F453032

General Info

Members Datasets Scaffolds Average Seq Length
485 268 466 337

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10054539|JGI24739J22299_100545392
Length 372
Sequence MADLCHLPAWKLVGHVESDGALVEMRLRGLAGPTVGGGIESTVMRFGLFIPQGWRLDLVDIPTDKHWQVMRDLAAYADGGPWDSLWVYDHFHTIPMPTHEATHEAWSLMSAYAATTSRIKLGQMCTAMGYRNPVYLAKVAATADXISGGRVQMGIGGGWYEHEWKAYGYGFPSAGVRLGMLDEGVQIMRDAWRKGVVSLHGKHYQVDGAIVEPKPLQEGGLPLWIAGGGEKVTLRIAAKYAQYTNFTSEPGGFEHKSQVLADHCRDVGSDYGAIVRSANFNAVVGESEADVKERVARVRARLVAKANEAAVDPMLATVTSPDSASGTPEQVVEKLKRLRDLGCEYAILNFPEAAYDRSGIELFEREVIPALS

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
9 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
10 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
11 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
12 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
13 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
14 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
15 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
16 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
17 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
18 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
19 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 0.21
Rhizoplane 11.55
Rhizosphere 65.57
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004002 3300001977 Bacteria 2328
2 JGI24739J22299_10054539 3300001989 Bacteria 1280
3 JGI24750J21931_1001413 3300002070 Bacteria 3002
4 JGI24748J21848_1003984 3300002074 Bacteria 1693
5 JGI24749J21850_1008965 3300002076 Bacteria 1397
6 JGI24744J21845_10002134 3300002077 Bacteria 4015
7 JGI24742J22300_10003095 3300002244 Bacteria 2692
8 Ga0055540_1000392 3300003792 Bacteria 35964
9 Ga0055540_1001171 3300003792 Bacteria 16270
10 Ga0055540_1003464 3300003792 Bacteria 7619
11 Ga0070676_10002409 3300005328 Bacteria 9582
12 Ga0070676_10129942 3300005328 Bacteria 1591
13 Ga0070683_100338940 3300005329 Bacteria 1431
14 Ga0068869_100010877 3300005334 Bacteria 5952
15 Ga0068869_100038611 3300005334 Bacteria 3405
16 Ga0070666_10006217 3300005335 Bacteria 7346
17 Ga0070682_100022026 3300005337 Bacteria 3769
18 Ga0070682_100031098 3300005337 Bacteria 3228
19 Ga0070689_100014146 3300005340 Bacteria 5790
20 Ga0070689_100134317 3300005340 Bacteria 1986
21 Ga0070691_10002933 3300005341 Bacteria 7646
22 Ga0070668_100000201 3300005347 Bacteria 39161
23 Ga0070668_100001887 3300005347 Bacteria 15322
24 Ga0070668_100042214 3300005347 Bacteria 3495
25 Ga0070669_100006850 3300005353 Bacteria 8197
26 Ga0070669_100051760 3300005353 Bacteria 3003
27 Ga0070671_100094176 3300005355 Bacteria 2510
28 Ga0070674_100003900 3300005356 Bacteria 8445
29 Ga0070674_100062334 3300005356 Bacteria 2605
30 Ga0070688_100014899 3300005365 Bacteria 4413
31 Ga0070659_100065719 3300005366 Bacteria 2873
32 Ga0070667_100000142 3300005367 Bacteria 90696
33 Ga0070667_100000752 3300005367 Bacteria 30896
34 Ga0070667_100009424 3300005367 Bacteria 8100
35 Ga0070667_100014581 3300005367 Bacteria 6496
36 Ga0070709_10131588 3300005434 Bacteria 1709
37 Ga0070710_10000771 3300005437 Bacteria 15308
38 Ga0070701_10006164 3300005438 Bacteria 5028
39 Ga0070711_100007162 3300005439 Bacteria 6771
40 Ga0070711_100015606 3300005439 Bacteria 4809
41 Ga0070705_100153235 3300005440 Bacteria 1531
42 Ga0070700_100000263 3300005441 Bacteria 28075
43 Ga0070663_100014385 3300005455 Bacteria 5080
44 Ga0070663_100032464 3300005455 Bacteria 3599
45 Ga0070663_100112798 3300005455 Bacteria 2045
46 Ga0070678_100000712 3300005456 Bacteria 16488
47 Ga0070662_100051903 3300005457 Bacteria 2963
48 Ga0068867_100000537 3300005459 Bacteria 24926
49 Ga0070685_10057520 3300005466 Bacteria 2264
50 Ga0068853_100001294 3300005539 Bacteria 17970
51 Ga0068853_100083470 3300005539 Bacteria 2799
52 Ga0070686_100025821 3300005544 Bacteria 3538
53 Ga0070686_100212103 3300005544 Bacteria 1395
54 Ga0070695_100002626 3300005545 Bacteria 10385
55 Ga0070693_100001778 3300005547 Bacteria 9827
56 Ga0070665_100037891 3300005548 Bacteria 4846
57 Ga0070665_100044119 3300005548 Bacteria 4478
58 Ga0070665_100086813 3300005548 Bacteria 3134
59 Ga0070704_100371142 3300005549 Bacteria 1213
60 Ga0068856_100164408 3300005614 Bacteria 2230
61 Ga0068856_100168126 3300005614 Bacteria 2204
62 Ga0070702_100004815 3300005615 Bacteria 6204
63 Ga0070702_100143414 3300005615 Bacteria 1524
64 Ga0068852_100045827 3300005616 Bacteria 3722
65 Ga0068852_100468652 3300005616 Bacteria 1250
66 Ga0068859_100001155 3300005617 Bacteria 26941
67 Ga0068859_100002067 3300005617 Bacteria 20487
68 Ga0068866_10000629 3300005718 Bacteria 16020
69 Ga0068861_100000739 3300005719 Bacteria 19591
70 Ga0068863_100005764 3300005841 Bacteria 12154
71 Ga0068863_100026906 3300005841 Bacteria 5485
72 Ga0068863_100081541 3300005841 Bacteria 3065
73 Ga0068858_100002363 3300005842 Bacteria 19075
74 Ga0068858_100022302 3300005842 Bacteria 5912
75 Ga0068858_100034389 3300005842 Bacteria 4700
76 Ga0068858_100210935 3300005842 Bacteria 1838
77 Ga0068858_100295329 3300005842 Bacteria 1545
78 Ga0068860_100000160 3300005843 Bacteria 110266
79 Ga0068860_100002272 3300005843 Bacteria 20190
80 Ga0068860_100099323 3300005843 Bacteria 2776
81 Ga0068860_100132298 3300005843 Bacteria 2395
82 Ga0068860_100143223 3300005843 Bacteria 2298
83 Ga0068862_100001362 3300005844 Bacteria 22694
84 Ga0068862_100017092 3300005844 Bacteria 6036
85 Ga0068862_100247599 3300005844 Bacteria 1623
86 Ga0081455_10092322 3300005937 Bacteria 2449
87 Ga0075365_10004459 3300006038 Bacteria 7419
88 Ga0075365_10004774 3300006038 Bacteria 7229
89 Ga0075365_10027057 3300006038 Bacteria 3645
90 Ga0075368_10052831 3300006042 Bacteria 1617
91 Ga0075363_100002619 3300006048 Bacteria 7411
92 Ga0075363_100015968 3300006048 Bacteria 3701
93 Ga0075363_100044588 3300006048 Bacteria 2350
94 Ga0075364_10001086 3300006051 Bacteria 14506
95 Ga0075364_10005904 3300006051 Bacteria 7153
96 Ga0075364_10015218 3300006051 Bacteria 4766
97 Ga0075364_10028229 3300006051 Bacteria 3591
98 Ga0070716_100000613 3300006173 Bacteria 15075
99 Ga0070712_100000495 3300006175 Bacteria 22525
100 Ga0070712_100003591 3300006175 Bacteria 9558
101 Ga0075362_10061159 3300006177 Bacteria 1704
102 Ga0075367_10021233 3300006178 Bacteria 3626
103 Ga0075369_10001541 3300006186 Bacteria 7896
104 Ga0075369_10035878 3300006186 Bacteria 2109
105 Ga0075369_10042549 3300006186 Bacteria 1948
106 Ga0075369_10049616 3300006186 Bacteria 1813
107 Ga0097621_100117596 3300006237 Bacteria 2253
108 Ga0075370_10002764 3300006353 Bacteria 8218
109 Ga0075370_10009460 3300006353 Bacteria 5063
110 Ga0075370_10041179 3300006353 Bacteria 2608
111 Ga0075370_10053659 3300006353 Bacteria 2288
112 Ga0068871_100030273 3300006358 Bacteria 4261
113 Ga0075428_100042557 3300006844 Bacteria 4994
114 Ga0075431_100005649 3300006847 Bacteria 12358
115 Ga0075429_100193803 3300006880 Bacteria 1780
116 Ga0068865_100000670 3300006881 Bacteria 19290
117 Ga0097620_100001155 3300006931 Bacteria 26941
118 Ga0097620_100002067 3300006931 Bacteria 20487
119 Ga0099795_10014464 3300007788 Bacteria 2448
120 Ga0105250_10031654 3300009092 Bacteria 2123
121 Ga0105250_10051555 3300009092 Bacteria 1651
122 Ga0111539_10526691 3300009094 Bacteria 1377
123 Ga0105245_10003258 3300009098 Bacteria 14558
124 Ga0105245_10006338 3300009098 Bacteria 10410
125 Ga0105247_10000078 3300009101 Bacteria 110404
126 Ga0105247_10000433 3300009101 Bacteria 35512
127 Ga0114129_10403435 3300009147 Bacteria 1801
128 Ga0114129_10649536 3300009147 Bacteria 1362
129 Ga0114129_10855381 3300009147 Bacteria 1156
130 Ga0105243_10001959 3300009148 Bacteria 17537
131 Ga0105241_10076984 3300009174 Bacteria 2603
132 Ga0105241_10155881 3300009174 Bacteria 1873
133 Ga0105242_10000858 3300009176 Bacteria 23563
134 Ga0105248_10000082 3300009177 Bacteria 110759
135 Ga0105248_10001630 3300009177 Bacteria 24938
136 Ga0105237_10013670 3300009545 Bacteria 8501
137 Ga0105237_10014302 3300009545 Bacteria 8307
138 Ga0105238_10154928 3300009551 Bacteria 2266
139 Ga0105238_10196215 3300009551 Bacteria 1994
140 Ga0105249_10000031 3300009553 Bacteria 220006
141 Ga0105249_10002952 3300009553 Bacteria 14673
142 Ga0105249_10006646 3300009553 Bacteria 10064
143 Ga0105239_10097039 3300010375 Bacteria 3257
144 Ga0105239_10099487 3300010375 Bacteria 3215
145 Ga0105239_10100150 3300010375 Bacteria 3205
146 Ga0105239_10102968 3300010375 Bacteria 3160
147 Ga0105239_10115479 3300010375 Bacteria 2978
148 Ga0105239_10292072 3300010375 Bacteria 1836
149 Ga0157374_10064140 3300013296 Bacteria 3446
150 Ga0157378_10002386 3300013297 Bacteria 16682
151 Ga0157378_10134604 3300013297 Bacteria 2290
152 Ga0163162_10108263 3300013306 Bacteria 2875
153 Ga0163162_10125638 3300013306 Bacteria 2671
154 Ga0163162_10181830 3300013306 Bacteria 2229
155 Ga0157372_10018187 3300013307 Bacteria 7554
156 Ga0157372_10224071 3300013307 Bacteria 2180
157 Ga0157375_10000849 3300013308 Bacteria 26601
158 Ga0157375_10059164 3300013308 Bacteria 3795
159 Ga0157380_10000339 3300014326 Bacteria 27956
160 Ga0157377_10025834 3300014745 Bacteria 3136
161 Ga0157379_10009573 3300014968 Bacteria 8438
162 Ga0163161_10000520 3300017792 Bacteria 31388
163 Ga0213876_10025305 3300021384 Bacteria 3132
164 Ga0209051_1000033 3300025303 Bacteria 380540
165 Ga0209051_1001272 3300025303 Bacteria 22502
166 Ga0209051_1006750 3300025303 Bacteria 6405
167 Ga0209051_1007878 3300025303 Bacteria 5746
168 Ga0209051_1008784 3300025303 Bacteria 5301
169 Ga0207696_1026523 3300025711 Bacteria 1792
170 Ga0207692_10003161 3300025898 Bacteria 6392
171 Ga0207642_10025532 3300025899 Bacteria 2392
172 Ga0207710_10000022 3300025900 Bacteria 335632
173 Ga0207688_10001068 3300025901 Bacteria 14029
174 Ga0207688_10003201 3300025901 Bacteria 8937
175 Ga0207680_10027503 3300025903 Bacteria 3168
176 Ga0207645_10004966 3300025907 Bacteria 9748
177 Ga0207645_10130176 3300025907 Bacteria 1637
178 Ga0207671_10021568 3300025914 Bacteria 4884
179 Ga0207671_10038881 3300025914 Bacteria 3525
180 Ga0207671_10129645 3300025914 Bacteria 1935
181 Ga0207693_10000660 3300025915 Bacteria 30957
182 Ga0207693_10011341 3300025915 Bacteria 7216
183 Ga0207663_10010988 3300025916 Bacteria 4840
184 Ga0207663_10024744 3300025916 Bacteria 3462
185 Ga0207681_10002764 3300025923 Bacteria 11101
186 Ga0207681_10030443 3300025923 Bacteria 3519
187 Ga0207694_10100412 3300025924 Bacteria 2293
188 Ga0207659_10113779 3300025926 Bacteria 2062
189 Ga0207687_10006483 3300025927 Bacteria 7728
190 Ga0207687_10008737 3300025927 Bacteria 6619
191 Ga0207644_10068525 3300025931 Bacteria 2588
192 Ga0207644_10231647 3300025931 Bacteria 1468
193 Ga0207690_10022446 3300025932 Bacteria 3927
194 Ga0207690_10228753 3300025932 Bacteria 1426
195 Ga0207706_10011539 3300025933 Bacteria 8046
196 Ga0207686_10001835 3300025934 Bacteria 11817
197 Ga0207709_10171486 3300025935 Bacteria 1523
198 Ga0207709_10284801 3300025935 Bacteria 1222
199 Ga0207670_10095399 3300025936 Bacteria 2112
200 Ga0207669_10000218 3300025937 Bacteria 26144
201 Ga0207704_10000179 3300025938 Bacteria 33399
202 Ga0207665_10009061 3300025939 Bacteria 6533
203 Ga0207711_10002041 3300025941 Bacteria 18263
204 Ga0207711_10045158 3300025941 Bacteria 3764
205 Ga0207689_10012044 3300025942 Bacteria 7412
206 Ga0207689_10049736 3300025942 Bacteria 3458
207 Ga0207667_10186429 3300025949 Bacteria 2130
208 Ga0207667_10456681 3300025949 Bacteria 1298
209 Ga0207712_10000029 3300025961 Bacteria 220014
210 Ga0207712_10167812 3300025961 Bacteria 1713
211 Ga0207668_10002863 3300025972 Bacteria 10113
212 Ga0207668_10023149 3300025972 Bacteria 3987
213 Ga0207668_10122662 3300025972 Bacteria 1970
214 Ga0207668_10277758 3300025972 Bacteria 1372
215 Ga0207640_10070790 3300025981 Bacteria 2347
216 Ga0207658_10000113 3300025986 Bacteria 88960
217 Ga0207658_10006956 3300025986 Bacteria 7702
218 Ga0207658_10006993 3300025986 Bacteria 7680
219 Ga0207658_10201717 3300025986 Bacteria 1661
220 Ga0207658_10256413 3300025986 Bacteria 1488
221 Ga0207677_10066180 3300026023 Bacteria 2525
222 Ga0207703_10002619 3300026035 Bacteria 15524
223 Ga0207703_10263477 3300026035 Bacteria 1559
224 Ga0207639_10006160 3300026041 Bacteria 8142
225 Ga0207678_10007543 3300026067 Bacteria 9615
226 Ga0207678_10152735 3300026067 Bacteria 1972
227 Ga0207678_10189200 3300026067 Bacteria 1759
228 Ga0207708_10000787 3300026075 Bacteria 23921
229 Ga0207702_10082772 3300026078 Bacteria 2791
230 Ga0207641_10003451 3300026088 Bacteria 13997
231 Ga0207641_10046978 3300026088 Bacteria 3640
232 Ga0207648_10001756 3300026089 Bacteria 23738
233 Ga0207648_10201227 3300026089 Bacteria 1766
234 Ga0207674_10320191 3300026116 Bacteria 1500
235 Ga0207675_100003125 3300026118 Bacteria 16240
236 Ga0207683_10000990 3300026121 Bacteria 26040
237 Ga0207683_10022683 3300026121 Bacteria 5391
238 Ga0207698_10025126 3300026142 Bacteria 4191
239 Ga0268266_10008889 3300028379 Bacteria 8893
240 Ga0268266_10015525 3300028379 Bacteria 6532
241 Ga0268266_10029328 3300028379 Bacteria 4678
242 Ga0268266_10031388 3300028379 Bacteria 4511
243 Ga0268265_10000040 3300028380 Bacteria 194156
244 Ga0268265_10092349 3300028380 Bacteria 2422
245 Ga0268264_10000017 3300028381 Bacteria 498037
246 Ga0268264_10002402 3300028381 Bacteria 16495
247 Ga0268264_10070448 3300028381 Bacteria 2960
248 Ga0265327_10001869 3300031251 Bacteria 24383
249 Ga0316578_10015304 3300031728 Bacteria 4121
250 Ga0307413_10174742 3300031824 Bacteria 1525
251 Ga0307416_100083921 3300032002 Bacteria 2705
252 Ga0307415_100039425 3300032126 Bacteria 3122
253 Ga0316574_0025202 3300035398 Bacteria 3568
254 Ga0373931_0028466 3300035691 Bacteria 2861
255 Ga0316584_0091506 3300036712 Bacteria 2277
256 Ga0436365_1466271 3300039437 Bacteria 3886
257 Ga0436363_0279243 3300039450 Bacteria 1309
258 Ga0439461_0001829 3300041410 Bacteria 3347
259 Ga0439466_0004397 3300041411 Bacteria 5426
260 Ga0439466_0010299 3300041411 Bacteria 3476
261 Ga0439466_0025624 3300041411 Bacteria 2058
262 Ga0439465_0000494 3300041413 Bacteria 11749
263 Ga0439465_0001755 3300041413 Bacteria 7094
264 Ga0439465_0056112 3300041413 Bacteria 1298
265 Ga0451789_0617823 3300041443 Bacteria 1928
266 Ga0451802_0857407 3300041460 Bacteria 1557
267 Ga0439431_0002999 3300041997 Bacteria 3702
268 Ga0439431_0014129 3300041997 Bacteria 1848
269 Ga0439442_003479 3300042002 Bacteria 3113
270 Ga0439445_0015084 3300042004 Bacteria 1888
271 Ga0439448_0021084 3300042005 Bacteria 2020
272 Ga0439434_0004309 3300042435 Bacteria 4159
273 Ga0439434_0018458 3300042435 Bacteria 2088
274 Ga0466972_0002001 3300044658 Bacteria 9980
275 Ga0466972_0004098 3300044658 Bacteria 7276
276 Ga0466972_0027940 3300044658 Bacteria 2788
277 Ga0466972_0053936 3300044658 Bacteria 1935
278 Ga0466965_0010449 3300044683 Bacteria 4330
279 Ga0466965_0041200 3300044683 Bacteria 2275
280 Ga0466965_0072567 3300044683 Bacteria 1732
281 Ga0466966_0008971 3300044684 Bacteria 6627
282 Ga0466971_0073465 3300044719 Bacteria 1554
283 Ga0466968_0001824 3300044735 Bacteria 7688
284 Ga0466970_0004992 3300044765 Bacteria 6555
285 Ga0466970_0010287 3300044765 Bacteria 4746
286 Ga0466970_0013631 3300044765 Bacteria 4170
287 Ga0466957_0016439 3300044842 Bacteria 4328
288 Ga0466957_0018882 3300044842 Bacteria 4052
289 Ga0466957_0020058 3300044842 Bacteria 3934
290 Ga0466957_0134876 3300044842 Bacteria 1585
291 Ga0466960_0007922 3300044901 Bacteria 4337
292 Ga0466960_0022306 3300044901 Bacteria 2829
293 Ga0466960_0044943 3300044901 Bacteria 2108
294 Ga0466960_0199796 3300044901 Bacteria 1092
295 Ga0466959_0011817 3300045049 Bacteria 6285
296 Ga0466959_0022184 3300045049 Bacteria 4690
297 Ga0466958_0026698 3300045836 Bacteria 3414
298 Ga0466967_0008334 3300045976 Bacteria 7585
299 Ga0466967_0020016 3300045976 Bacteria 5397
300 Ga0466967_0072056 3300045976 Bacteria 3095
301 Ga0466967_0082113 3300045976 Bacteria 2912
302 Ga0466967_0159145 3300045976 Bacteria 2118
303 Ga0495603_0098624 3300046455 Bacteria 1706
304 Ga0495629_0211477 3300046459 Bacteria 1339
305 Ga0495638_0017592 3300046460 Bacteria 4762
306 Ga0495582_0007927 3300046473 Bacteria 5869
307 Ga0495607_0021557 3300046501 Bacteria 4053
308 Ga0495583_0056437 3300046506 Bacteria 1771
309 Ga0495606_0007421 3300046507 Bacteria 9823
310 Ga0495608_0068205 3300046511 Bacteria 2326
311 Ga0495648_0014111 3300046524 Bacteria 5868
312 Ga0495652_0174887 3300046529 Bacteria 1654
313 Ga0495668_0080801 3300046616 Bacteria 1784
314 Ga0495658_0035937 3300046683 Bacteria 2730
315 Ga0495624_0144356 3300046690 Bacteria 1457
316 Ga0495671_0048377 3300046692 Bacteria 2122
317 Ga0495674_0028281 3300047319 Bacteria 5115
318 Ga0495674_0312343 3300047319 Bacteria 1282
319 Ga0495672_0026524 3300047320 Bacteria 3696
320 Ga0495676_0156854 3300047321 Bacteria 1614
321 Ga0495683_0004511 3300047323 Bacteria 7887
322 Ga0495673_0004486 3300047469 Bacteria 8717
323 Ga0495686_0020947 3300047472 Bacteria 4353
324 Ga0495686_0054040 3300047472 Bacteria 2516
325 Ga0495593_0004484 3300047673 Bacteria 8293
326 Ga0496100_0004302 3300048903 Bacteria 7536
327 Ga0496100_0005940 3300048903 Bacteria 6619
328 Ga0496100_0007056 3300048903 Bacteria 6164
329 Ga0496100_0015984 3300048903 Bacteria 4395
330 Ga0496100_0310003 3300048903 Bacteria 1183
331 Ga0496101_0000031 3300048904 Bacteria 195195
332 Ga0496101_0000376 3300048904 Bacteria 29560
333 Ga0496101_0002865 3300048904 Bacteria 10603
334 Ga0496101_0034625 3300048904 Bacteria 3568
335 Ga0496101_0071924 3300048904 Bacteria 2537
336 Ga0496101_0174342 3300048904 Bacteria 1653
337 Ga0496102_0000011 3300048905 Bacteria 321716
338 Ga0496102_0000197 3300048905 Bacteria 81788
339 Ga0496102_0002308 3300048905 Bacteria 16298
340 Ga0496102_0070834 3300048905 Bacteria 3201
341 Ga0496102_0187341 3300048905 Bacteria 1950
342 Ga0496103_0000124 3300048906 Bacteria 83703
343 Ga0496103_0000842 3300048906 Bacteria 22441
344 Ga0496103_0001721 3300048906 Bacteria 14296
345 Ga0496103_0012537 3300048906 Bacteria 5026
346 Ga0496104_0028796 3300048907 Bacteria 5148
347 Ga0496105_0001822 3300048908 Bacteria 15267
348 Ga0496105_0091227 3300048908 Bacteria 2516
349 Ga0496106_0001477 3300048909 Bacteria 17670
350 Ga0496106_0002768 3300048909 Bacteria 12994
351 Ga0496106_0007731 3300048909 Bacteria 7956
352 Ga0496106_0044611 3300048909 Bacteria 3328
353 Ga0496106_0107064 3300048909 Bacteria 2174
354 Ga0496107_0000825 3300048910 Bacteria 18053
355 Ga0496107_0005178 3300048910 Bacteria 8904
356 Ga0496107_0029614 3300048910 Bacteria 3896
357 Ga0496108_0003052 3300048911 Bacteria 13459
358 Ga0496108_0007913 3300048911 Bacteria 8617
359 Ga0496108_0119081 3300048911 Bacteria 2264
360 Ga0496109_0000030 3300048912 Bacteria 164120
361 Ga0496109_0000948 3300048912 Bacteria 24001
362 Ga0496109_0021983 3300048912 Bacteria 5647
363 Ga0496109_0022239 3300048912 Bacteria 5615
364 Ga0496109_0341825 3300048912 Bacteria 1413
365 Ga0496110_0011549 3300048913 Bacteria 7236
366 Ga0496110_0180430 3300048913 Bacteria 1917
367 Ga0496110_0376642 3300048913 Bacteria 1293
368 Ga0496110_0468605 3300048913 Bacteria 1148
369 Ga0496111_0218499 3300048914 Bacteria 1416
370 Ga0496112_0003459 3300048915 Bacteria 13049
371 Ga0496113_0071694 3300048916 Bacteria 2635
372 Ga0496114_0000312 3300048917 Bacteria 35518
373 Ga0496114_0003137 3300048917 Bacteria 12682
374 Ga0496114_0006995 3300048917 Bacteria 8892
375 Ga0496114_0124607 3300048917 Bacteria 2220
376 Ga0496115_0020623 3300048918 Bacteria 5085
377 Ga0496115_0047807 3300048918 Bacteria 3421
378 Ga0496115_0179923 3300048918 Bacteria 1748
379 Ga0496115_0419187 3300048918 Bacteria 1085
380 Ga0496116_0000297 3300048919 Bacteria 83713
381 Ga0496116_0001267 3300048919 Bacteria 29110
382 Ga0496116_0003727 3300048919 Bacteria 14903
383 Ga0496117_0000039 3300048920 Bacteria 322143
384 Ga0496117_0000160 3300048920 Bacteria 141709
385 Ga0496117_0011502 3300048920 Bacteria 7921
386 Ga0496118_0000035 3300048921 Bacteria 322143
387 Ga0496118_0000391 3300048921 Bacteria 74169
388 Ga0496118_0018788 3300048921 Bacteria 6209
389 Ga0496119_0008591 3300048922 Bacteria 8946
390 Ga0496119_0011337 3300048922 Bacteria 7398
391 Ga0496119_0032005 3300048922 Bacteria 3512
392 Ga0496120_0005344 3300048923 Bacteria 10284
393 Ga0496120_0027956 3300048923 Bacteria 3462
394 Ga0496121_0000004 3300048924 Bacteria 1139011
395 Ga0496121_0000425 3300048924 Bacteria 82887
396 Ga0496121_0024475 3300048924 Bacteria 5770
397 Ga0496122_0000138 3300048925 Bacteria 169434
398 Ga0496122_0028122 3300048925 Bacteria 4783
399 Ga0496123_0007604 3300048926 Bacteria 10150
400 Ga0496123_0016687 3300048926 Bacteria 5946
401 Ga0496124_0000012 3300048927 Bacteria 512581
402 Ga0496125_0000003 3300048928 Bacteria 1189767
403 Ga0496125_0199311 3300048928 Bacteria 1313
404 Ga0496126_0000001 3300048929 Bacteria 1139011
405 Ga0496126_0003942 3300048929 Bacteria 18162
406 Ga0496126_0004985 3300048929 Bacteria 15476
407 Ga0496126_0046261 3300048929 Bacteria 3993
408 Ga0501032_0005015 3300049569 Bacteria 9899
409 Ga0501033_0196080 3300049570 Bacteria 1444
410 Ga0501034_0009748 3300049571 Bacteria 10043
411 Ga0501034_0089027 3300049571 Bacteria 3084
412 Ga0501036_0224089 3300049572 Bacteria 1578
413 Ga0501037_0001249 3300049573 Bacteria 18730
414 Ga0501038_0015694 3300049574 Bacteria 6883
415 Ga0501039_0000299 3300049575 Bacteria 35240
416 Ga0501040_0108652 3300049576 Bacteria 1939
417 Ga0501043_0002900 3300049579 Bacteria 14321
418 Ga0501070_0002832 3300049586 Bacteria 15135
419 Ga0501073_0043023 3300049589 Bacteria 3186
420 Ga0501080_0124193 3300049742 Bacteria 2391
421 Ga0501044_0002556 3300049823 Bacteria 20725
422 nmdc:mga03n38_21848_c1 3300050490 Bacteria 2581
423 nmdc:mga03n38_36707_c1 3300050490 Bacteria 2109
424 nmdc:mga03n38_53145_c1 3300050490 Bacteria 1815
425 nmdc:mga03n38_73194_c1 3300050490 Bacteria 1590
426 nmdc:mga00v17_12108_c1 3300050491 Bacteria 4752
427 nmdc:mga00v17_163160_c1 3300050491 Bacteria 1435
428 nmdc:mga00v17_22485_c1 3300050491 Bacteria 3638
429 nmdc:mga00v17_225943_c1 3300050491 Bacteria 1212
430 nmdc:mga00v17_27457_c1 3300050491 Bacteria 3323
431 nmdc:mga00v17_8904_c1 3300050491 Bacteria 5414
432 nmdc:mga00v17_974_c1 3300050491 Bacteria 15331
433 nmdc:mga0yw44_1098_c1 3300050492 Bacteria 10401
434 nmdc:mga0yw44_20738_c2 3300050492 Bacteria 2685
435 nmdc:mga0yw44_52402_c1 3300050492 Bacteria 2473
436 nmdc:mga0yw44_60856_c1 3300050492 Bacteria 2314
437 nmdc:mga06z11_18856_c1 3300050494 Bacteria 3160
438 nmdc:mga07m45_12910_c1 3300050496 Bacteria 3737
439 nmdc:mga07m45_3050_c1 3300050496 Bacteria 7996
440 nmdc:mga07m45_42565_c2 3300050496 Bacteria 2198
441 nmdc:mga07m45_64337_c1 3300050496 Bacteria 2081
442 nmdc:mga05p37_424622_c1 3300050507 Bacteria 1546
443 nmdc:mga05p37_653110_c1 3300050507 Bacteria 1177
444 nmdc:mga0qj67_238431_c1 3300050509 Bacteria 1475
445 nmdc:mga0qj67_36693_c1 3300050509 Bacteria 3836
446 nmdc:mga06r32_99020_c1 3300050510 Bacteria 2859
447 nmdc:mga0sz30_100112_c1 3300050516 Bacteria 1266
448 nmdc:mga0sz30_1052_c1 3300050516 Bacteria 9942
449 nmdc:mga0sz30_13105_c2 3300050516 Bacteria 2711
450 nmdc:mga0sz30_13826_c1 3300050516 Bacteria 3167
451 nmdc:mga0sz30_19956_c1 3300050516 Bacteria 1818
452 nmdc:mga0sz30_41205_c1 3300050516 Bacteria 1941
453 nmdc:mga0sz30_43867_c1 3300050516 Bacteria 1883
454 nmdc:mga0sz30_88909_c1 3300050516 Bacteria 1342
455 Ga0500635_0018492 3300053080 Bacteria 2104
456 Ga0495595_0109916 3300053084 Bacteria 1336
457 Ga0495619_0163734 3300053085 Bacteria 1537
458 Ga0500643_044172 3300053087 Bacteria 1296
459 Ga0500646_0062241 3300053090 Bacteria 1101
460 Ga0500608_112615 3300053122 Bacteria 1245
461 Ga0500652_001098 3300053131 Bacteria 8728
462 Ga0500652_042979 3300053131 Bacteria 1825
463 Ga0500559_0000202 3300053136 Bacteria 47695
464 Ga0500627_0158030 3300053158 Bacteria 1023
465 Ga0500645_000025 3300053730 Bacteria 125835
466 Ga0466962_0031156 3300061719 Bacteria 2553

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0199796 Ga0466960_0199796_50_841 263
2 3300041460 Ga0451802_0857407 Ga0451802_0857407_676_1536 286
3 3300032002 Ga0307416_100083921 Ga0307416_1000839212 293
4 3300006847 Ga0075431_100005649 Ga0075431_1000056497 298
5 3300006880 Ga0075429_100193803 Ga0075429_1001938033 298
6 3300050510 nmdc:mga06r32_99020_c1 nmdc:mga06r32_99020_c1_836_1771 298
7 3300047319 Ga0495674_0312343 Ga0495674_0312343_341_1249 302
8 3300005466 Ga0070685_10057520 Ga0070685_100575203 303
9 3300048909 Ga0496106_0107064 Ga0496106_0107064_1230_2144 303
10 3300049574 Ga0501038_0015694 Ga0501038_0015694_26_937 303
11 3300050516 nmdc:mga0sz30_41205_c1 nmdc:mga0sz30_41205_c1_357_1268 303
12 3300005549 Ga0070704_100371142 Ga0070704_1003711421 304
13 3300005844 Ga0068862_100247599 Ga0068862_1002475992 304
14 3300006844 Ga0075428_100042557 Ga0075428_1000425572 304
15 3300009147 Ga0114129_10649536 Ga0114129_106495362 304
16 3300009147 Ga0114129_10855381 Ga0114129_108553811 304
17 3300026116 Ga0207674_10320191 Ga0207674_103201912 304
18 3300031728 Ga0316578_10015304 Ga0316578_100153044 304
19 3300035398 Ga0316574_0025202 Ga0316574_0025202_676_1677 304
20 3300036712 Ga0316584_0091506 Ga0316584_0091506_1083_2084 304
21 3300050507 nmdc:mga05p37_424622_c1 nmdc:mga05p37_424622_c1_534_1466 304
22 3300050507 nmdc:mga05p37_653110_c1 nmdc:mga05p37_653110_c1_179_1111 304
23 3300044683 Ga0466965_0010449 Ga0466965_0010449_1127_2116 308
24 3300044735 Ga0466968_0001824 Ga0466968_0001824_3759_4748 308
25 3300044901 Ga0466960_0007922 Ga0466960_0007922_2682_3671 308
26 3300045049 Ga0466959_0011817 Ga0466959_0011817_2743_3732 308
27 3300045976 Ga0466967_0008334 Ga0466967_0008334_482_1471 308
28 3300009553 Ga0105249_10000031 Ga0105249_10000031110 309
29 3300025961 Ga0207712_10000029 Ga0207712_10000029110 309
30 3300046455 Ga0495603_0098624 Ga0495603_0098624_74_1018 314
31 3300021384 Ga0213876_10025305 Ga0213876_100253053 321
32 3300039437 Ga0436365_1466271 Ga0436365_1466271_1067_2053 321
33 3300048910 Ga0496107_0005178 Ga0496107_0005178_6804_7772 321
34 iso_pu_bacteria 2523231044 2523382504 323
35 iso_pu_bacteria 2744054611 2744958477 324
36 iso_pu_bacteria 2842888712 2842890726 324
37 iso_pu_bacteria 2547132424 2548694393 325
38 iso_pu_bacteria 2585428094 2587862209 325
39 iso_pu_bacteria 2643221687 2644491188 325
40 iso_pu_bacteria 2643221715 2644637243 325
41 iso_pu_bacteria 2738541264 2738667272 325
42 iso_pu_bacteria 2738541274 2738707394 325
43 iso_pu_bacteria 2738541356 2739146115 325
44 iso_pu_bacteria 2738543028 2739328700 325
45 iso_pu_bacteria 2842134933 2842139569 325
46 iso_pu_bacteria 2902792274 2902797337 325
47 iso_pu_bacteria 2902799365 2902799750 325
48 iso_pu_bacteria 2902810491 2902814627 325
49 iso_pu_bacteria 2902837492 2902843036 325
50 iso_pu_bacteria 2929212328 2929217771 325
51 iso_pu_bacteria 8046352972 8046354126 325
52 3300053136 Ga0500559_0000202 Ga0500559_0000202_23741_24751 326
53 3300005614 Ga0068856_100164408 Ga0068856_1001644083 327
54 3300010375 Ga0105239_10097039 Ga0105239_100970393 327
55 3300025949 Ga0207667_10456681 Ga0207667_104566812 327
56 3300049571 Ga0501034_0089027 Ga0501034_0089027_741_1730 327
57 3300005329 Ga0070683_100338940 Ga0070683_1003389402 328
58 3300005843 Ga0068860_100132298 Ga0068860_1001322982 328
59 3300025986 Ga0207658_10201717 Ga0207658_102017172 328
60 3300028379 Ga0268266_10015525 Ga0268266_100155255 328
61 3300028381 Ga0268264_10070448 Ga0268264_100704482 328
62 3300001977 JGI24746J21847_1004002 JGI24746J21847_10040023 329
63 3300001989 JGI24739J22299_10054539 JGI24739J22299_100545392 329
64 3300002070 JGI24750J21931_1001413 JGI24750J21931_10014133 329
65 3300002074 JGI24748J21848_1003984 JGI24748J21848_10039842 329
66 3300002076 JGI24749J21850_1008965 JGI24749J21850_10089652 329
67 3300002077 JGI24744J21845_10002134 JGI24744J21845_100021345 329
68 3300002244 JGI24742J22300_10003095 JGI24742J22300_100030953 329
69 3300003792 Ga0055540_1000392 Ga0055540_100039238 329
70 3300003792 Ga0055540_1001171 Ga0055540_100117117 329
71 3300003792 Ga0055540_1003464 Ga0055540_10034644 329
72 3300005328 Ga0070676_10002409 Ga0070676_100024099 329
73 3300005328 Ga0070676_10129942 Ga0070676_101299422 329
74 3300005334 Ga0068869_100010877 Ga0068869_1000108773 329
75 3300005334 Ga0068869_100038611 Ga0068869_1000386112 329
76 3300005335 Ga0070666_10006217 Ga0070666_100062178 329
77 3300005337 Ga0070682_100022026 Ga0070682_1000220265 329
78 3300005337 Ga0070682_100031098 Ga0070682_1000310983 329
79 3300005340 Ga0070689_100014146 Ga0070689_1000141463 329
80 3300005340 Ga0070689_100134317 Ga0070689_1001343173 329
81 3300005341 Ga0070691_10002933 Ga0070691_100029335 329
82 3300005347 Ga0070668_100000201 Ga0070668_1000002013 329
83 3300005347 Ga0070668_100001887 Ga0070668_1000018877 329
84 3300005347 Ga0070668_100042214 Ga0070668_1000422142 329
85 3300005353 Ga0070669_100006850 Ga0070669_1000068507 329
86 3300005353 Ga0070669_100051760 Ga0070669_1000517602 329
87 3300005355 Ga0070671_100094176 Ga0070671_1000941764 329
88 3300005356 Ga0070674_100003900 Ga0070674_1000039007 329
89 3300005356 Ga0070674_100062334 Ga0070674_1000623343 329
90 3300005365 Ga0070688_100014899 Ga0070688_1000148993 329
91 3300005366 Ga0070659_100065719 Ga0070659_1000657193 329
92 3300005367 Ga0070667_100000142 Ga0070667_10000014285 329
93 3300005367 Ga0070667_100000752 Ga0070667_1000007525 329
94 3300005367 Ga0070667_100009424 Ga0070667_1000094244 329
95 3300005367 Ga0070667_100014581 Ga0070667_1000145813 329
96 3300005434 Ga0070709_10131588 Ga0070709_101315882 329
97 3300005437 Ga0070710_10000771 Ga0070710_1000077112 329
98 3300005438 Ga0070701_10006164 Ga0070701_100061643 329
99 3300005439 Ga0070711_100007162 Ga0070711_1000071624 329
100 3300005439 Ga0070711_100015606 Ga0070711_1000156064 329
101 3300005440 Ga0070705_100153235 Ga0070705_1001532352 329
102 3300005441 Ga0070700_100000263 Ga0070700_10000026312 329
103 3300005455 Ga0070663_100014385 Ga0070663_1000143854 329
104 3300005455 Ga0070663_100032464 Ga0070663_1000324644 329
105 3300005455 Ga0070663_100112798 Ga0070663_1001127982 329
106 3300005456 Ga0070678_100000712 Ga0070678_10000071212 329
107 3300005457 Ga0070662_100051903 Ga0070662_1000519032 329
108 3300005459 Ga0068867_100000537 Ga0068867_10000053713 329
109 3300005539 Ga0068853_100001294 Ga0068853_10000129412 329
110 3300005539 Ga0068853_100083470 Ga0068853_1000834702 329
111 3300005544 Ga0070686_100025821 Ga0070686_1000258213 329
112 3300005544 Ga0070686_100212103 Ga0070686_1002121032 329
113 3300005545 Ga0070695_100002626 Ga0070695_1000026269 329
114 3300005547 Ga0070693_100001778 Ga0070693_10000177810 329
115 3300005548 Ga0070665_100037891 Ga0070665_1000378915 329
116 3300005548 Ga0070665_100044119 Ga0070665_1000441192 329
117 3300005548 Ga0070665_100086813 Ga0070665_1000868134 329
118 3300005614 Ga0068856_100168126 Ga0068856_1001681262 329
119 3300005615 Ga0070702_100004815 Ga0070702_1000048154 329
120 3300005615 Ga0070702_100143414 Ga0070702_1001434142 329
121 3300005616 Ga0068852_100045827 Ga0068852_1000458273 329
122 3300005616 Ga0068852_100468652 Ga0068852_1004686521 329
123 3300005617 Ga0068859_100001155 Ga0068859_10000115518 329
124 3300005617 Ga0068859_100002067 Ga0068859_1000020676 329
125 3300005718 Ga0068866_10000629 Ga0068866_100006296 329
126 3300005719 Ga0068861_100000739 Ga0068861_10000073917 329
127 3300005841 Ga0068863_100005764 Ga0068863_1000057646 329
128 3300005841 Ga0068863_100026906 Ga0068863_1000269064 329
129 3300005841 Ga0068863_100081541 Ga0068863_1000815412 329
130 3300005842 Ga0068858_100002363 Ga0068858_1000023637 329
131 3300005842 Ga0068858_100022302 Ga0068858_1000223023 329
132 3300005842 Ga0068858_100034389 Ga0068858_1000343893 329
133 3300005842 Ga0068858_100210935 Ga0068858_1002109352 329
134 3300005842 Ga0068858_100295329 Ga0068858_1002953292 329
135 3300005843 Ga0068860_100000160 Ga0068860_1000001609 329
136 3300005843 Ga0068860_100002272 Ga0068860_10000227217 329
137 3300005843 Ga0068860_100099323 Ga0068860_1000993234 329
138 3300005843 Ga0068860_100143223 Ga0068860_1001432232 329
139 3300005844 Ga0068862_100001362 Ga0068862_10000136221 329
140 3300005844 Ga0068862_100017092 Ga0068862_1000170926 329
141 3300005937 Ga0081455_10092322 Ga0081455_100923223 329
142 3300006038 Ga0075365_10004459 Ga0075365_100044595 329
143 3300006038 Ga0075365_10004774 Ga0075365_100047747 329
144 3300006038 Ga0075365_10027057 Ga0075365_100270574 329
145 3300006042 Ga0075368_10052831 Ga0075368_100528312 329
146 3300006048 Ga0075363_100002619 Ga0075363_1000026195 329
147 3300006048 Ga0075363_100015968 Ga0075363_1000159682 329
148 3300006048 Ga0075363_100044588 Ga0075363_1000445882 329
149 3300006051 Ga0075364_10001086 Ga0075364_100010865 329
150 3300006051 Ga0075364_10005904 Ga0075364_100059046 329
151 3300006051 Ga0075364_10015218 Ga0075364_100152182 329
152 3300006051 Ga0075364_10028229 Ga0075364_100282294 329
153 3300006173 Ga0070716_100000613 Ga0070716_1000006139 329
154 3300006175 Ga0070712_100000495 Ga0070712_10000049517 329
155 3300006175 Ga0070712_100003591 Ga0070712_1000035915 329
156 3300006177 Ga0075362_10061159 Ga0075362_100611592 329
157 3300006178 Ga0075367_10021233 Ga0075367_100212335 329
158 3300006186 Ga0075369_10001541 Ga0075369_100015416 329
159 3300006186 Ga0075369_10035878 Ga0075369_100358782 329
160 3300006186 Ga0075369_10042549 Ga0075369_100425492 329
161 3300006186 Ga0075369_10049616 Ga0075369_100496163 329
162 3300006237 Ga0097621_100117596 Ga0097621_1001175962 329
163 3300006353 Ga0075370_10002764 Ga0075370_100027648 329
164 3300006353 Ga0075370_10009460 Ga0075370_100094606 329
165 3300006353 Ga0075370_10041179 Ga0075370_100411792 329
166 3300006353 Ga0075370_10053659 Ga0075370_100536592 329
167 3300006358 Ga0068871_100030273 Ga0068871_1000302736 329
168 3300006881 Ga0068865_100000670 Ga0068865_1000006707 329
169 3300006931 Ga0097620_100001155 Ga0097620_10000115518 329
170 3300006931 Ga0097620_100002067 Ga0097620_1000020676 329
171 3300007788 Ga0099795_10014464 Ga0099795_100144643 329
172 3300009092 Ga0105250_10031654 Ga0105250_100316542 329
173 3300009092 Ga0105250_10051555 Ga0105250_100515552 329
174 3300009094 Ga0111539_10526691 Ga0111539_105266911 329
175 3300009098 Ga0105245_10003258 Ga0105245_100032584 329
176 3300009098 Ga0105245_10006338 Ga0105245_100063389 329
177 3300009101 Ga0105247_10000078 Ga0105247_100000789 329
178 3300009101 Ga0105247_10000433 Ga0105247_1000043325 329
179 3300009147 Ga0114129_10403435 Ga0114129_104034352 329
180 3300009148 Ga0105243_10001959 Ga0105243_100019596 329
181 3300009174 Ga0105241_10076984 Ga0105241_100769841 329
182 3300009174 Ga0105241_10155881 Ga0105241_101558813 329
183 3300009176 Ga0105242_10000858 Ga0105242_1000085811 329
184 3300009177 Ga0105248_10000082 Ga0105248_100000829 329
185 3300009177 Ga0105248_10001630 Ga0105248_1000163012 329
186 3300009545 Ga0105237_10013670 Ga0105237_100136706 329
187 3300009545 Ga0105237_10014302 Ga0105237_100143023 329
188 3300009551 Ga0105238_10154928 Ga0105238_101549282 329
189 3300009551 Ga0105238_10196215 Ga0105238_101962151 329
190 3300009553 Ga0105249_10002952 Ga0105249_100029526 329
191 3300009553 Ga0105249_10006646 Ga0105249_100066467 329
192 3300010375 Ga0105239_10099487 Ga0105239_100994872 329
193 3300010375 Ga0105239_10100150 Ga0105239_101001504 329
194 3300010375 Ga0105239_10102968 Ga0105239_101029683 329
195 3300010375 Ga0105239_10115479 Ga0105239_101154792 329
196 3300010375 Ga0105239_10292072 Ga0105239_102920721 329
197 3300013296 Ga0157374_10064140 Ga0157374_100641403 329
198 3300013297 Ga0157378_10002386 Ga0157378_1000238617 329
199 3300013297 Ga0157378_10134604 Ga0157378_101346041 329
200 3300013306 Ga0163162_10108263 Ga0163162_101082634 329
201 3300013306 Ga0163162_10125638 Ga0163162_101256383 329
202 3300013306 Ga0163162_10181830 Ga0163162_101818302 329
203 3300013307 Ga0157372_10018187 Ga0157372_100181871 329
204 3300013307 Ga0157372_10224071 Ga0157372_102240713 329
205 3300013308 Ga0157375_10000849 Ga0157375_100008497 329
206 3300013308 Ga0157375_10059164 Ga0157375_100591643 329
207 3300014326 Ga0157380_10000339 Ga0157380_1000033917 329
208 3300014745 Ga0157377_10025834 Ga0157377_100258344 329
209 3300014968 Ga0157379_10009573 Ga0157379_1000957310 329
210 3300017792 Ga0163161_10000520 Ga0163161_1000052011 329
211 3300025303 Ga0209051_1000033 Ga0209051_1000033194 329
212 3300025303 Ga0209051_1001272 Ga0209051_10012722 329
213 3300025303 Ga0209051_1006750 Ga0209051_10067502 329
214 3300025303 Ga0209051_1007878 Ga0209051_10078783 329
215 3300025303 Ga0209051_1008784 Ga0209051_10087846 329
216 3300025711 Ga0207696_1026523 Ga0207696_10265232 329
217 3300025898 Ga0207692_10003161 Ga0207692_100031617 329
218 3300025899 Ga0207642_10025532 Ga0207642_100255323 329
219 3300025900 Ga0207710_10000022 Ga0207710_1000002255 329
220 3300025901 Ga0207688_10001068 Ga0207688_100010683 329
221 3300025901 Ga0207688_10003201 Ga0207688_100032014 329
222 3300025903 Ga0207680_10027503 Ga0207680_100275033 329
223 3300025907 Ga0207645_10004966 Ga0207645_100049662 329
224 3300025907 Ga0207645_10130176 Ga0207645_101301761 329
225 3300025914 Ga0207671_10021568 Ga0207671_100215682 329
226 3300025914 Ga0207671_10038881 Ga0207671_100388812 329
227 3300025914 Ga0207671_10129645 Ga0207671_101296452 329
228 3300025915 Ga0207693_10000660 Ga0207693_1000066018 329
229 3300025915 Ga0207693_10011341 Ga0207693_100113416 329
230 3300025916 Ga0207663_10010988 Ga0207663_100109882 329
231 3300025916 Ga0207663_10024744 Ga0207663_100247442 329
232 3300025923 Ga0207681_10002764 Ga0207681_100027647 329
233 3300025923 Ga0207681_10030443 Ga0207681_100304432 329
234 3300025924 Ga0207694_10100412 Ga0207694_101004123 329
235 3300025926 Ga0207659_10113779 Ga0207659_101137792 329
236 3300025927 Ga0207687_10006483 Ga0207687_100064837 329
237 3300025927 Ga0207687_10008737 Ga0207687_100087374 329
238 3300025931 Ga0207644_10068525 Ga0207644_100685252 329
239 3300025931 Ga0207644_10231647 Ga0207644_102316472 329
240 3300025932 Ga0207690_10022446 Ga0207690_100224462 329
241 3300025932 Ga0207690_10228753 Ga0207690_102287531 329
242 3300025933 Ga0207706_10011539 Ga0207706_100115392 329
243 3300025934 Ga0207686_10001835 Ga0207686_100018359 329
244 3300025935 Ga0207709_10171486 Ga0207709_101714861 329
245 3300025935 Ga0207709_10284801 Ga0207709_102848011 329
246 3300025936 Ga0207670_10095399 Ga0207670_100953993 329
247 3300025937 Ga0207669_10000218 Ga0207669_1000021817 329
248 3300025938 Ga0207704_10000179 Ga0207704_1000017916 329
249 3300025939 Ga0207665_10009061 Ga0207665_100090613 329
250 3300025941 Ga0207711_10002041 Ga0207711_1000204119 329
251 3300025941 Ga0207711_10045158 Ga0207711_100451582 329
252 3300025942 Ga0207689_10012044 Ga0207689_100120445 329
253 3300025942 Ga0207689_10049736 Ga0207689_100497362 329
254 3300025949 Ga0207667_10186429 Ga0207667_101864292 329
255 3300025961 Ga0207712_10167812 Ga0207712_101678122 329
256 3300025972 Ga0207668_10002863 Ga0207668_100028637 329
257 3300025972 Ga0207668_10023149 Ga0207668_100231493 329
258 3300025972 Ga0207668_10122662 Ga0207668_101226621 329
259 3300025972 Ga0207668_10277758 Ga0207668_102777581 329
260 3300025981 Ga0207640_10070790 Ga0207640_100707902 329
261 3300025986 Ga0207658_10000113 Ga0207658_1000011382 329
262 3300025986 Ga0207658_10006956 Ga0207658_100069564 329
263 3300025986 Ga0207658_10006993 Ga0207658_100069938 329
264 3300025986 Ga0207658_10256413 Ga0207658_102564132 329
265 3300026023 Ga0207677_10066180 Ga0207677_100661802 329
266 3300026035 Ga0207703_10002619 Ga0207703_1000261912 329
267 3300026035 Ga0207703_10263477 Ga0207703_102634772 329
268 3300026041 Ga0207639_10006160 Ga0207639_100061602 329
269 3300026067 Ga0207678_10007543 Ga0207678_100075434 329
270 3300026067 Ga0207678_10152735 Ga0207678_101527352 329
271 3300026067 Ga0207678_10189200 Ga0207678_101892002 329
272 3300026075 Ga0207708_10000787 Ga0207708_1000078712 329
273 3300026078 Ga0207702_10082772 Ga0207702_100827722 329
274 3300026088 Ga0207641_10003451 Ga0207641_100034516 329
275 3300026088 Ga0207641_10046978 Ga0207641_100469783 329
276 3300026089 Ga0207648_10001756 Ga0207648_1000175613 329
277 3300026089 Ga0207648_10201227 Ga0207648_102012272 329
278 3300026118 Ga0207675_100003125 Ga0207675_1000031256 329
279 3300026121 Ga0207683_10000990 Ga0207683_1000099013 329
280 3300026121 Ga0207683_10022683 Ga0207683_100226832 329
281 3300026142 Ga0207698_10025126 Ga0207698_100251263 329
282 3300028379 Ga0268266_10008889 Ga0268266_100088896 329
283 3300028379 Ga0268266_10029328 Ga0268266_100293286 329
284 3300028379 Ga0268266_10031388 Ga0268266_100313884 329
285 3300028380 Ga0268265_10000040 Ga0268265_1000004081 329
286 3300028380 Ga0268265_10092349 Ga0268265_100923492 329
287 3300028381 Ga0268264_10000017 Ga0268264_10000017260 329
288 3300028381 Ga0268264_10002402 Ga0268264_1000240217 329
289 3300031251 Ga0265327_10001869 Ga0265327_1000186914 329
290 3300031824 Ga0307413_10174742 Ga0307413_101747422 329
291 3300032126 Ga0307415_100039425 Ga0307415_1000394252 329
292 3300035691 Ga0373931_0028466 Ga0373931_0028466_1441_2559 329
293 3300039450 Ga0436363_0279243 Ga0436363_0279243_179_1168 329
294 3300041410 Ga0439461_0001829 Ga0439461_0001829_12_1001 329
295 3300041411 Ga0439466_0004397 Ga0439466_0004397_281_1270 329
296 3300041411 Ga0439466_0010299 Ga0439466_0010299_600_1589 329
297 3300041411 Ga0439466_0025624 Ga0439466_0025624_592_1581 329
298 3300041413 Ga0439465_0000494 Ga0439465_0000494_2648_3637 329
299 3300041413 Ga0439465_0001755 Ga0439465_0001755_5938_6927 329
300 3300041413 Ga0439465_0056112 Ga0439465_0056112_155_1210 329
301 3300041443 Ga0451789_0617823 Ga0451789_0617823_588_1577 329
302 3300041997 Ga0439431_0002999 Ga0439431_0002999_2110_3099 329
303 3300041997 Ga0439431_0014129 Ga0439431_0014129_671_1660 329
304 3300042002 Ga0439442_003479 Ga0439442_003479_1227_2216 329
305 3300042004 Ga0439445_0015084 Ga0439445_0015084_487_1476 329
306 3300042005 Ga0439448_0021084 Ga0439448_0021084_653_1645 329
307 3300042435 Ga0439434_0004309 Ga0439434_0004309_911_1900 329
308 3300042435 Ga0439434_0018458 Ga0439434_0018458_1049_2038 329
309 3300044658 Ga0466972_0002001 Ga0466972_0002001_6202_7191 329
310 3300044658 Ga0466972_0004098 Ga0466972_0004098_2341_3330 329
311 3300044658 Ga0466972_0027940 Ga0466972_0027940_698_1687 329
312 3300044658 Ga0466972_0053936 Ga0466972_0053936_505_1494 329
313 3300044683 Ga0466965_0041200 Ga0466965_0041200_107_1096 329
314 3300044683 Ga0466965_0072567 Ga0466965_0072567_167_1159 329
315 3300044684 Ga0466966_0008971 Ga0466966_0008971_824_1813 329
316 3300044719 Ga0466971_0073465 Ga0466971_0073465_14_1003 329
317 3300044765 Ga0466970_0004992 Ga0466970_0004992_5479_6468 329
318 3300044765 Ga0466970_0010287 Ga0466970_0010287_1061_2050 329
319 3300044765 Ga0466970_0013631 Ga0466970_0013631_3159_4148 329
320 3300044842 Ga0466957_0016439 Ga0466957_0016439_3186_4175 329
321 3300044842 Ga0466957_0018882 Ga0466957_0018882_845_1834 329
322 3300044842 Ga0466957_0020058 Ga0466957_0020058_1987_2976 329
323 3300044842 Ga0466957_0134876 Ga0466957_0134876_110_1099 329
324 3300044901 Ga0466960_0022306 Ga0466960_0022306_341_1330 329
325 3300044901 Ga0466960_0044943 Ga0466960_0044943_1055_2044 329
326 3300045049 Ga0466959_0022184 Ga0466959_0022184_3434_4423 329
327 3300045836 Ga0466958_0026698 Ga0466958_0026698_551_1540 329
328 3300045976 Ga0466967_0020016 Ga0466967_0020016_2760_3752 329
329 3300045976 Ga0466967_0072056 Ga0466967_0072056_1506_2495 329
330 3300045976 Ga0466967_0082113 Ga0466967_0082113_807_1796 329
331 3300045976 Ga0466967_0159145 Ga0466967_0159145_563_1552 329
332 3300046459 Ga0495629_0211477 Ga0495629_0211477_99_1088 329
333 3300046460 Ga0495638_0017592 Ga0495638_0017592_2984_3973 329
334 3300046473 Ga0495582_0007927 Ga0495582_0007927_3755_4744 329
335 3300046501 Ga0495607_0021557 Ga0495607_0021557_2238_3230 329
336 3300046506 Ga0495583_0056437 Ga0495583_0056437_745_1737 329
337 3300046507 Ga0495606_0007421 Ga0495606_0007421_6707_7705 329
338 3300046511 Ga0495608_0068205 Ga0495608_0068205_86_1075 329
339 3300046524 Ga0495648_0014111 Ga0495648_0014111_2192_3190 329
340 3300046529 Ga0495652_0174887 Ga0495652_0174887_539_1528 329
341 3300046616 Ga0495668_0080801 Ga0495668_0080801_320_1318 329
342 3300046683 Ga0495658_0035937 Ga0495658_0035937_947_1936 329
343 3300046690 Ga0495624_0144356 Ga0495624_0144356_222_1256 329
344 3300046692 Ga0495671_0048377 Ga0495671_0048377_842_1840 329
345 3300047319 Ga0495674_0028281 Ga0495674_0028281_3413_4402 329
346 3300047320 Ga0495672_0026524 Ga0495672_0026524_2218_3216 329
347 3300047321 Ga0495676_0156854 Ga0495676_0156854_394_1383 329
348 3300047323 Ga0495683_0004511 Ga0495683_0004511_3322_4314 329
349 3300047469 Ga0495673_0004486 Ga0495673_0004486_602_1600 329
350 3300047472 Ga0495686_0020947 Ga0495686_0020947_1716_2705 329
351 3300047472 Ga0495686_0054040 Ga0495686_0054040_145_1203 329
352 3300047673 Ga0495593_0004484 Ga0495593_0004484_2962_3951 329
353 3300048903 Ga0496100_0004302 Ga0496100_0004302_5410_6402 329
354 3300048903 Ga0496100_0005940 Ga0496100_0005940_2978_3976 329
355 3300048903 Ga0496100_0007056 Ga0496100_0007056_3124_4242 329
356 3300048903 Ga0496100_0015984 Ga0496100_0015984_554_1546 329
357 3300048903 Ga0496100_0310003 Ga0496100_0310003_55_1044 329
358 3300048904 Ga0496101_0000031 Ga0496101_0000031_191580_192578 329
359 3300048904 Ga0496101_0000376 Ga0496101_0000376_1616_2608 329
360 3300048904 Ga0496101_0002865 Ga0496101_0002865_780_1769 329
361 3300048904 Ga0496101_0034625 Ga0496101_0034625_2174_3292 329
362 3300048904 Ga0496101_0071924 Ga0496101_0071924_67_1056 329
363 3300048904 Ga0496101_0174342 Ga0496101_0174342_625_1617 329
364 3300048905 Ga0496102_0000011 Ga0496102_0000011_79783_80781 329
365 3300048905 Ga0496102_0000197 Ga0496102_0000197_61802_62791 329
366 3300048905 Ga0496102_0002308 Ga0496102_0002308_1046_2164 329
367 3300048905 Ga0496102_0070834 Ga0496102_0070834_1116_2108 329
368 3300048905 Ga0496102_0187341 Ga0496102_0187341_908_1897 329
369 3300048906 Ga0496103_0000124 Ga0496103_0000124_79783_80781 329
370 3300048906 Ga0496103_0000842 Ga0496103_0000842_1133_2125 329
371 3300048906 Ga0496103_0001721 Ga0496103_0001721_8611_9600 329
372 3300048906 Ga0496103_0012537 Ga0496103_0012537_1856_2974 329
373 3300048907 Ga0496104_0028796 Ga0496104_0028796_3913_4902 329
374 3300048908 Ga0496105_0001822 Ga0496105_0001822_1475_2467 329
375 3300048908 Ga0496105_0091227 Ga0496105_0091227_318_1307 329
376 3300048909 Ga0496106_0001477 Ga0496106_0001477_13481_14473 329
377 3300048909 Ga0496106_0002768 Ga0496106_0002768_10369_11487 329
378 3300048909 Ga0496106_0007731 Ga0496106_0007731_6613_7605 329
379 3300048909 Ga0496106_0044611 Ga0496106_0044611_1457_2455 329
380 3300048910 Ga0496107_0000825 Ga0496107_0000825_5533_6651 329
381 3300048910 Ga0496107_0029614 Ga0496107_0029614_2026_3015 329
382 3300048911 Ga0496108_0003052 Ga0496108_0003052_4347_5336 329
383 3300048911 Ga0496108_0007913 Ga0496108_0007913_4950_5942 329
384 3300048911 Ga0496108_0119081 Ga0496108_0119081_1030_2019 329
385 3300048912 Ga0496109_0000030 Ga0496109_0000030_156179_157171 329
386 3300048912 Ga0496109_0000948 Ga0496109_0000948_19840_20829 329
387 3300048912 Ga0496109_0021983 Ga0496109_0021983_1777_2766 329
388 3300048912 Ga0496109_0022239 Ga0496109_0022239_1693_2682 329
389 3300048912 Ga0496109_0341825 Ga0496109_0341825_202_1191 329
390 3300048913 Ga0496110_0011549 Ga0496110_0011549_1107_2099 329
391 3300048913 Ga0496110_0180430 Ga0496110_0180430_577_1566 329
392 3300048913 Ga0496110_0376642 Ga0496110_0376642_256_1245 329
393 3300048913 Ga0496110_0468605 Ga0496110_0468605_18_1007 329
394 3300048914 Ga0496111_0218499 Ga0496111_0218499_174_1163 329
395 3300048915 Ga0496112_0003459 Ga0496112_0003459_7375_8364 329
396 3300048916 Ga0496113_0071694 Ga0496113_0071694_418_1407 329
397 3300048917 Ga0496114_0000312 Ga0496114_0000312_25998_26990 329
398 3300048917 Ga0496114_0003137 Ga0496114_0003137_2186_3304 329
399 3300048917 Ga0496114_0006995 Ga0496114_0006995_1130_2122 329
400 3300048917 Ga0496114_0124607 Ga0496114_0124607_65_1057 329
401 3300048918 Ga0496115_0020623 Ga0496115_0020623_2844_3836 329
402 3300048918 Ga0496115_0047807 Ga0496115_0047807_1897_2889 329
403 3300048918 Ga0496115_0179923 Ga0496115_0179923_610_1728 329
404 3300048918 Ga0496115_0419187 Ga0496115_0419187_60_1052 329
405 3300048919 Ga0496116_0000297 Ga0496116_0000297_79783_80781 329
406 3300048919 Ga0496116_0001267 Ga0496116_0001267_26984_27976 329
407 3300048919 Ga0496116_0003727 Ga0496116_0003727_2659_3648 329
408 3300048920 Ga0496117_0000039 Ga0496117_0000039_241363_242361 329
409 3300048920 Ga0496117_0000160 Ga0496117_0000160_74471_75460 329
410 3300048920 Ga0496117_0011502 Ga0496117_0011502_1798_2790 329
411 3300048921 Ga0496118_0000035 Ga0496118_0000035_79783_80781 329
412 3300048921 Ga0496118_0000391 Ga0496118_0000391_18870_19859 329
413 3300048921 Ga0496118_0018788 Ga0496118_0018788_4083_5075 329
414 3300048922 Ga0496119_0008591 Ga0496119_0008591_1121_2113 329
415 3300048922 Ga0496119_0011337 Ga0496119_0011337_3043_4041 329
416 3300048922 Ga0496119_0032005 Ga0496119_0032005_730_1719 329
417 3300048923 Ga0496120_0005344 Ga0496120_0005344_2644_3642 329
418 3300048923 Ga0496120_0027956 Ga0496120_0027956_1364_2356 329
419 3300048924 Ga0496121_0000004 Ga0496121_0000004_478997_479989 329
420 3300048924 Ga0496121_0000425 Ga0496121_0000425_78989_79987 329
421 3300048924 Ga0496121_0024475 Ga0496121_0024475_4552_5541 329
422 3300048925 Ga0496122_0000138 Ga0496122_0000138_6829_7821 329
423 3300048925 Ga0496122_0028122 Ga0496122_0028122_2562_3551 329
424 3300048926 Ga0496123_0007604 Ga0496123_0007604_3369_4361 329
425 3300048926 Ga0496123_0016687 Ga0496123_0016687_3445_4434 329
426 3300048927 Ga0496124_0000012 Ga0496124_0000012_203790_204782 329
427 3300048928 Ga0496125_0000003 Ga0496125_0000003_709779_710771 329
428 3300048928 Ga0496125_0199311 Ga0496125_0199311_177_1166 329
429 3300048929 Ga0496126_0000001 Ga0496126_0000001_478997_479989 329
430 3300048929 Ga0496126_0003942 Ga0496126_0003942_11055_12044 329
431 3300048929 Ga0496126_0004985 Ga0496126_0004985_3087_4085 329
432 3300048929 Ga0496126_0046261 Ga0496126_0046261_655_1644 329
433 3300049569 Ga0501032_0005015 Ga0501032_0005015_6587_7576 329
434 3300049570 Ga0501033_0196080 Ga0501033_0196080_33_1022 329
435 3300049571 Ga0501034_0009748 Ga0501034_0009748_7747_8736 329
436 3300049572 Ga0501036_0224089 Ga0501036_0224089_335_1324 329
437 3300049573 Ga0501037_0001249 Ga0501037_0001249_7939_8928 329
438 3300049575 Ga0501039_0000299 Ga0501039_0000299_18472_19461 329
439 3300049576 Ga0501040_0108652 Ga0501040_0108652_94_1083 329
440 3300049579 Ga0501043_0002900 Ga0501043_0002900_2506_3495 329
441 3300049586 Ga0501070_0002832 Ga0501070_0002832_5958_6947 329
442 3300049589 Ga0501073_0043023 Ga0501073_0043023_1869_2858 329
443 3300049742 Ga0501080_0124193 Ga0501080_0124193_1378_2367 329
444 3300049823 Ga0501044_0002556 Ga0501044_0002556_13343_14332 329
445 3300050490 nmdc:mga03n38_21848_c1 nmdc:mga03n38_21848_c1_1215_2243 329
446 3300050490 nmdc:mga03n38_36707_c1 nmdc:mga03n38_36707_c1_385_1401 329
447 3300050490 nmdc:mga03n38_53145_c1 nmdc:mga03n38_53145_c1_664_1692 329
448 3300050490 nmdc:mga03n38_73194_c1 nmdc:mga03n38_73194_c1_207_1223 329
449 3300050491 nmdc:mga00v17_12108_c1 nmdc:mga00v17_12108_c1_1149_2138 329
450 3300050491 nmdc:mga00v17_163160_c1 nmdc:mga00v17_163160_c1_250_1239 329
451 3300050491 nmdc:mga00v17_22485_c1 nmdc:mga00v17_22485_c1_1780_2808 329
452 3300050491 nmdc:mga00v17_225943_c1 nmdc:mga00v17_225943_c1_13_1002 329
453 3300050491 nmdc:mga00v17_27457_c1 nmdc:mga00v17_27457_c1_803_1792 329
454 3300050491 nmdc:mga00v17_8904_c1 nmdc:mga00v17_8904_c1_322_1311 329
455 3300050491 nmdc:mga00v17_974_c1 nmdc:mga00v17_974_c1_1189_2214 329
456 3300050492 nmdc:mga0yw44_1098_c1 nmdc:mga0yw44_1098_c1_5710_6738 329
457 3300050492 nmdc:mga0yw44_20738_c2 nmdc:mga0yw44_20738_c2_403_1392 329
458 3300050492 nmdc:mga0yw44_52402_c1 nmdc:mga0yw44_52402_c1_410_1399 329
459 3300050492 nmdc:mga0yw44_60856_c1 nmdc:mga0yw44_60856_c1_596_1588 329
460 3300050494 nmdc:mga06z11_18856_c1 nmdc:mga06z11_18856_c1_1795_2784 329
461 3300050496 nmdc:mga07m45_12910_c1 nmdc:mga07m45_12910_c1_404_1432 329
462 3300050496 nmdc:mga07m45_3050_c1 nmdc:mga07m45_3050_c1_5508_6536 329
463 3300050496 nmdc:mga07m45_42565_c2 nmdc:mga07m45_42565_c2_203_1192 329
464 3300050496 nmdc:mga07m45_64337_c1 nmdc:mga07m45_64337_c1_550_1539 329
465 3300050509 nmdc:mga0qj67_238431_c1 nmdc:mga0qj67_238431_c1_363_1388 329
466 3300050509 nmdc:mga0qj67_36693_c1 nmdc:mga0qj67_36693_c1_2505_3494 329
467 3300050516 nmdc:mga0sz30_100112_c1 nmdc:mga0sz30_100112_c1_243_1232 329
468 3300050516 nmdc:mga0sz30_1052_c1 nmdc:mga0sz30_1052_c1_3415_4440 329
469 3300050516 nmdc:mga0sz30_13105_c2 nmdc:mga0sz30_13105_c2_1480_2469 329
470 3300050516 nmdc:mga0sz30_13826_c1 nmdc:mga0sz30_13826_c1_1813_2802 329
471 3300050516 nmdc:mga0sz30_19956_c1 nmdc:mga0sz30_19956_c1_442_1431 329
472 3300050516 nmdc:mga0sz30_43867_c1 nmdc:mga0sz30_43867_c1_498_1487 329
473 3300050516 nmdc:mga0sz30_88909_c1 nmdc:mga0sz30_88909_c1_71_1060 329
474 3300053080 Ga0500635_0018492 Ga0500635_0018492_61_1053 329
475 3300053084 Ga0495595_0109916 Ga0495595_0109916_116_1105 329
476 3300053085 Ga0495619_0163734 Ga0495619_0163734_33_1022 329
477 3300053087 Ga0500643_044172 Ga0500643_044172_129_1118 329
478 3300053090 Ga0500646_0062241 Ga0500646_0062241_50_1039 329
479 3300053122 Ga0500608_112615 Ga0500608_112615_156_1148 329
480 3300053131 Ga0500652_001098 Ga0500652_001098_5129_6121 329
481 3300053131 Ga0500652_042979 Ga0500652_042979_133_1122 329
482 3300053158 Ga0500627_0158030 Ga0500627_0158030_13_1005 329
483 3300053730 Ga0500645_000025 Ga0500645_000025_115838_116827 329
484 3300061719 Ga0466962_0031156 Ga0466962_0031156_147_1136 329
485 iso_pu_bacteria 2939582691 2939585013 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

44

345

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8547 1 328
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8388 1 328
1luc-assembly1.cif.gz_A bacterial luciferase 0.8351 1 329
1luc-assembly1.cif.gz_A bacterial luciferase 0.8255 1 329
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8241 1 328
ID Description Score Start End Superfamily
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8998 1 321 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8883 1 321 3.20.20.30
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8611 39 329 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8431 2 317 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8248 2 329 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A3N2D1K6-F1-model_v4 F420-dependent oxidoreductase-like protein 0.9858 1 329 GO:0008726
GO:0046306
AF-A0A3N2D1K6-F1-model_v4 F420-dependent oxidoreductase-like protein 0.9799 1 329 GO:0008726
GO:0046306
AF-A0A7C0YIY5-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9583 1 261 GO:0008726
GO:0046306
AF-A0A7W1C6G0-F1-model_v4 TIGR03560 family F420-dependent LLM class oxidoreductase 0.9516 33 235 GO:0008726
GO:0046306
AF-A0A838DNK8-F1-model_v4 TIGR03560 family F420-dependent LLM class oxidoreductase 0.9472 40 201 GO:0008726
GO:0046306

Feature Viewer

pLDDT pTM Quality
95.94 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map