187 3300048915 Bacteria 662
412 Ga0496113_0626072 3300048916 Bacteria 861
413 Ga0496113_1137945 3300048916 Bacteria 611
414 Ga0496115_0445366 3300048918 Bacteria 1047
415 Ga0496118_0512860 3300048921 Bacteria 593
416 Ga0496119_0168866 3300048922 Bacteria 1157
417 Ga0496119_0245455 3300048922 Bacteria 905
418 Ga0496121_0030782 3300048924 Bacteria 4922
419 Ga0496121_0291975 3300048924 Bacteria 1110
420 Ga0496121_0647094 3300048924 Bacteria 644
421 Ga0496124_0161337 3300048927 Bacteria 1747
422 Ga0496125_0041454 3300048928 Bacteria 3935
423 Ga0496125_0233846 3300048928 Bacteria 1173
424 Ga0496126_0007266 3300048929 Bacteria 12176
425 Ga0496126_0285139 3300048929 Bacteria 1367
426 Ga0496126_0332970 3300048929 Bacteria 1245
427 Ga0496126_0883801 3300048929 Unclassified 679
428 Ga0495682_0207252 3300049460 Bacteria 695
429 Ga0501071_0943257 3300049587 Bacteria 666
430 nmdc:mga03683_281692_c1 3300050489 Bacteria 777
431 nmdc:mga03683_293133_c1 3300050489 Bacteria 762
432 nmdc:mga03683_347833_c1 3300050489 Bacteria 701
433 nmdc:mga03n38_349_c1 3300050490 Bacteria 11233
434 nmdc:mga00v17_133066_c1 3300050491 Bacteria 1590
435 nmdc:mga00v17_501772_c1 3300050491 Bacteria 786
436 nmdc:mga0yw44_39915_c1 3300050492 Bacteria 2785
437 nmdc:mga0k408_131275_c2 3300050493 Bacteria 1080
438 nmdc:mga0k408_232593_c1 3300050493 Bacteria 1100
439 nmdc:mga0k408_426755_c1 3300050493 Unclassified 788
440 nmdc:mga06z11_165103_c1 3300050494 Bacteria 1268
441 nmdc:mga06z11_39726_c1 3300050494 Bacteria 2343
442 nmdc:mga06z11_5879_c1 3300050494 Bacteria 4955
443 nmdc:mga07m45_13454_c1 3300050496 Bacteria 4343
444 nmdc:mga08y16_63283_c1 3300050511 Bacteria 3863
445 nmdc:mga0rr50_1166472_c1 3300050513 Unclassified 655
446 Ga0495601_0060259 3300053077 Unclassified 2408
447 Ga0495612_0032749 3300053078 Bacteria 2101
448 Ga0500635_0016215 3300053080 Bacteria 2212
449 Ga0495595_0076630 3300053084 Bacteria 1588
450 Ga0495595_0116400 3300053084 Bacteria 1299
451 Ga0495619_0004936 3300053085 Bacteria 8472
452 Ga0495619_0211662 3300053085 Bacteria 1342
453 Ga0500647_0129881 3300053091 Bacteria 1188
454 Ga0500566_0000012 3300053094 Bacteria 117873
455 Ga0500640_000281 3300053095 Bacteria 11373
456 Ga0500641_0003660 3300053096 Bacteria 5428
457 Ga0500641_0033212 3300053096 Bacteria 2046
458 Ga0500562_025325 3300053108 Bacteria 1552
459 Ga0500572_000709 3300053111 Bacteria 10803
460 Ga0500591_009115 3300053115 Bacteria 4648
461 Ga0500614_000765 3300053123 Bacteria 8151
462 Ga0500642_0230044 3300053130 Bacteria 857
463 Ga0500559_0002087 3300053136 Bacteria 10675
464 Ga0500589_190648 3300053147 Bacteria 796
465 Ga0500590_160490 3300053148 Bacteria 1002
466 Ga0500603_000253 3300053150 Bacteria 14087
467 Ga0500622_0048510 3300053156 Bacteria 2191
468 Ga0500630_044981 3300053159 Bacteria 2146
469 Ga0500638_039700 3300053162 Bacteria 2284
470 Ga0500639_000058 3300053163 Bacteria 50219
471 Ga0500639_048227 3300053163 Bacteria 2223
472 Ga0500637_0071155 3300053178 Bacteria 2000
473 Ga0500601_004143 3300053737 Bacteria 1572
474 Ga0500601_018515 3300053737 Bacteria 800
475 2723842596 2721755755 Bacteria 8322773
476 2793078535
477 2876808663 2876808645 Bacteria 8824342
478 2879111935 2879110137 Bacteria 8907982
479 2935784683 2935777560 Bacteria 8077691
480 8006965896 8006964411 Bacteria 8966052
481 8006989980 8006984368 Bacteria 9651211
482 8006999126 8006994254 Bacteria 8309700
483 8016590241 8016583857 Bacteria 10421953
484 8016603540 8016603502 Bacteria 8731218
485 8016613601 8016613128 Bacteria 8794220
486 Ga0070709_10003489
487 JGI24744J21845_10068324
488 JGI24742J22300_10023900
489 JGI24742J22300_10027685
490 rootH2_10034466
491 rootL2_10086746
492 rootH1_10162573
493 Ga0070658_10339032
494 Ga0070676_10130068
495 Ga0070676_10512485
496 Ga0070670_100152017
497 Ga0068869_100570945
498 Ga0070680_100168641
499 Ga0070682_100133902
500 Ga0070682_100508665
501 Ga0068868_101052269
502 Ga0070660_100367271
503 Ga0070689_100023664
504 Ga0070689_100829187
505 Ga0070661_100236481
506 Ga0070668_100067629
507 Ga0070668_100097917
508 Ga0070668_100119817
509 Ga0070668_100174995
510 Ga0070668_100366954
511 Ga0070668_100617355
512 Ga0070669_100343807
513 Ga0070669_100495698
514 Ga0070675_100426299
515 Ga0070675_101459544
516 Ga0070671_100289111
517 Ga0070674_100329125
518 Ga0070673_100243792
519 Ga0070673_100269579
520 Ga0070688_100147459
521 Ga0070659_100033769
522 Ga0070659_100075011
523 Ga0070709_10326963
524 Ga0070714_101464484
525 Ga0070701_10125901
526 Ga0070701_10155495
527 Ga0070711_100208745
528 Ga0070700_100223469
529 Ga0070700_100265545
530 Ga0070700_100777689
531 Ga0070694_100557484
532 Ga0070663_100001409
533 Ga0070663_100151287
534 Ga0070663_100299658
535 Ga0070663_100452094
536 Ga0070663_100874802
537 Ga0070678_100027690
538 Ga0070678_100416729
539 Ga0070678_100498025
540 Ga0070678_100717523
541 Ga0070678_100815676
542 Ga0070662_100017824
543 Ga0070662_100449074
544 Ga0070681_10610597
545 Ga0068867_100151943
546 Ga0068867_100795005
547 Ga0070685_11066887
548 Ga0070698_100362808
549 Ga0070679_100487893
550 Ga0068853_101606271
551 Ga0070672_100202227
552 Ga0070686_100024111
553 Ga0070686_100457611
554 Ga0070686_100860608
555 Ga0070665_100006053
556 Ga0070665_100069503
557 Ga0070665_100163462
558 Ga0070665_100273893
559 Ga0068855_100120124
560 Ga0068856_100204376
561 Ga0068856_100647209
562 Ga0070702_100458185
563 Ga0068852_100152394
564 Ga0068852_100422156
565 Ga0068859_100166048
566 Ga0068859_100435972
567 Ga0068864_100489630
568 Ga0068864_100528525
569 Ga0068866_10084497
570 Ga0068866_10110362
571 Ga0068866_11303825
572 Ga0068861_100017176
573 Ga0068861_100095162
574 Ga0068861_100370821
575 Ga0068851_11015805
576 Ga0068870_10076115
577 Ga0068858_100043473
578 Ga0068858_100131196
579 Ga0068858_101650795
580 Ga0068860_101117681
581 Ga0068862_100010027
582 Ga0068862_100083440
583 Ga0068862_100111345
584 Ga0068862_100449540
585 Ga0081455_10017631
586 Ga0081540_1000514
587 Ga0081540_1017363
588 Ga0070717_11478197
589 Ga0075365_10086835
590 Ga0075365_10410761
591 Ga0075365_10760996
592 Ga0075363_100044741
593 Ga0075364_10095433
594 Ga0075432_10296288
595 Ga0070712_101205078
596 Ga0075362_10081977
597 Ga0075362_10306439
598 Ga0075367_10057030
599 Ga0075367_10067593
600 Ga0075367_10164391
601 Ga0075369_10255118
602 Ga0075366_10401228
603 Ga0097621_100537659
604 Ga0097621_100901164
605 Ga0097621_100977636
606 Ga0075370_10101671
607 Ga0068865_100293395
608 Ga0097620_100166044
609 Ga0097620_100435979
610 Ga0075435_101230032
611 Ga0111539_10062958
612 Ga0105245_10054897
613 Ga0105245_10098165
614 Ga0105245_11584595
615 Ga0105247_10126513
616 Ga0105247_10170846
617 Ga0105243_10020372
618 Ga0105243_10244305
619 Ga0105243_10539202
620 Ga0105243_10893167
621 Ga0105248_10091458
622 Ga0105248_10336314
623 Ga0105248_10767469
624 Ga0105237_11878371
625 Ga0105238_10293543
626 Ga0105238_10603520
627 Ga0105238_11291433
628 Ga0105249_10013955
629 Ga0105249_10172562
630 Ga0105249_10180815
631 Ga0099796_10169617
632 Ga0105239_10457455
633 Ga0105239_10501932
634 Ga0105246_10097532
635 Ga0105246_10284825
636 Ga0157373_10768944
637 Ga0157370_10485408
638 Ga0157369_10196107
639 Ga0157374_10469165
640 Ga0157374_10871479
641 Ga0157374_11309903
642 Ga0157374_11536718
643 Ga0157378_10161586
644 Ga0157378_10211809
645 Ga0157378_10591868
646 Ga0157378_11655366
647 Ga0163162_10060228
648 Ga0163162_10091341
649 Ga0163162_10284535
650 Ga0163162_10339887
651 Ga0163162_10815684
652 Ga0157375_10340054
653 Ga0157375_10378194
654 Ga0157375_10503295
655 Ga0157375_11875177
656 Ga0163163_10133772
657 Ga0157380_10005100
658 Ga0157380_10164925
659 Ga0157380_10286295
660 Ga0157380_10361433
661 Ga0157380_11383699
662 Ga0157380_11464275
663 Ga0157377_10817638
664 Ga0157379_10020802
665 Ga0157379_10090520
666 Ga0157376_10780548
667 Ga0163161_10200052
668 Ga0213872_10013393
669 Ga0213871_10001420
670 Ga0209758_1065114
671 Ga0209257_1025719
672 Ga0207688_10310989
673 Ga0207645_10439686
674 Ga0207663_10146983
675 Ga0207660_10364774
676 Ga0207652_10173533
677 Ga0207681_10098777
678 Ga0207659_10945181
679 Ga0207687_10137869
680 Ga0207687_10303804
681 Ga0207687_10949238
682 Ga0207644_11774980
683 Ga0207690_10079795
684 Ga0207706_10098671
685 Ga0207686_10266747
686 Ga0207709_10020993
687 Ga0207709_10043711
688 Ga0207709_10127067
689 Ga0207709_10329079
690 Ga0207709_10969272
691 Ga0207670_10993229
692 Ga0207669_10244348
693 Ga0207669_10309867
694 Ga0207669_10647847
695 Ga0207704_10126441
696 Ga0207704_10302189
697 Ga0207691_10211859
698 Ga0207711_10051694
699 Ga0207711_10425619
700 Ga0207711_11153227
701 Ga0207689_10012982
702 Ga0207689_10057685
703 Ga0207667_10097778
704 Ga0207651_10419097
705 Ga0207712_10126752
706 Ga0207668_10942952
707 Ga0207658_10216391
708 Ga0207677_10255838
709 Ga0207677_11629845
710 Ga0207703_10098396
711 Ga0207703_10302822
712 Ga0207703_10961301
713 Ga0207678_10000586
714 Ga0207678_10099164
715 Ga0207678_10111118
716 Ga0207678_10309372
717 Ga0207678_11154472
718 Ga0207708_10778108
719 Ga0207702_11374306
720 Ga0207641_10230366
721 Ga0207648_10067968
722 Ga0207648_10139697
723 Ga0207648_10206485
724 Ga0207675_100028097
725 Ga0207683_10096593
726 Ga0207683_10119481
727 Ga0207683_10130044
728 Ga0207683_10264906
729 Ga0207683_10293721
730 Ga0207683_10923185
731 Ga0207698_10384763
732 Ga0207698_10997310
733 Ga0207428_10187741
734 Ga0268266_10001600
735 Ga0268266_10024855
736 Ga0268266_10090251
737 Ga0268266_11146085
738 Ga0268265_10321056
739 Ga0268265_11359388
740 Ga0268264_10159548
741 Ga0268264_10770537
742 Ga0307513_10103997
743 Ga0265314_10003461
744 Ga0307405_10651479
745 Ga0307406_10594824
746 Ga0307407_11046903
747 Ga0307415_100335712
748 Ga0373951_0067282
749 Ga0373952_0256057
750 Ga0373923_0047916
751 Ga0373923_0096172
752 Ga0373954_0004376
753 Ga0373954_0206220
754 Ga0373957_0254020
755 Ga0373955_0070988
756 Ga0373962_0289135
757 Ga0373935_0462026
758 Ga0373927_0314742
759 Ga0373933_0008846
760 Ga0373937_0016997
761 Ga0373937_0776919
762 Ga0436360_0803820
763 Ga0436361_0072729
764 Ga0436362_0927811
765 Ga0451789_0014638
766 Ga0451791_0542517
767 Ga0451793_1098934
768 Ga0451802_0603257
769 Ga0451807_2274282
770 Ga0495617_099819
771 Ga0495592_0067708
772 Ga0495592_0225640
773 Ga0495603_0454023
774 Ga0495629_0088277
775 Ga0495638_0001923
776 Ga0495638_0142953
777 Ga0495651_0008826
778 Ga0495651_0370648
779 Ga0495653_0051978
780 Ga0495639_0121448
781 Ga0495584_0127276
782 Ga0495585_0199373
783 Ga0495585_0244475
784 Ga0495585_0260861
785 Ga0495594_0029408
786 Ga0495594_0331005
787 Ga0495606_0002114
788 Ga0495606_0002289
789 Ga0495606_0262766
790 Ga0495606_0508630
791 Ga0495608_0062737
792 Ga0495616_0079685
793 Ga0495616_0148051
794 Ga0495616_0170881
795 Ga0495618_0426827
796 Ga0495628_0213929
797 Ga0495628_0366476
798 Ga0495632_0046612
799 Ga0495643_0002226
800 Ga0495643_0243016
801 Ga0495644_0106523
802 Ga0495652_0018275
803 Ga0495652_0139463
804 Ga0495640_0194240
805 Ga0495587_0004924
806 Ga0495587_0051914
807 Ga0495598_0002752
808 Ga0495598_0070205
809 Ga0495597_0013360
810 Ga0495645_0314843
811 Ga0495633_0051002
812 Ga0495633_0452409
813 Ga0495667_0001223
814 Ga0495667_0233979
815 Ga0495656_0029790
816 Ga0495656_0057234
817 Ga0495656_0062180
818 Ga0495656_0413009
819 Ga0495668_0002293
820 Ga0495668_0184333
821 Ga0495668_0255223
822 Ga0495634_0163724
823 Ga0495634_0238346
824 Ga0495611_0017360
825 Ga0495625_0012535
826 Ga0495625_0233409
827 Ga0495635_0005694
828 Ga0495635_0376929
829 Ga0495659_0040354
830 Ga0495659_0182099
831 Ga0495588_0006266
832 Ga0495588_0079693
833 Ga0495588_0524623
834 Ga0495657_0001003
835 Ga0495657_0197312
836 Ga0495599_0006302
837 Ga0495599_0120828
838 Ga0495623_0000922
839 Ga0495623_0298864
840 Ga0495646_0330103
841 Ga0495669_0619797
842 Ga0495624_0468068
843 Ga0495624_0587774
844 Ga0495670_0249119
845 Ga0495670_0406905
846 Ga0495649_0004586
847 Ga0495589_0064911
848 Ga0495589_0138046
849 Ga0495589_0155010
850 Ga0495589_0217303
851 Ga0495600_0000450
852 Ga0495600_0064551
853 Ga0495604_0015451
854 Ga0495636_0017728
855 Ga0495636_0204406
856 Ga0495680_0032496
857 Ga0495680_0072935
858 Ga0495683_0120240
859 Ga0495675_0000734
860 Ga0495675_0079454
861 Ga0495677_0315074
862 Ga0495681_0137937
863 Ga0495684_0009657
864 Ga0495686_0349725
865 Ga0495593_0093541
866 Ga0495593_0206642
867 Ga0495602_0015491
868 Ga0495602_0053366
869 Ga0495615_0205119
870 Ga0495626_0017780
871 Ga0496100_0723819
872 Ga0496100_1156217
873 Ga0496101_0171101
874 Ga0496102_0298929
875 Ga0496102_0304519
876 Ga0496102_0491864
877 Ga0496102_0780633
878 Ga0496104_0741229
879 Ga0496104_0917414
880 Ga0496104_1226131
881 Ga0496105_0175256
882 Ga0496105_0782469
883 Ga0496105_1078859
884 Ga0496106_0269600
885 Ga0496108_0354218
886 Ga0496108_0722473
887 Ga0496109_0151932
888 Ga0496109_0594694
889 Ga0496110_0363795
890 Ga0496111_0194145
891 Ga0496111_0292744
892 Ga0496112_0000079
893 Ga0496112_0047461
894 Ga0496112_0283983
895 Ga0496112_0292088
896 Ga0496112_1240187
897 Ga0496113_0626072
898 Ga0496113_1137945
899 Ga0496115_0445366
900 Ga0496118_0512860
901 Ga0496119_0168866
902 Ga0496119_0245455
903 Ga0496121_0030782
904 Ga0496121_0291975
905 Ga0496121_0647094
906 Ga0496124_0161337
907 Ga0496125_0041454
908 Ga0496125_0233846
909 Ga0496126_0007266
910 Ga0496126_0285139
911 Ga0496126_0332970
912 Ga0496126_0883801
913 Ga0495682_0207252
914 Ga0501071_0943257
915 nmdc:mga03683_281692_c1
916 nmdc:mga03683_293133_c1
917 nmdc:mga03683_347833_c1
918 nmdc:mga03n38_349_c1
919 nmdc:mga00v17_133066_c1
920 nmdc:mga00v17_501772_c1
921 nmdc:mga0yw44_39915_c1
922 nmdc:mga0k408_131275_c2
923 nmdc:mga0k408_232593_c1
924 nmdc:mga0k408_426755_c1
925 nmdc:mga06z11_165103_c1
926 nmdc:mga06z11_39726_c1
927 nmdc:mga06z11_5879_c1
928 nmdc:mga07m45_13454_c1
929 nmdc:mga08y16_63283_c1
930 nmdc:mga0rr50_1166472_c1
931 Ga0495601_0060259
932 Ga0495612_0032749
933 Ga0500635_0016215
934 Ga0495595_0076630
935 Ga0495595_0116400
936 Ga0495619_0004936
937 Ga0495619_0211662
938 Ga0500647_0129881
939 Ga0500566_0000012
940 Ga0500640_000281
941 Ga0500641_0003660
942 Ga0500641_0033212
943 Ga0500562_025325
944 Ga0500572_000709
945 Ga0500591_009115
946 Ga0500614_000765
947 Ga0500642_0230044
948 Ga0500559_0002087
949 Ga0500589_190648
950 Ga0500590_160490
951 Ga0500603_000253
952 Ga0500622_0048510
953 Ga0500630_044981
954 Ga0500638_039700
955 Ga0500639_000058
956 Ga0500639_048227
957 Ga0500637_0071155
958 Ga0500601_004143
959 Ga0500601_018515
960 2723842596
961 2793078535
962 2876808663
963 2879111935
964 2935784683
965 8006965896
966 8006989980
967 8006999126
968 8016590241
969 8016603540
970 8016613601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zxg-assembly1.cif.gz_B cyclic alpha-maltosyl-(1-->6)-maltose hydrolase from arthrobacter globiformis, ligand-free form 0.7605 95 123
6a0k-assembly1.cif.gz_B cyclic alpha-maltosyl-(1-->6)-maltose hydrolase from arthrobacter globiformis, complex with panose 0.7575 95 123
2vu4-assembly1.cif.gz_A structure of psbp protein from spinacia oleracea at 1.98 a resolution 0.7487 24 154
4u4l-assembly3.cif.gz_C crystal structure of the metallo-beta-lactamase ndm-1 in complex with a bisthiazolidine inhibitor 0.7429 95 125
2xb3-assembly1.cif.gz_A the structure of cyanobacterial psbp 0.7286 26 154
ID Description Score Start End Superfamily
af_Q54P88_2_150_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7549 23 154 3.40.1000.10
af_Q6ZK86_73_232_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7376 55 155 3.40.1000.10
2xb3A00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7286 26 154 3.40.1000.10
af_Q54C86_7_153_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7225 27 155 3.40.1000.10
af_Q6ATY3_75_252_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7052 25 155 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A2A2V554-F1-model_v4 Uncharacterized protein 0.941 19 155
AF-A0A537N3B6-F1-model_v4 Uncharacterized protein 0.9249 26 154
AF-A0A023XAU7-F1-model_v4 deleted 0.9214 19 155
AF-A0A4Q0S2X6-F1-model_v4 Uncharacterized protein 0.9187 17 155
AF-A0A7S7U6W9-F1-model_v4 Uncharacterized protein 0.9176 19 155

Map