F453032
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 268 | 466 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10054539|JGI24739J22299_100545392 |
| Length | 372 |
| Sequence | MADLCHLPAWKLVGHVESDGALVEMRLRGLAGPTVGGGIESTVMRFGLFIPQGWRLDLVDIPTDKHWQVMRDLAAYADGGPWDSLWVYDHFHTIPMPTHEATHEAWSLMSAYAATTSRIKLGQMCTAMGYRNPVYLAKVAATADXISGGRVQMGIGGGWYEHEWKAYGYGFPSAGVRLGMLDEGVQIMRDAWRKGVVSLHGKHYQVDGAIVEPKPLQEGGLPLWIAGGGEKVTLRIAAKYAQYTNFTSEPGGFEHKSQVLADHCRDVGSDYGAIVRSANFNAVVGESEADVKERVARVRARLVAKANEAAVDPMLATVTSPDSASGTPEQVVEKLKRLRDLGCEYAILNFPEAAYDRSGIELFEREVIPALS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 6 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 7 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 8 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 9 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 10 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 11 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 12 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 13 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 14 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 15 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 16 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 17 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 18 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 19 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 22 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 23 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 24 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 167 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 168 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 169 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 172 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 173 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 174 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 250 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 261 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 262 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 263 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 264 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 267 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 268 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.08 |
| Metatranscriptomes | 0 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.61 |
| Nodule | 0.21 |
| Rhizoplane | 11.55 |
| Rhizosphere | 65.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1004002 | 3300001977 | Bacteria | 2328 |
| 2 | JGI24739J22299_10054539 | 3300001989 | Bacteria | 1280 |
| 3 | JGI24750J21931_1001413 | 3300002070 | Bacteria | 3002 |
| 4 | JGI24748J21848_1003984 | 3300002074 | Bacteria | 1693 |
| 5 | JGI24749J21850_1008965 | 3300002076 | Bacteria | 1397 |
| 6 | JGI24744J21845_10002134 | 3300002077 | Bacteria | 4015 |
| 7 | JGI24742J22300_10003095 | 3300002244 | Bacteria | 2692 |
| 8 | Ga0055540_1000392 | 3300003792 | Bacteria | 35964 |
| 9 | Ga0055540_1001171 | 3300003792 | Bacteria | 16270 |
| 10 | Ga0055540_1003464 | 3300003792 | Bacteria | 7619 |
| 11 | Ga0070676_10002409 | 3300005328 | Bacteria | 9582 |
| 12 | Ga0070676_10129942 | 3300005328 | Bacteria | 1591 |
| 13 | Ga0070683_100338940 | 3300005329 | Bacteria | 1431 |
| 14 | Ga0068869_100010877 | 3300005334 | Bacteria | 5952 |
| 15 | Ga0068869_100038611 | 3300005334 | Bacteria | 3405 |
| 16 | Ga0070666_10006217 | 3300005335 | Bacteria | 7346 |
| 17 | Ga0070682_100022026 | 3300005337 | Bacteria | 3769 |
| 18 | Ga0070682_100031098 | 3300005337 | Bacteria | 3228 |
| 19 | Ga0070689_100014146 | 3300005340 | Bacteria | 5790 |
| 20 | Ga0070689_100134317 | 3300005340 | Bacteria | 1986 |
| 21 | Ga0070691_10002933 | 3300005341 | Bacteria | 7646 |
| 22 | Ga0070668_100000201 | 3300005347 | Bacteria | 39161 |
| 23 | Ga0070668_100001887 | 3300005347 | Bacteria | 15322 |
| 24 | Ga0070668_100042214 | 3300005347 | Bacteria | 3495 |
| 25 | Ga0070669_100006850 | 3300005353 | Bacteria | 8197 |
| 26 | Ga0070669_100051760 | 3300005353 | Bacteria | 3003 |
| 27 | Ga0070671_100094176 | 3300005355 | Bacteria | 2510 |
| 28 | Ga0070674_100003900 | 3300005356 | Bacteria | 8445 |
| 29 | Ga0070674_100062334 | 3300005356 | Bacteria | 2605 |
| 30 | Ga0070688_100014899 | 3300005365 | Bacteria | 4413 |
| 31 | Ga0070659_100065719 | 3300005366 | Bacteria | 2873 |
| 32 | Ga0070667_100000142 | 3300005367 | Bacteria | 90696 |
| 33 | Ga0070667_100000752 | 3300005367 | Bacteria | 30896 |
| 34 | Ga0070667_100009424 | 3300005367 | Bacteria | 8100 |
| 35 | Ga0070667_100014581 | 3300005367 | Bacteria | 6496 |
| 36 | Ga0070709_10131588 | 3300005434 | Bacteria | 1709 |
| 37 | Ga0070710_10000771 | 3300005437 | Bacteria | 15308 |
| 38 | Ga0070701_10006164 | 3300005438 | Bacteria | 5028 |
| 39 | Ga0070711_100007162 | 3300005439 | Bacteria | 6771 |
| 40 | Ga0070711_100015606 | 3300005439 | Bacteria | 4809 |
| 41 | Ga0070705_100153235 | 3300005440 | Bacteria | 1531 |
| 42 | Ga0070700_100000263 | 3300005441 | Bacteria | 28075 |
| 43 | Ga0070663_100014385 | 3300005455 | Bacteria | 5080 |
| 44 | Ga0070663_100032464 | 3300005455 | Bacteria | 3599 |
| 45 | Ga0070663_100112798 | 3300005455 | Bacteria | 2045 |
| 46 | Ga0070678_100000712 | 3300005456 | Bacteria | 16488 |
| 47 | Ga0070662_100051903 | 3300005457 | Bacteria | 2963 |
| 48 | Ga0068867_100000537 | 3300005459 | Bacteria | 24926 |
| 49 | Ga0070685_10057520 | 3300005466 | Bacteria | 2264 |
| 50 | Ga0068853_100001294 | 3300005539 | Bacteria | 17970 |
| 51 | Ga0068853_100083470 | 3300005539 | Bacteria | 2799 |
| 52 | Ga0070686_100025821 | 3300005544 | Bacteria | 3538 |
| 53 | Ga0070686_100212103 | 3300005544 | Bacteria | 1395 |
| 54 | Ga0070695_100002626 | 3300005545 | Bacteria | 10385 |
| 55 | Ga0070693_100001778 | 3300005547 | Bacteria | 9827 |
| 56 | Ga0070665_100037891 | 3300005548 | Bacteria | 4846 |
| 57 | Ga0070665_100044119 | 3300005548 | Bacteria | 4478 |
| 58 | Ga0070665_100086813 | 3300005548 | Bacteria | 3134 |
| 59 | Ga0070704_100371142 | 3300005549 | Bacteria | 1213 |
| 60 | Ga0068856_100164408 | 3300005614 | Bacteria | 2230 |
| 61 | Ga0068856_100168126 | 3300005614 | Bacteria | 2204 |
| 62 | Ga0070702_100004815 | 3300005615 | Bacteria | 6204 |
| 63 | Ga0070702_100143414 | 3300005615 | Bacteria | 1524 |
| 64 | Ga0068852_100045827 | 3300005616 | Bacteria | 3722 |
| 65 | Ga0068852_100468652 | 3300005616 | Bacteria | 1250 |
| 66 | Ga0068859_100001155 | 3300005617 | Bacteria | 26941 |
| 67 | Ga0068859_100002067 | 3300005617 | Bacteria | 20487 |
| 68 | Ga0068866_10000629 | 3300005718 | Bacteria | 16020 |
| 69 | Ga0068861_100000739 | 3300005719 | Bacteria | 19591 |
| 70 | Ga0068863_100005764 | 3300005841 | Bacteria | 12154 |
| 71 | Ga0068863_100026906 | 3300005841 | Bacteria | 5485 |
| 72 | Ga0068863_100081541 | 3300005841 | Bacteria | 3065 |
| 73 | Ga0068858_100002363 | 3300005842 | Bacteria | 19075 |
| 74 | Ga0068858_100022302 | 3300005842 | Bacteria | 5912 |
| 75 | Ga0068858_100034389 | 3300005842 | Bacteria | 4700 |
| 76 | Ga0068858_100210935 | 3300005842 | Bacteria | 1838 |
| 77 | Ga0068858_100295329 | 3300005842 | Bacteria | 1545 |
| 78 | Ga0068860_100000160 | 3300005843 | Bacteria | 110266 |
| 79 | Ga0068860_100002272 | 3300005843 | Bacteria | 20190 |
| 80 | Ga0068860_100099323 | 3300005843 | Bacteria | 2776 |
| 81 | Ga0068860_100132298 | 3300005843 | Bacteria | 2395 |
| 82 | Ga0068860_100143223 | 3300005843 | Bacteria | 2298 |
| 83 | Ga0068862_100001362 | 3300005844 | Bacteria | 22694 |
| 84 | Ga0068862_100017092 | 3300005844 | Bacteria | 6036 |
| 85 | Ga0068862_100247599 | 3300005844 | Bacteria | 1623 |
| 86 | Ga0081455_10092322 | 3300005937 | Bacteria | 2449 |
| 87 | Ga0075365_10004459 | 3300006038 | Bacteria | 7419 |
| 88 | Ga0075365_10004774 | 3300006038 | Bacteria | 7229 |
| 89 | Ga0075365_10027057 | 3300006038 | Bacteria | 3645 |
| 90 | Ga0075368_10052831 | 3300006042 | Bacteria | 1617 |
| 91 | Ga0075363_100002619 | 3300006048 | Bacteria | 7411 |
| 92 | Ga0075363_100015968 | 3300006048 | Bacteria | 3701 |
| 93 | Ga0075363_100044588 | 3300006048 | Bacteria | 2350 |
| 94 | Ga0075364_10001086 | 3300006051 | Bacteria | 14506 |
| 95 | Ga0075364_10005904 | 3300006051 | Bacteria | 7153 |
| 96 | Ga0075364_10015218 | 3300006051 | Bacteria | 4766 |
| 97 | Ga0075364_10028229 | 3300006051 | Bacteria | 3591 |
| 98 | Ga0070716_100000613 | 3300006173 | Bacteria | 15075 |
| 99 | Ga0070712_100000495 | 3300006175 | Bacteria | 22525 |
| 100 | Ga0070712_100003591 | 3300006175 | Bacteria | 9558 |
| 101 | Ga0075362_10061159 | 3300006177 | Bacteria | 1704 |
| 102 | Ga0075367_10021233 | 3300006178 | Bacteria | 3626 |
| 103 | Ga0075369_10001541 | 3300006186 | Bacteria | 7896 |
| 104 | Ga0075369_10035878 | 3300006186 | Bacteria | 2109 |
| 105 | Ga0075369_10042549 | 3300006186 | Bacteria | 1948 |
| 106 | Ga0075369_10049616 | 3300006186 | Bacteria | 1813 |
| 107 | Ga0097621_100117596 | 3300006237 | Bacteria | 2253 |
| 108 | Ga0075370_10002764 | 3300006353 | Bacteria | 8218 |
| 109 | Ga0075370_10009460 | 3300006353 | Bacteria | 5063 |
| 110 | Ga0075370_10041179 | 3300006353 | Bacteria | 2608 |
| 111 | Ga0075370_10053659 | 3300006353 | Bacteria | 2288 |
| 112 | Ga0068871_100030273 | 3300006358 | Bacteria | 4261 |
| 113 | Ga0075428_100042557 | 3300006844 | Bacteria | 4994 |
| 114 | Ga0075431_100005649 | 3300006847 | Bacteria | 12358 |
| 115 | Ga0075429_100193803 | 3300006880 | Bacteria | 1780 |
| 116 | Ga0068865_100000670 | 3300006881 | Bacteria | 19290 |
| 117 | Ga0097620_100001155 | 3300006931 | Bacteria | 26941 |
| 118 | Ga0097620_100002067 | 3300006931 | Bacteria | 20487 |
| 119 | Ga0099795_10014464 | 3300007788 | Bacteria | 2448 |
| 120 | Ga0105250_10031654 | 3300009092 | Bacteria | 2123 |
| 121 | Ga0105250_10051555 | 3300009092 | Bacteria | 1651 |
| 122 | Ga0111539_10526691 | 3300009094 | Bacteria | 1377 |
| 123 | Ga0105245_10003258 | 3300009098 | Bacteria | 14558 |
| 124 | Ga0105245_10006338 | 3300009098 | Bacteria | 10410 |
| 125 | Ga0105247_10000078 | 3300009101 | Bacteria | 110404 |
| 126 | Ga0105247_10000433 | 3300009101 | Bacteria | 35512 |
| 127 | Ga0114129_10403435 | 3300009147 | Bacteria | 1801 |
| 128 | Ga0114129_10649536 | 3300009147 | Bacteria | 1362 |
| 129 | Ga0114129_10855381 | 3300009147 | Bacteria | 1156 |
| 130 | Ga0105243_10001959 | 3300009148 | Bacteria | 17537 |
| 131 | Ga0105241_10076984 | 3300009174 | Bacteria | 2603 |
| 132 | Ga0105241_10155881 | 3300009174 | Bacteria | 1873 |
| 133 | Ga0105242_10000858 | 3300009176 | Bacteria | 23563 |
| 134 | Ga0105248_10000082 | 3300009177 | Bacteria | 110759 |
| 135 | Ga0105248_10001630 | 3300009177 | Bacteria | 24938 |
| 136 | Ga0105237_10013670 | 3300009545 | Bacteria | 8501 |
| 137 | Ga0105237_10014302 | 3300009545 | Bacteria | 8307 |
| 138 | Ga0105238_10154928 | 3300009551 | Bacteria | 2266 |
| 139 | Ga0105238_10196215 | 3300009551 | Bacteria | 1994 |
| 140 | Ga0105249_10000031 | 3300009553 | Bacteria | 220006 |
| 141 | Ga0105249_10002952 | 3300009553 | Bacteria | 14673 |
| 142 | Ga0105249_10006646 | 3300009553 | Bacteria | 10064 |
| 143 | Ga0105239_10097039 | 3300010375 | Bacteria | 3257 |
| 144 | Ga0105239_10099487 | 3300010375 | Bacteria | 3215 |
| 145 | Ga0105239_10100150 | 3300010375 | Bacteria | 3205 |
| 146 | Ga0105239_10102968 | 3300010375 | Bacteria | 3160 |
| 147 | Ga0105239_10115479 | 3300010375 | Bacteria | 2978 |
| 148 | Ga0105239_10292072 | 3300010375 | Bacteria | 1836 |
| 149 | Ga0157374_10064140 | 3300013296 | Bacteria | 3446 |
| 150 | Ga0157378_10002386 | 3300013297 | Bacteria | 16682 |
| 151 | Ga0157378_10134604 | 3300013297 | Bacteria | 2290 |
| 152 | Ga0163162_10108263 | 3300013306 | Bacteria | 2875 |
| 153 | Ga0163162_10125638 | 3300013306 | Bacteria | 2671 |
| 154 | Ga0163162_10181830 | 3300013306 | Bacteria | 2229 |
| 155 | Ga0157372_10018187 | 3300013307 | Bacteria | 7554 |
| 156 | Ga0157372_10224071 | 3300013307 | Bacteria | 2180 |
| 157 | Ga0157375_10000849 | 3300013308 | Bacteria | 26601 |
| 158 | Ga0157375_10059164 | 3300013308 | Bacteria | 3795 |
| 159 | Ga0157380_10000339 | 3300014326 | Bacteria | 27956 |
| 160 | Ga0157377_10025834 | 3300014745 | Bacteria | 3136 |
| 161 | Ga0157379_10009573 | 3300014968 | Bacteria | 8438 |
| 162 | Ga0163161_10000520 | 3300017792 | Bacteria | 31388 |
| 163 | Ga0213876_10025305 | 3300021384 | Bacteria | 3132 |
| 164 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 165 | Ga0209051_1001272 | 3300025303 | Bacteria | 22502 |
| 166 | Ga0209051_1006750 | 3300025303 | Bacteria | 6405 |
| 167 | Ga0209051_1007878 | 3300025303 | Bacteria | 5746 |
| 168 | Ga0209051_1008784 | 3300025303 | Bacteria | 5301 |
| 169 | Ga0207696_1026523 | 3300025711 | Bacteria | 1792 |
| 170 | Ga0207692_10003161 | 3300025898 | Bacteria | 6392 |
| 171 | Ga0207642_10025532 | 3300025899 | Bacteria | 2392 |
| 172 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 173 | Ga0207688_10001068 | 3300025901 | Bacteria | 14029 |
| 174 | Ga0207688_10003201 | 3300025901 | Bacteria | 8937 |
| 175 | Ga0207680_10027503 | 3300025903 | Bacteria | 3168 |
| 176 | Ga0207645_10004966 | 3300025907 | Bacteria | 9748 |
| 177 | Ga0207645_10130176 | 3300025907 | Bacteria | 1637 |
| 178 | Ga0207671_10021568 | 3300025914 | Bacteria | 4884 |
| 179 | Ga0207671_10038881 | 3300025914 | Bacteria | 3525 |
| 180 | Ga0207671_10129645 | 3300025914 | Bacteria | 1935 |
| 181 | Ga0207693_10000660 | 3300025915 | Bacteria | 30957 |
| 182 | Ga0207693_10011341 | 3300025915 | Bacteria | 7216 |
| 183 | Ga0207663_10010988 | 3300025916 | Bacteria | 4840 |
| 184 | Ga0207663_10024744 | 3300025916 | Bacteria | 3462 |
| 185 | Ga0207681_10002764 | 3300025923 | Bacteria | 11101 |
| 186 | Ga0207681_10030443 | 3300025923 | Bacteria | 3519 |
| 187 | Ga0207694_10100412 | 3300025924 | Bacteria | 2293 |
| 188 | Ga0207659_10113779 | 3300025926 | Bacteria | 2062 |
| 189 | Ga0207687_10006483 | 3300025927 | Bacteria | 7728 |
| 190 | Ga0207687_10008737 | 3300025927 | Bacteria | 6619 |
| 191 | Ga0207644_10068525 | 3300025931 | Bacteria | 2588 |
| 192 | Ga0207644_10231647 | 3300025931 | Bacteria | 1468 |
| 193 | Ga0207690_10022446 | 3300025932 | Bacteria | 3927 |
| 194 | Ga0207690_10228753 | 3300025932 | Bacteria | 1426 |
| 195 | Ga0207706_10011539 | 3300025933 | Bacteria | 8046 |
| 196 | Ga0207686_10001835 | 3300025934 | Bacteria | 11817 |
| 197 | Ga0207709_10171486 | 3300025935 | Bacteria | 1523 |
| 198 | Ga0207709_10284801 | 3300025935 | Bacteria | 1222 |
| 199 | Ga0207670_10095399 | 3300025936 | Bacteria | 2112 |
| 200 | Ga0207669_10000218 | 3300025937 | Bacteria | 26144 |
| 201 | Ga0207704_10000179 | 3300025938 | Bacteria | 33399 |
| 202 | Ga0207665_10009061 | 3300025939 | Bacteria | 6533 |
| 203 | Ga0207711_10002041 | 3300025941 | Bacteria | 18263 |
| 204 | Ga0207711_10045158 | 3300025941 | Bacteria | 3764 |
| 205 | Ga0207689_10012044 | 3300025942 | Bacteria | 7412 |
| 206 | Ga0207689_10049736 | 3300025942 | Bacteria | 3458 |
| 207 | Ga0207667_10186429 | 3300025949 | Bacteria | 2130 |
| 208 | Ga0207667_10456681 | 3300025949 | Bacteria | 1298 |
| 209 | Ga0207712_10000029 | 3300025961 | Bacteria | 220014 |
| 210 | Ga0207712_10167812 | 3300025961 | Bacteria | 1713 |
| 211 | Ga0207668_10002863 | 3300025972 | Bacteria | 10113 |
| 212 | Ga0207668_10023149 | 3300025972 | Bacteria | 3987 |
| 213 | Ga0207668_10122662 | 3300025972 | Bacteria | 1970 |
| 214 | Ga0207668_10277758 | 3300025972 | Bacteria | 1372 |
| 215 | Ga0207640_10070790 | 3300025981 | Bacteria | 2347 |
| 216 | Ga0207658_10000113 | 3300025986 | Bacteria | 88960 |
| 217 | Ga0207658_10006956 | 3300025986 | Bacteria | 7702 |
| 218 | Ga0207658_10006993 | 3300025986 | Bacteria | 7680 |
| 219 | Ga0207658_10201717 | 3300025986 | Bacteria | 1661 |
| 220 | Ga0207658_10256413 | 3300025986 | Bacteria | 1488 |
| 221 | Ga0207677_10066180 | 3300026023 | Bacteria | 2525 |
| 222 | Ga0207703_10002619 | 3300026035 | Bacteria | 15524 |
| 223 | Ga0207703_10263477 | 3300026035 | Bacteria | 1559 |
| 224 | Ga0207639_10006160 | 3300026041 | Bacteria | 8142 |
| 225 | Ga0207678_10007543 | 3300026067 | Bacteria | 9615 |
| 226 | Ga0207678_10152735 | 3300026067 | Bacteria | 1972 |
| 227 | Ga0207678_10189200 | 3300026067 | Bacteria | 1759 |
| 228 | Ga0207708_10000787 | 3300026075 | Bacteria | 23921 |
| 229 | Ga0207702_10082772 | 3300026078 | Bacteria | 2791 |
| 230 | Ga0207641_10003451 | 3300026088 | Bacteria | 13997 |
| 231 | Ga0207641_10046978 | 3300026088 | Bacteria | 3640 |
| 232 | Ga0207648_10001756 | 3300026089 | Bacteria | 23738 |
| 233 | Ga0207648_10201227 | 3300026089 | Bacteria | 1766 |
| 234 | Ga0207674_10320191 | 3300026116 | Bacteria | 1500 |
| 235 | Ga0207675_100003125 | 3300026118 | Bacteria | 16240 |
| 236 | Ga0207683_10000990 | 3300026121 | Bacteria | 26040 |
| 237 | Ga0207683_10022683 | 3300026121 | Bacteria | 5391 |
| 238 | Ga0207698_10025126 | 3300026142 | Bacteria | 4191 |
| 239 | Ga0268266_10008889 | 3300028379 | Bacteria | 8893 |
| 240 | Ga0268266_10015525 | 3300028379 | Bacteria | 6532 |
| 241 | Ga0268266_10029328 | 3300028379 | Bacteria | 4678 |
| 242 | Ga0268266_10031388 | 3300028379 | Bacteria | 4511 |
| 243 | Ga0268265_10000040 | 3300028380 | Bacteria | 194156 |
| 244 | Ga0268265_10092349 | 3300028380 | Bacteria | 2422 |
| 245 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 246 | Ga0268264_10002402 | 3300028381 | Bacteria | 16495 |
| 247 | Ga0268264_10070448 | 3300028381 | Bacteria | 2960 |
| 248 | Ga0265327_10001869 | 3300031251 | Bacteria | 24383 |
| 249 | Ga0316578_10015304 | 3300031728 | Bacteria | 4121 |
| 250 | Ga0307413_10174742 | 3300031824 | Bacteria | 1525 |
| 251 | Ga0307416_100083921 | 3300032002 | Bacteria | 2705 |
| 252 | Ga0307415_100039425 | 3300032126 | Bacteria | 3122 |
| 253 | Ga0316574_0025202 | 3300035398 | Bacteria | 3568 |
| 254 | Ga0373931_0028466 | 3300035691 | Bacteria | 2861 |
| 255 | Ga0316584_0091506 | 3300036712 | Bacteria | 2277 |
| 256 | Ga0436365_1466271 | 3300039437 | Bacteria | 3886 |
| 257 | Ga0436363_0279243 | 3300039450 | Bacteria | 1309 |
| 258 | Ga0439461_0001829 | 3300041410 | Bacteria | 3347 |
| 259 | Ga0439466_0004397 | 3300041411 | Bacteria | 5426 |
| 260 | Ga0439466_0010299 | 3300041411 | Bacteria | 3476 |
| 261 | Ga0439466_0025624 | 3300041411 | Bacteria | 2058 |
| 262 | Ga0439465_0000494 | 3300041413 | Bacteria | 11749 |
| 263 | Ga0439465_0001755 | 3300041413 | Bacteria | 7094 |
| 264 | Ga0439465_0056112 | 3300041413 | Bacteria | 1298 |
| 265 | Ga0451789_0617823 | 3300041443 | Bacteria | 1928 |
| 266 | Ga0451802_0857407 | 3300041460 | Bacteria | 1557 |
| 267 | Ga0439431_0002999 | 3300041997 | Bacteria | 3702 |
| 268 | Ga0439431_0014129 | 3300041997 | Bacteria | 1848 |
| 269 | Ga0439442_003479 | 3300042002 | Bacteria | 3113 |
| 270 | Ga0439445_0015084 | 3300042004 | Bacteria | 1888 |
| 271 | Ga0439448_0021084 | 3300042005 | Bacteria | 2020 |
| 272 | Ga0439434_0004309 | 3300042435 | Bacteria | 4159 |
| 273 | Ga0439434_0018458 | 3300042435 | Bacteria | 2088 |
| 274 | Ga0466972_0002001 | 3300044658 | Bacteria | 9980 |
| 275 | Ga0466972_0004098 | 3300044658 | Bacteria | 7276 |
| 276 | Ga0466972_0027940 | 3300044658 | Bacteria | 2788 |
| 277 | Ga0466972_0053936 | 3300044658 | Bacteria | 1935 |
| 278 | Ga0466965_0010449 | 3300044683 | Bacteria | 4330 |
| 279 | Ga0466965_0041200 | 3300044683 | Bacteria | 2275 |
| 280 | Ga0466965_0072567 | 3300044683 | Bacteria | 1732 |
| 281 | Ga0466966_0008971 | 3300044684 | Bacteria | 6627 |
| 282 | Ga0466971_0073465 | 3300044719 | Bacteria | 1554 |
| 283 | Ga0466968_0001824 | 3300044735 | Bacteria | 7688 |
| 284 | Ga0466970_0004992 | 3300044765 | Bacteria | 6555 |
| 285 | Ga0466970_0010287 | 3300044765 | Bacteria | 4746 |
| 286 | Ga0466970_0013631 | 3300044765 | Bacteria | 4170 |
| 287 | Ga0466957_0016439 | 3300044842 | Bacteria | 4328 |
| 288 | Ga0466957_0018882 | 3300044842 | Bacteria | 4052 |
| 289 | Ga0466957_0020058 | 3300044842 | Bacteria | 3934 |
| 290 | Ga0466957_0134876 | 3300044842 | Bacteria | 1585 |
| 291 | Ga0466960_0007922 | 3300044901 | Bacteria | 4337 |
| 292 | Ga0466960_0022306 | 3300044901 | Bacteria | 2829 |
| 293 | Ga0466960_0044943 | 3300044901 | Bacteria | 2108 |
| 294 | Ga0466960_0199796 | 3300044901 | Bacteria | 1092 |
| 295 | Ga0466959_0011817 | 3300045049 | Bacteria | 6285 |
| 296 | Ga0466959_0022184 | 3300045049 | Bacteria | 4690 |
| 297 | Ga0466958_0026698 | 3300045836 | Bacteria | 3414 |
| 298 | Ga0466967_0008334 | 3300045976 | Bacteria | 7585 |
| 299 | Ga0466967_0020016 | 3300045976 | Bacteria | 5397 |
| 300 | Ga0466967_0072056 | 3300045976 | Bacteria | 3095 |
| 301 | Ga0466967_0082113 | 3300045976 | Bacteria | 2912 |
| 302 | Ga0466967_0159145 | 3300045976 | Bacteria | 2118 |
| 303 | Ga0495603_0098624 | 3300046455 | Bacteria | 1706 |
| 304 | Ga0495629_0211477 | 3300046459 | Bacteria | 1339 |
| 305 | Ga0495638_0017592 | 3300046460 | Bacteria | 4762 |
| 306 | Ga0495582_0007927 | 3300046473 | Bacteria | 5869 |
| 307 | Ga0495607_0021557 | 3300046501 | Bacteria | 4053 |
| 308 | Ga0495583_0056437 | 3300046506 | Bacteria | 1771 |
| 309 | Ga0495606_0007421 | 3300046507 | Bacteria | 9823 |
| 310 | Ga0495608_0068205 | 3300046511 | Bacteria | 2326 |
| 311 | Ga0495648_0014111 | 3300046524 | Bacteria | 5868 |
| 312 | Ga0495652_0174887 | 3300046529 | Bacteria | 1654 |
| 313 | Ga0495668_0080801 | 3300046616 | Bacteria | 1784 |
| 314 | Ga0495658_0035937 | 3300046683 | Bacteria | 2730 |
| 315 | Ga0495624_0144356 | 3300046690 | Bacteria | 1457 |
| 316 | Ga0495671_0048377 | 3300046692 | Bacteria | 2122 |
| 317 | Ga0495674_0028281 | 3300047319 | Bacteria | 5115 |
| 318 | Ga0495674_0312343 | 3300047319 | Bacteria | 1282 |
| 319 | Ga0495672_0026524 | 3300047320 | Bacteria | 3696 |
| 320 | Ga0495676_0156854 | 3300047321 | Bacteria | 1614 |
| 321 | Ga0495683_0004511 | 3300047323 | Bacteria | 7887 |
| 322 | Ga0495673_0004486 | 3300047469 | Bacteria | 8717 |
| 323 | Ga0495686_0020947 | 3300047472 | Bacteria | 4353 |
| 324 | Ga0495686_0054040 | 3300047472 | Bacteria | 2516 |
| 325 | Ga0495593_0004484 | 3300047673 | Bacteria | 8293 |
| 326 | Ga0496100_0004302 | 3300048903 | Bacteria | 7536 |
| 327 | Ga0496100_0005940 | 3300048903 | Bacteria | 6619 |
| 328 | Ga0496100_0007056 | 3300048903 | Bacteria | 6164 |
| 329 | Ga0496100_0015984 | 3300048903 | Bacteria | 4395 |
| 330 | Ga0496100_0310003 | 3300048903 | Bacteria | 1183 |
| 331 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 332 | Ga0496101_0000376 | 3300048904 | Bacteria | 29560 |
| 333 | Ga0496101_0002865 | 3300048904 | Bacteria | 10603 |
| 334 | Ga0496101_0034625 | 3300048904 | Bacteria | 3568 |
| 335 | Ga0496101_0071924 | 3300048904 | Bacteria | 2537 |
| 336 | Ga0496101_0174342 | 3300048904 | Bacteria | 1653 |
| 337 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 338 | Ga0496102_0000197 | 3300048905 | Bacteria | 81788 |
| 339 | Ga0496102_0002308 | 3300048905 | Bacteria | 16298 |
| 340 | Ga0496102_0070834 | 3300048905 | Bacteria | 3201 |
| 341 | Ga0496102_0187341 | 3300048905 | Bacteria | 1950 |
| 342 | Ga0496103_0000124 | 3300048906 | Bacteria | 83703 |
| 343 | Ga0496103_0000842 | 3300048906 | Bacteria | 22441 |
| 344 | Ga0496103_0001721 | 3300048906 | Bacteria | 14296 |
| 345 | Ga0496103_0012537 | 3300048906 | Bacteria | 5026 |
| 346 | Ga0496104_0028796 | 3300048907 | Bacteria | 5148 |
| 347 | Ga0496105_0001822 | 3300048908 | Bacteria | 15267 |
| 348 | Ga0496105_0091227 | 3300048908 | Bacteria | 2516 |
| 349 | Ga0496106_0001477 | 3300048909 | Bacteria | 17670 |
| 350 | Ga0496106_0002768 | 3300048909 | Bacteria | 12994 |
| 351 | Ga0496106_0007731 | 3300048909 | Bacteria | 7956 |
| 352 | Ga0496106_0044611 | 3300048909 | Bacteria | 3328 |
| 353 | Ga0496106_0107064 | 3300048909 | Bacteria | 2174 |
| 354 | Ga0496107_0000825 | 3300048910 | Bacteria | 18053 |
| 355 | Ga0496107_0005178 | 3300048910 | Bacteria | 8904 |
| 356 | Ga0496107_0029614 | 3300048910 | Bacteria | 3896 |
| 357 | Ga0496108_0003052 | 3300048911 | Bacteria | 13459 |
| 358 | Ga0496108_0007913 | 3300048911 | Bacteria | 8617 |
| 359 | Ga0496108_0119081 | 3300048911 | Bacteria | 2264 |
| 360 | Ga0496109_0000030 | 3300048912 | Bacteria | 164120 |
| 361 | Ga0496109_0000948 | 3300048912 | Bacteria | 24001 |
| 362 | Ga0496109_0021983 | 3300048912 | Bacteria | 5647 |
| 363 | Ga0496109_0022239 | 3300048912 | Bacteria | 5615 |
| 364 | Ga0496109_0341825 | 3300048912 | Bacteria | 1413 |
| 365 | Ga0496110_0011549 | 3300048913 | Bacteria | 7236 |
| 366 | Ga0496110_0180430 | 3300048913 | Bacteria | 1917 |
| 367 | Ga0496110_0376642 | 3300048913 | Bacteria | 1293 |
| 368 | Ga0496110_0468605 | 3300048913 | Bacteria | 1148 |
| 369 | Ga0496111_0218499 | 3300048914 | Bacteria | 1416 |
| 370 | Ga0496112_0003459 | 3300048915 | Bacteria | 13049 |
| 371 | Ga0496113_0071694 | 3300048916 | Bacteria | 2635 |
| 372 | Ga0496114_0000312 | 3300048917 | Bacteria | 35518 |
| 373 | Ga0496114_0003137 | 3300048917 | Bacteria | 12682 |
| 374 | Ga0496114_0006995 | 3300048917 | Bacteria | 8892 |
| 375 | Ga0496114_0124607 | 3300048917 | Bacteria | 2220 |
| 376 | Ga0496115_0020623 | 3300048918 | Bacteria | 5085 |
| 377 | Ga0496115_0047807 | 3300048918 | Bacteria | 3421 |
| 378 | Ga0496115_0179923 | 3300048918 | Bacteria | 1748 |
| 379 | Ga0496115_0419187 | 3300048918 | Bacteria | 1085 |
| 380 | Ga0496116_0000297 | 3300048919 | Bacteria | 83713 |
| 381 | Ga0496116_0001267 | 3300048919 | Bacteria | 29110 |
| 382 | Ga0496116_0003727 | 3300048919 | Bacteria | 14903 |
| 383 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 384 | Ga0496117_0000160 | 3300048920 | Bacteria | 141709 |
| 385 | Ga0496117_0011502 | 3300048920 | Bacteria | 7921 |
| 386 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 387 | Ga0496118_0000391 | 3300048921 | Bacteria | 74169 |
| 388 | Ga0496118_0018788 | 3300048921 | Bacteria | 6209 |
| 389 | Ga0496119_0008591 | 3300048922 | Bacteria | 8946 |
| 390 | Ga0496119_0011337 | 3300048922 | Bacteria | 7398 |
| 391 | Ga0496119_0032005 | 3300048922 | Bacteria | 3512 |
| 392 | Ga0496120_0005344 | 3300048923 | Bacteria | 10284 |
| 393 | Ga0496120_0027956 | 3300048923 | Bacteria | 3462 |
| 394 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 395 | Ga0496121_0000425 | 3300048924 | Bacteria | 82887 |
| 396 | Ga0496121_0024475 | 3300048924 | Bacteria | 5770 |
| 397 | Ga0496122_0000138 | 3300048925 | Bacteria | 169434 |
| 398 | Ga0496122_0028122 | 3300048925 | Bacteria | 4783 |
| 399 | Ga0496123_0007604 | 3300048926 | Bacteria | 10150 |
| 400 | Ga0496123_0016687 | 3300048926 | Bacteria | 5946 |
| 401 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 402 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 403 | Ga0496125_0199311 | 3300048928 | Bacteria | 1313 |
| 404 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 405 | Ga0496126_0003942 | 3300048929 | Bacteria | 18162 |
| 406 | Ga0496126_0004985 | 3300048929 | Bacteria | 15476 |
| 407 | Ga0496126_0046261 | 3300048929 | Bacteria | 3993 |
| 408 | Ga0501032_0005015 | 3300049569 | Bacteria | 9899 |
| 409 | Ga0501033_0196080 | 3300049570 | Bacteria | 1444 |
| 410 | Ga0501034_0009748 | 3300049571 | Bacteria | 10043 |
| 411 | Ga0501034_0089027 | 3300049571 | Bacteria | 3084 |
| 412 | Ga0501036_0224089 | 3300049572 | Bacteria | 1578 |
| 413 | Ga0501037_0001249 | 3300049573 | Bacteria | 18730 |
| 414 | Ga0501038_0015694 | 3300049574 | Bacteria | 6883 |
| 415 | Ga0501039_0000299 | 3300049575 | Bacteria | 35240 |
| 416 | Ga0501040_0108652 | 3300049576 | Bacteria | 1939 |
| 417 | Ga0501043_0002900 | 3300049579 | Bacteria | 14321 |
| 418 | Ga0501070_0002832 | 3300049586 | Bacteria | 15135 |
| 419 | Ga0501073_0043023 | 3300049589 | Bacteria | 3186 |
| 420 | Ga0501080_0124193 | 3300049742 | Bacteria | 2391 |
| 421 | Ga0501044_0002556 | 3300049823 | Bacteria | 20725 |
| 422 | nmdc:mga03n38_21848_c1 | 3300050490 | Bacteria | 2581 |
| 423 | nmdc:mga03n38_36707_c1 | 3300050490 | Bacteria | 2109 |
| 424 | nmdc:mga03n38_53145_c1 | 3300050490 | Bacteria | 1815 |
| 425 | nmdc:mga03n38_73194_c1 | 3300050490 | Bacteria | 1590 |
| 426 | nmdc:mga00v17_12108_c1 | 3300050491 | Bacteria | 4752 |
| 427 | nmdc:mga00v17_163160_c1 | 3300050491 | Bacteria | 1435 |
| 428 | nmdc:mga00v17_22485_c1 | 3300050491 | Bacteria | 3638 |
| 429 | nmdc:mga00v17_225943_c1 | 3300050491 | Bacteria | 1212 |
| 430 | nmdc:mga00v17_27457_c1 | 3300050491 | Bacteria | 3323 |
| 431 | nmdc:mga00v17_8904_c1 | 3300050491 | Bacteria | 5414 |
| 432 | nmdc:mga00v17_974_c1 | 3300050491 | Bacteria | 15331 |
| 433 | nmdc:mga0yw44_1098_c1 | 3300050492 | Bacteria | 10401 |
| 434 | nmdc:mga0yw44_20738_c2 | 3300050492 | Bacteria | 2685 |
| 435 | nmdc:mga0yw44_52402_c1 | 3300050492 | Bacteria | 2473 |
| 436 | nmdc:mga0yw44_60856_c1 | 3300050492 | Bacteria | 2314 |
| 437 | nmdc:mga06z11_18856_c1 | 3300050494 | Bacteria | 3160 |
| 438 | nmdc:mga07m45_12910_c1 | 3300050496 | Bacteria | 3737 |
| 439 | nmdc:mga07m45_3050_c1 | 3300050496 | Bacteria | 7996 |
| 440 | nmdc:mga07m45_42565_c2 | 3300050496 | Bacteria | 2198 |
| 441 | nmdc:mga07m45_64337_c1 | 3300050496 | Bacteria | 2081 |
| 442 | nmdc:mga05p37_424622_c1 | 3300050507 | Bacteria | 1546 |
| 443 | nmdc:mga05p37_653110_c1 | 3300050507 | Bacteria | 1177 |
| 444 | nmdc:mga0qj67_238431_c1 | 3300050509 | Bacteria | 1475 |
| 445 | nmdc:mga0qj67_36693_c1 | 3300050509 | Bacteria | 3836 |
| 446 | nmdc:mga06r32_99020_c1 | 3300050510 | Bacteria | 2859 |
| 447 | nmdc:mga0sz30_100112_c1 | 3300050516 | Bacteria | 1266 |
| 448 | nmdc:mga0sz30_1052_c1 | 3300050516 | Bacteria | 9942 |
| 449 | nmdc:mga0sz30_13105_c2 | 3300050516 | Bacteria | 2711 |
| 450 | nmdc:mga0sz30_13826_c1 | 3300050516 | Bacteria | 3167 |
| 451 | nmdc:mga0sz30_19956_c1 | 3300050516 | Bacteria | 1818 |
| 452 | nmdc:mga0sz30_41205_c1 | 3300050516 | Bacteria | 1941 |
| 453 | nmdc:mga0sz30_43867_c1 | 3300050516 | Bacteria | 1883 |
| 454 | nmdc:mga0sz30_88909_c1 | 3300050516 | Bacteria | 1342 |
| 455 | Ga0500635_0018492 | 3300053080 | Bacteria | 2104 |
| 456 | Ga0495595_0109916 | 3300053084 | Bacteria | 1336 |
| 457 | Ga0495619_0163734 | 3300053085 | Bacteria | 1537 |
| 458 | Ga0500643_044172 | 3300053087 | Bacteria | 1296 |
| 459 | Ga0500646_0062241 | 3300053090 | Bacteria | 1101 |
| 460 | Ga0500608_112615 | 3300053122 | Bacteria | 1245 |
| 461 | Ga0500652_001098 | 3300053131 | Bacteria | 8728 |
| 462 | Ga0500652_042979 | 3300053131 | Bacteria | 1825 |
| 463 | Ga0500559_0000202 | 3300053136 | Bacteria | 47695 |
| 464 | Ga0500627_0158030 | 3300053158 | Bacteria | 1023 |
| 465 | Ga0500645_000025 | 3300053730 | Bacteria | 125835 |
| 466 | Ga0466962_0031156 | 3300061719 | Bacteria | 2553 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044901 | Ga0466960_0199796 | Ga0466960_0199796_50_841 | 263 |
| 2 | 3300041460 | Ga0451802_0857407 | Ga0451802_0857407_676_1536 | 286 |
| 3 | 3300032002 | Ga0307416_100083921 | Ga0307416_1000839212 | 293 |
| 4 | 3300006847 | Ga0075431_100005649 | Ga0075431_1000056497 | 298 |
| 5 | 3300006880 | Ga0075429_100193803 | Ga0075429_1001938033 | 298 |
| 6 | 3300050510 | nmdc:mga06r32_99020_c1 | nmdc:mga06r32_99020_c1_836_1771 | 298 |
| 7 | 3300047319 | Ga0495674_0312343 | Ga0495674_0312343_341_1249 | 302 |
| 8 | 3300005466 | Ga0070685_10057520 | Ga0070685_100575203 | 303 |
| 9 | 3300048909 | Ga0496106_0107064 | Ga0496106_0107064_1230_2144 | 303 |
| 10 | 3300049574 | Ga0501038_0015694 | Ga0501038_0015694_26_937 | 303 |
| 11 | 3300050516 | nmdc:mga0sz30_41205_c1 | nmdc:mga0sz30_41205_c1_357_1268 | 303 |
| 12 | 3300005549 | Ga0070704_100371142 | Ga0070704_1003711421 | 304 |
| 13 | 3300005844 | Ga0068862_100247599 | Ga0068862_1002475992 | 304 |
| 14 | 3300006844 | Ga0075428_100042557 | Ga0075428_1000425572 | 304 |
| 15 | 3300009147 | Ga0114129_10649536 | Ga0114129_106495362 | 304 |
| 16 | 3300009147 | Ga0114129_10855381 | Ga0114129_108553811 | 304 |
| 17 | 3300026116 | Ga0207674_10320191 | Ga0207674_103201912 | 304 |
| 18 | 3300031728 | Ga0316578_10015304 | Ga0316578_100153044 | 304 |
| 19 | 3300035398 | Ga0316574_0025202 | Ga0316574_0025202_676_1677 | 304 |
| 20 | 3300036712 | Ga0316584_0091506 | Ga0316584_0091506_1083_2084 | 304 |
| 21 | 3300050507 | nmdc:mga05p37_424622_c1 | nmdc:mga05p37_424622_c1_534_1466 | 304 |
| 22 | 3300050507 | nmdc:mga05p37_653110_c1 | nmdc:mga05p37_653110_c1_179_1111 | 304 |
| 23 | 3300044683 | Ga0466965_0010449 | Ga0466965_0010449_1127_2116 | 308 |
| 24 | 3300044735 | Ga0466968_0001824 | Ga0466968_0001824_3759_4748 | 308 |
| 25 | 3300044901 | Ga0466960_0007922 | Ga0466960_0007922_2682_3671 | 308 |
| 26 | 3300045049 | Ga0466959_0011817 | Ga0466959_0011817_2743_3732 | 308 |
| 27 | 3300045976 | Ga0466967_0008334 | Ga0466967_0008334_482_1471 | 308 |
| 28 | 3300009553 | Ga0105249_10000031 | Ga0105249_10000031110 | 309 |
| 29 | 3300025961 | Ga0207712_10000029 | Ga0207712_10000029110 | 309 |
| 30 | 3300046455 | Ga0495603_0098624 | Ga0495603_0098624_74_1018 | 314 |
| 31 | 3300021384 | Ga0213876_10025305 | Ga0213876_100253053 | 321 |
| 32 | 3300039437 | Ga0436365_1466271 | Ga0436365_1466271_1067_2053 | 321 |
| 33 | 3300048910 | Ga0496107_0005178 | Ga0496107_0005178_6804_7772 | 321 |
| 34 | iso_pu_bacteria | 2523231044 | 2523382504 | 323 |
| 35 | iso_pu_bacteria | 2744054611 | 2744958477 | 324 |
| 36 | iso_pu_bacteria | 2842888712 | 2842890726 | 324 |
| 37 | iso_pu_bacteria | 2547132424 | 2548694393 | 325 |
| 38 | iso_pu_bacteria | 2585428094 | 2587862209 | 325 |
| 39 | iso_pu_bacteria | 2643221687 | 2644491188 | 325 |
| 40 | iso_pu_bacteria | 2643221715 | 2644637243 | 325 |
| 41 | iso_pu_bacteria | 2738541264 | 2738667272 | 325 |
| 42 | iso_pu_bacteria | 2738541274 | 2738707394 | 325 |
| 43 | iso_pu_bacteria | 2738541356 | 2739146115 | 325 |
| 44 | iso_pu_bacteria | 2738543028 | 2739328700 | 325 |
| 45 | iso_pu_bacteria | 2842134933 | 2842139569 | 325 |
| 46 | iso_pu_bacteria | 2902792274 | 2902797337 | 325 |
| 47 | iso_pu_bacteria | 2902799365 | 2902799750 | 325 |
| 48 | iso_pu_bacteria | 2902810491 | 2902814627 | 325 |
| 49 | iso_pu_bacteria | 2902837492 | 2902843036 | 325 |
| 50 | iso_pu_bacteria | 2929212328 | 2929217771 | 325 |
| 51 | iso_pu_bacteria | 8046352972 | 8046354126 | 325 |
| 52 | 3300053136 | Ga0500559_0000202 | Ga0500559_0000202_23741_24751 | 326 |
| 53 | 3300005614 | Ga0068856_100164408 | Ga0068856_1001644083 | 327 |
| 54 | 3300010375 | Ga0105239_10097039 | Ga0105239_100970393 | 327 |
| 55 | 3300025949 | Ga0207667_10456681 | Ga0207667_104566812 | 327 |
| 56 | 3300049571 | Ga0501034_0089027 | Ga0501034_0089027_741_1730 | 327 |
| 57 | 3300005329 | Ga0070683_100338940 | Ga0070683_1003389402 | 328 |
| 58 | 3300005843 | Ga0068860_100132298 | Ga0068860_1001322982 | 328 |
| 59 | 3300025986 | Ga0207658_10201717 | Ga0207658_102017172 | 328 |
| 60 | 3300028379 | Ga0268266_10015525 | Ga0268266_100155255 | 328 |
| 61 | 3300028381 | Ga0268264_10070448 | Ga0268264_100704482 | 328 |
| 62 | 3300001977 | JGI24746J21847_1004002 | JGI24746J21847_10040023 | 329 |
| 63 | 3300001989 | JGI24739J22299_10054539 | JGI24739J22299_100545392 | 329 |
| 64 | 3300002070 | JGI24750J21931_1001413 | JGI24750J21931_10014133 | 329 |
| 65 | 3300002074 | JGI24748J21848_1003984 | JGI24748J21848_10039842 | 329 |
| 66 | 3300002076 | JGI24749J21850_1008965 | JGI24749J21850_10089652 | 329 |
| 67 | 3300002077 | JGI24744J21845_10002134 | JGI24744J21845_100021345 | 329 |
| 68 | 3300002244 | JGI24742J22300_10003095 | JGI24742J22300_100030953 | 329 |
| 69 | 3300003792 | Ga0055540_1000392 | Ga0055540_100039238 | 329 |
| 70 | 3300003792 | Ga0055540_1001171 | Ga0055540_100117117 | 329 |
| 71 | 3300003792 | Ga0055540_1003464 | Ga0055540_10034644 | 329 |
| 72 | 3300005328 | Ga0070676_10002409 | Ga0070676_100024099 | 329 |
| 73 | 3300005328 | Ga0070676_10129942 | Ga0070676_101299422 | 329 |
| 74 | 3300005334 | Ga0068869_100010877 | Ga0068869_1000108773 | 329 |
| 75 | 3300005334 | Ga0068869_100038611 | Ga0068869_1000386112 | 329 |
| 76 | 3300005335 | Ga0070666_10006217 | Ga0070666_100062178 | 329 |
| 77 | 3300005337 | Ga0070682_100022026 | Ga0070682_1000220265 | 329 |
| 78 | 3300005337 | Ga0070682_100031098 | Ga0070682_1000310983 | 329 |
| 79 | 3300005340 | Ga0070689_100014146 | Ga0070689_1000141463 | 329 |
| 80 | 3300005340 | Ga0070689_100134317 | Ga0070689_1001343173 | 329 |
| 81 | 3300005341 | Ga0070691_10002933 | Ga0070691_100029335 | 329 |
| 82 | 3300005347 | Ga0070668_100000201 | Ga0070668_1000002013 | 329 |
| 83 | 3300005347 | Ga0070668_100001887 | Ga0070668_1000018877 | 329 |
| 84 | 3300005347 | Ga0070668_100042214 | Ga0070668_1000422142 | 329 |
| 85 | 3300005353 | Ga0070669_100006850 | Ga0070669_1000068507 | 329 |
| 86 | 3300005353 | Ga0070669_100051760 | Ga0070669_1000517602 | 329 |
| 87 | 3300005355 | Ga0070671_100094176 | Ga0070671_1000941764 | 329 |
| 88 | 3300005356 | Ga0070674_100003900 | Ga0070674_1000039007 | 329 |
| 89 | 3300005356 | Ga0070674_100062334 | Ga0070674_1000623343 | 329 |
| 90 | 3300005365 | Ga0070688_100014899 | Ga0070688_1000148993 | 329 |
| 91 | 3300005366 | Ga0070659_100065719 | Ga0070659_1000657193 | 329 |
| 92 | 3300005367 | Ga0070667_100000142 | Ga0070667_10000014285 | 329 |
| 93 | 3300005367 | Ga0070667_100000752 | Ga0070667_1000007525 | 329 |
| 94 | 3300005367 | Ga0070667_100009424 | Ga0070667_1000094244 | 329 |
| 95 | 3300005367 | Ga0070667_100014581 | Ga0070667_1000145813 | 329 |
| 96 | 3300005434 | Ga0070709_10131588 | Ga0070709_101315882 | 329 |
| 97 | 3300005437 | Ga0070710_10000771 | Ga0070710_1000077112 | 329 |
| 98 | 3300005438 | Ga0070701_10006164 | Ga0070701_100061643 | 329 |
| 99 | 3300005439 | Ga0070711_100007162 | Ga0070711_1000071624 | 329 |
| 100 | 3300005439 | Ga0070711_100015606 | Ga0070711_1000156064 | 329 |
| 101 | 3300005440 | Ga0070705_100153235 | Ga0070705_1001532352 | 329 |
| 102 | 3300005441 | Ga0070700_100000263 | Ga0070700_10000026312 | 329 |
| 103 | 3300005455 | Ga0070663_100014385 | Ga0070663_1000143854 | 329 |
| 104 | 3300005455 | Ga0070663_100032464 | Ga0070663_1000324644 | 329 |
| 105 | 3300005455 | Ga0070663_100112798 | Ga0070663_1001127982 | 329 |
| 106 | 3300005456 | Ga0070678_100000712 | Ga0070678_10000071212 | 329 |
| 107 | 3300005457 | Ga0070662_100051903 | Ga0070662_1000519032 | 329 |
| 108 | 3300005459 | Ga0068867_100000537 | Ga0068867_10000053713 | 329 |
| 109 | 3300005539 | Ga0068853_100001294 | Ga0068853_10000129412 | 329 |
| 110 | 3300005539 | Ga0068853_100083470 | Ga0068853_1000834702 | 329 |
| 111 | 3300005544 | Ga0070686_100025821 | Ga0070686_1000258213 | 329 |
| 112 | 3300005544 | Ga0070686_100212103 | Ga0070686_1002121032 | 329 |
| 113 | 3300005545 | Ga0070695_100002626 | Ga0070695_1000026269 | 329 |
| 114 | 3300005547 | Ga0070693_100001778 | Ga0070693_10000177810 | 329 |
| 115 | 3300005548 | Ga0070665_100037891 | Ga0070665_1000378915 | 329 |
| 116 | 3300005548 | Ga0070665_100044119 | Ga0070665_1000441192 | 329 |
| 117 | 3300005548 | Ga0070665_100086813 | Ga0070665_1000868134 | 329 |
| 118 | 3300005614 | Ga0068856_100168126 | Ga0068856_1001681262 | 329 |
| 119 | 3300005615 | Ga0070702_100004815 | Ga0070702_1000048154 | 329 |
| 120 | 3300005615 | Ga0070702_100143414 | Ga0070702_1001434142 | 329 |
| 121 | 3300005616 | Ga0068852_100045827 | Ga0068852_1000458273 | 329 |
| 122 | 3300005616 | Ga0068852_100468652 | Ga0068852_1004686521 | 329 |
| 123 | 3300005617 | Ga0068859_100001155 | Ga0068859_10000115518 | 329 |
| 124 | 3300005617 | Ga0068859_100002067 | Ga0068859_1000020676 | 329 |
| 125 | 3300005718 | Ga0068866_10000629 | Ga0068866_100006296 | 329 |
| 126 | 3300005719 | Ga0068861_100000739 | Ga0068861_10000073917 | 329 |
| 127 | 3300005841 | Ga0068863_100005764 | Ga0068863_1000057646 | 329 |
| 128 | 3300005841 | Ga0068863_100026906 | Ga0068863_1000269064 | 329 |
| 129 | 3300005841 | Ga0068863_100081541 | Ga0068863_1000815412 | 329 |
| 130 | 3300005842 | Ga0068858_100002363 | Ga0068858_1000023637 | 329 |
| 131 | 3300005842 | Ga0068858_100022302 | Ga0068858_1000223023 | 329 |
| 132 | 3300005842 | Ga0068858_100034389 | Ga0068858_1000343893 | 329 |
| 133 | 3300005842 | Ga0068858_100210935 | Ga0068858_1002109352 | 329 |
| 134 | 3300005842 | Ga0068858_100295329 | Ga0068858_1002953292 | 329 |
| 135 | 3300005843 | Ga0068860_100000160 | Ga0068860_1000001609 | 329 |
| 136 | 3300005843 | Ga0068860_100002272 | Ga0068860_10000227217 | 329 |
| 137 | 3300005843 | Ga0068860_100099323 | Ga0068860_1000993234 | 329 |
| 138 | 3300005843 | Ga0068860_100143223 | Ga0068860_1001432232 | 329 |
| 139 | 3300005844 | Ga0068862_100001362 | Ga0068862_10000136221 | 329 |
| 140 | 3300005844 | Ga0068862_100017092 | Ga0068862_1000170926 | 329 |
| 141 | 3300005937 | Ga0081455_10092322 | Ga0081455_100923223 | 329 |
| 142 | 3300006038 | Ga0075365_10004459 | Ga0075365_100044595 | 329 |
| 143 | 3300006038 | Ga0075365_10004774 | Ga0075365_100047747 | 329 |
| 144 | 3300006038 | Ga0075365_10027057 | Ga0075365_100270574 | 329 |
| 145 | 3300006042 | Ga0075368_10052831 | Ga0075368_100528312 | 329 |
| 146 | 3300006048 | Ga0075363_100002619 | Ga0075363_1000026195 | 329 |
| 147 | 3300006048 | Ga0075363_100015968 | Ga0075363_1000159682 | 329 |
| 148 | 3300006048 | Ga0075363_100044588 | Ga0075363_1000445882 | 329 |
| 149 | 3300006051 | Ga0075364_10001086 | Ga0075364_100010865 | 329 |
| 150 | 3300006051 | Ga0075364_10005904 | Ga0075364_100059046 | 329 |
| 151 | 3300006051 | Ga0075364_10015218 | Ga0075364_100152182 | 329 |
| 152 | 3300006051 | Ga0075364_10028229 | Ga0075364_100282294 | 329 |
| 153 | 3300006173 | Ga0070716_100000613 | Ga0070716_1000006139 | 329 |
| 154 | 3300006175 | Ga0070712_100000495 | Ga0070712_10000049517 | 329 |
| 155 | 3300006175 | Ga0070712_100003591 | Ga0070712_1000035915 | 329 |
| 156 | 3300006177 | Ga0075362_10061159 | Ga0075362_100611592 | 329 |
| 157 | 3300006178 | Ga0075367_10021233 | Ga0075367_100212335 | 329 |
| 158 | 3300006186 | Ga0075369_10001541 | Ga0075369_100015416 | 329 |
| 159 | 3300006186 | Ga0075369_10035878 | Ga0075369_100358782 | 329 |
| 160 | 3300006186 | Ga0075369_10042549 | Ga0075369_100425492 | 329 |
| 161 | 3300006186 | Ga0075369_10049616 | Ga0075369_100496163 | 329 |
| 162 | 3300006237 | Ga0097621_100117596 | Ga0097621_1001175962 | 329 |
| 163 | 3300006353 | Ga0075370_10002764 | Ga0075370_100027648 | 329 |
| 164 | 3300006353 | Ga0075370_10009460 | Ga0075370_100094606 | 329 |
| 165 | 3300006353 | Ga0075370_10041179 | Ga0075370_100411792 | 329 |
| 166 | 3300006353 | Ga0075370_10053659 | Ga0075370_100536592 | 329 |
| 167 | 3300006358 | Ga0068871_100030273 | Ga0068871_1000302736 | 329 |
| 168 | 3300006881 | Ga0068865_100000670 | Ga0068865_1000006707 | 329 |
| 169 | 3300006931 | Ga0097620_100001155 | Ga0097620_10000115518 | 329 |
| 170 | 3300006931 | Ga0097620_100002067 | Ga0097620_1000020676 | 329 |
| 171 | 3300007788 | Ga0099795_10014464 | Ga0099795_100144643 | 329 |
| 172 | 3300009092 | Ga0105250_10031654 | Ga0105250_100316542 | 329 |
| 173 | 3300009092 | Ga0105250_10051555 | Ga0105250_100515552 | 329 |
| 174 | 3300009094 | Ga0111539_10526691 | Ga0111539_105266911 | 329 |
| 175 | 3300009098 | Ga0105245_10003258 | Ga0105245_100032584 | 329 |
| 176 | 3300009098 | Ga0105245_10006338 | Ga0105245_100063389 | 329 |
| 177 | 3300009101 | Ga0105247_10000078 | Ga0105247_100000789 | 329 |
| 178 | 3300009101 | Ga0105247_10000433 | Ga0105247_1000043325 | 329 |
| 179 | 3300009147 | Ga0114129_10403435 | Ga0114129_104034352 | 329 |
| 180 | 3300009148 | Ga0105243_10001959 | Ga0105243_100019596 | 329 |
| 181 | 3300009174 | Ga0105241_10076984 | Ga0105241_100769841 | 329 |
| 182 | 3300009174 | Ga0105241_10155881 | Ga0105241_101558813 | 329 |
| 183 | 3300009176 | Ga0105242_10000858 | Ga0105242_1000085811 | 329 |
| 184 | 3300009177 | Ga0105248_10000082 | Ga0105248_100000829 | 329 |
| 185 | 3300009177 | Ga0105248_10001630 | Ga0105248_1000163012 | 329 |
| 186 | 3300009545 | Ga0105237_10013670 | Ga0105237_100136706 | 329 |
| 187 | 3300009545 | Ga0105237_10014302 | Ga0105237_100143023 | 329 |
| 188 | 3300009551 | Ga0105238_10154928 | Ga0105238_101549282 | 329 |
| 189 | 3300009551 | Ga0105238_10196215 | Ga0105238_101962151 | 329 |
| 190 | 3300009553 | Ga0105249_10002952 | Ga0105249_100029526 | 329 |
| 191 | 3300009553 | Ga0105249_10006646 | Ga0105249_100066467 | 329 |
| 192 | 3300010375 | Ga0105239_10099487 | Ga0105239_100994872 | 329 |
| 193 | 3300010375 | Ga0105239_10100150 | Ga0105239_101001504 | 329 |
| 194 | 3300010375 | Ga0105239_10102968 | Ga0105239_101029683 | 329 |
| 195 | 3300010375 | Ga0105239_10115479 | Ga0105239_101154792 | 329 |
| 196 | 3300010375 | Ga0105239_10292072 | Ga0105239_102920721 | 329 |
| 197 | 3300013296 | Ga0157374_10064140 | Ga0157374_100641403 | 329 |
| 198 | 3300013297 | Ga0157378_10002386 | Ga0157378_1000238617 | 329 |
| 199 | 3300013297 | Ga0157378_10134604 | Ga0157378_101346041 | 329 |
| 200 | 3300013306 | Ga0163162_10108263 | Ga0163162_101082634 | 329 |
| 201 | 3300013306 | Ga0163162_10125638 | Ga0163162_101256383 | 329 |
| 202 | 3300013306 | Ga0163162_10181830 | Ga0163162_101818302 | 329 |
| 203 | 3300013307 | Ga0157372_10018187 | Ga0157372_100181871 | 329 |
| 204 | 3300013307 | Ga0157372_10224071 | Ga0157372_102240713 | 329 |
| 205 | 3300013308 | Ga0157375_10000849 | Ga0157375_100008497 | 329 |
| 206 | 3300013308 | Ga0157375_10059164 | Ga0157375_100591643 | 329 |
| 207 | 3300014326 | Ga0157380_10000339 | Ga0157380_1000033917 | 329 |
| 208 | 3300014745 | Ga0157377_10025834 | Ga0157377_100258344 | 329 |
| 209 | 3300014968 | Ga0157379_10009573 | Ga0157379_1000957310 | 329 |
| 210 | 3300017792 | Ga0163161_10000520 | Ga0163161_1000052011 | 329 |
| 211 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033194 | 329 |
| 212 | 3300025303 | Ga0209051_1001272 | Ga0209051_10012722 | 329 |
| 213 | 3300025303 | Ga0209051_1006750 | Ga0209051_10067502 | 329 |
| 214 | 3300025303 | Ga0209051_1007878 | Ga0209051_10078783 | 329 |
| 215 | 3300025303 | Ga0209051_1008784 | Ga0209051_10087846 | 329 |
| 216 | 3300025711 | Ga0207696_1026523 | Ga0207696_10265232 | 329 |
| 217 | 3300025898 | Ga0207692_10003161 | Ga0207692_100031617 | 329 |
| 218 | 3300025899 | Ga0207642_10025532 | Ga0207642_100255323 | 329 |
| 219 | 3300025900 | Ga0207710_10000022 | Ga0207710_1000002255 | 329 |
| 220 | 3300025901 | Ga0207688_10001068 | Ga0207688_100010683 | 329 |
| 221 | 3300025901 | Ga0207688_10003201 | Ga0207688_100032014 | 329 |
| 222 | 3300025903 | Ga0207680_10027503 | Ga0207680_100275033 | 329 |
| 223 | 3300025907 | Ga0207645_10004966 | Ga0207645_100049662 | 329 |
| 224 | 3300025907 | Ga0207645_10130176 | Ga0207645_101301761 | 329 |
| 225 | 3300025914 | Ga0207671_10021568 | Ga0207671_100215682 | 329 |
| 226 | 3300025914 | Ga0207671_10038881 | Ga0207671_100388812 | 329 |
| 227 | 3300025914 | Ga0207671_10129645 | Ga0207671_101296452 | 329 |
| 228 | 3300025915 | Ga0207693_10000660 | Ga0207693_1000066018 | 329 |
| 229 | 3300025915 | Ga0207693_10011341 | Ga0207693_100113416 | 329 |
| 230 | 3300025916 | Ga0207663_10010988 | Ga0207663_100109882 | 329 |
| 231 | 3300025916 | Ga0207663_10024744 | Ga0207663_100247442 | 329 |
| 232 | 3300025923 | Ga0207681_10002764 | Ga0207681_100027647 | 329 |
| 233 | 3300025923 | Ga0207681_10030443 | Ga0207681_100304432 | 329 |
| 234 | 3300025924 | Ga0207694_10100412 | Ga0207694_101004123 | 329 |
| 235 | 3300025926 | Ga0207659_10113779 | Ga0207659_101137792 | 329 |
| 236 | 3300025927 | Ga0207687_10006483 | Ga0207687_100064837 | 329 |
| 237 | 3300025927 | Ga0207687_10008737 | Ga0207687_100087374 | 329 |
| 238 | 3300025931 | Ga0207644_10068525 | Ga0207644_100685252 | 329 |
| 239 | 3300025931 | Ga0207644_10231647 | Ga0207644_102316472 | 329 |
| 240 | 3300025932 | Ga0207690_10022446 | Ga0207690_100224462 | 329 |
| 241 | 3300025932 | Ga0207690_10228753 | Ga0207690_102287531 | 329 |
| 242 | 3300025933 | Ga0207706_10011539 | Ga0207706_100115392 | 329 |
| 243 | 3300025934 | Ga0207686_10001835 | Ga0207686_100018359 | 329 |
| 244 | 3300025935 | Ga0207709_10171486 | Ga0207709_101714861 | 329 |
| 245 | 3300025935 | Ga0207709_10284801 | Ga0207709_102848011 | 329 |
| 246 | 3300025936 | Ga0207670_10095399 | Ga0207670_100953993 | 329 |
| 247 | 3300025937 | Ga0207669_10000218 | Ga0207669_1000021817 | 329 |
| 248 | 3300025938 | Ga0207704_10000179 | Ga0207704_1000017916 | 329 |
| 249 | 3300025939 | Ga0207665_10009061 | Ga0207665_100090613 | 329 |
| 250 | 3300025941 | Ga0207711_10002041 | Ga0207711_1000204119 | 329 |
| 251 | 3300025941 | Ga0207711_10045158 | Ga0207711_100451582 | 329 |
| 252 | 3300025942 | Ga0207689_10012044 | Ga0207689_100120445 | 329 |
| 253 | 3300025942 | Ga0207689_10049736 | Ga0207689_100497362 | 329 |
| 254 | 3300025949 | Ga0207667_10186429 | Ga0207667_101864292 | 329 |
| 255 | 3300025961 | Ga0207712_10167812 | Ga0207712_101678122 | 329 |
| 256 | 3300025972 | Ga0207668_10002863 | Ga0207668_100028637 | 329 |
| 257 | 3300025972 | Ga0207668_10023149 | Ga0207668_100231493 | 329 |
| 258 | 3300025972 | Ga0207668_10122662 | Ga0207668_101226621 | 329 |
| 259 | 3300025972 | Ga0207668_10277758 | Ga0207668_102777581 | 329 |
| 260 | 3300025981 | Ga0207640_10070790 | Ga0207640_100707902 | 329 |
| 261 | 3300025986 | Ga0207658_10000113 | Ga0207658_1000011382 | 329 |
| 262 | 3300025986 | Ga0207658_10006956 | Ga0207658_100069564 | 329 |
| 263 | 3300025986 | Ga0207658_10006993 | Ga0207658_100069938 | 329 |
| 264 | 3300025986 | Ga0207658_10256413 | Ga0207658_102564132 | 329 |
| 265 | 3300026023 | Ga0207677_10066180 | Ga0207677_100661802 | 329 |
| 266 | 3300026035 | Ga0207703_10002619 | Ga0207703_1000261912 | 329 |
| 267 | 3300026035 | Ga0207703_10263477 | Ga0207703_102634772 | 329 |
| 268 | 3300026041 | Ga0207639_10006160 | Ga0207639_100061602 | 329 |
| 269 | 3300026067 | Ga0207678_10007543 | Ga0207678_100075434 | 329 |
| 270 | 3300026067 | Ga0207678_10152735 | Ga0207678_101527352 | 329 |
| 271 | 3300026067 | Ga0207678_10189200 | Ga0207678_101892002 | 329 |
| 272 | 3300026075 | Ga0207708_10000787 | Ga0207708_1000078712 | 329 |
| 273 | 3300026078 | Ga0207702_10082772 | Ga0207702_100827722 | 329 |
| 274 | 3300026088 | Ga0207641_10003451 | Ga0207641_100034516 | 329 |
| 275 | 3300026088 | Ga0207641_10046978 | Ga0207641_100469783 | 329 |
| 276 | 3300026089 | Ga0207648_10001756 | Ga0207648_1000175613 | 329 |
| 277 | 3300026089 | Ga0207648_10201227 | Ga0207648_102012272 | 329 |
| 278 | 3300026118 | Ga0207675_100003125 | Ga0207675_1000031256 | 329 |
| 279 | 3300026121 | Ga0207683_10000990 | Ga0207683_1000099013 | 329 |
| 280 | 3300026121 | Ga0207683_10022683 | Ga0207683_100226832 | 329 |
| 281 | 3300026142 | Ga0207698_10025126 | Ga0207698_100251263 | 329 |
| 282 | 3300028379 | Ga0268266_10008889 | Ga0268266_100088896 | 329 |
| 283 | 3300028379 | Ga0268266_10029328 | Ga0268266_100293286 | 329 |
| 284 | 3300028379 | Ga0268266_10031388 | Ga0268266_100313884 | 329 |
| 285 | 3300028380 | Ga0268265_10000040 | Ga0268265_1000004081 | 329 |
| 286 | 3300028380 | Ga0268265_10092349 | Ga0268265_100923492 | 329 |
| 287 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017260 | 329 |
| 288 | 3300028381 | Ga0268264_10002402 | Ga0268264_1000240217 | 329 |
| 289 | 3300031251 | Ga0265327_10001869 | Ga0265327_1000186914 | 329 |
| 290 | 3300031824 | Ga0307413_10174742 | Ga0307413_101747422 | 329 |
| 291 | 3300032126 | Ga0307415_100039425 | Ga0307415_1000394252 | 329 |
| 292 | 3300035691 | Ga0373931_0028466 | Ga0373931_0028466_1441_2559 | 329 |
| 293 | 3300039450 | Ga0436363_0279243 | Ga0436363_0279243_179_1168 | 329 |
| 294 | 3300041410 | Ga0439461_0001829 | Ga0439461_0001829_12_1001 | 329 |
| 295 | 3300041411 | Ga0439466_0004397 | Ga0439466_0004397_281_1270 | 329 |
| 296 | 3300041411 | Ga0439466_0010299 | Ga0439466_0010299_600_1589 | 329 |
| 297 | 3300041411 | Ga0439466_0025624 | Ga0439466_0025624_592_1581 | 329 |
| 298 | 3300041413 | Ga0439465_0000494 | Ga0439465_0000494_2648_3637 | 329 |
| 299 | 3300041413 | Ga0439465_0001755 | Ga0439465_0001755_5938_6927 | 329 |
| 300 | 3300041413 | Ga0439465_0056112 | Ga0439465_0056112_155_1210 | 329 |
| 301 | 3300041443 | Ga0451789_0617823 | Ga0451789_0617823_588_1577 | 329 |
| 302 | 3300041997 | Ga0439431_0002999 | Ga0439431_0002999_2110_3099 | 329 |
| 303 | 3300041997 | Ga0439431_0014129 | Ga0439431_0014129_671_1660 | 329 |
| 304 | 3300042002 | Ga0439442_003479 | Ga0439442_003479_1227_2216 | 329 |
| 305 | 3300042004 | Ga0439445_0015084 | Ga0439445_0015084_487_1476 | 329 |
| 306 | 3300042005 | Ga0439448_0021084 | Ga0439448_0021084_653_1645 | 329 |
| 307 | 3300042435 | Ga0439434_0004309 | Ga0439434_0004309_911_1900 | 329 |
| 308 | 3300042435 | Ga0439434_0018458 | Ga0439434_0018458_1049_2038 | 329 |
| 309 | 3300044658 | Ga0466972_0002001 | Ga0466972_0002001_6202_7191 | 329 |
| 310 | 3300044658 | Ga0466972_0004098 | Ga0466972_0004098_2341_3330 | 329 |
| 311 | 3300044658 | Ga0466972_0027940 | Ga0466972_0027940_698_1687 | 329 |
| 312 | 3300044658 | Ga0466972_0053936 | Ga0466972_0053936_505_1494 | 329 |
| 313 | 3300044683 | Ga0466965_0041200 | Ga0466965_0041200_107_1096 | 329 |
| 314 | 3300044683 | Ga0466965_0072567 | Ga0466965_0072567_167_1159 | 329 |
| 315 | 3300044684 | Ga0466966_0008971 | Ga0466966_0008971_824_1813 | 329 |
| 316 | 3300044719 | Ga0466971_0073465 | Ga0466971_0073465_14_1003 | 329 |
| 317 | 3300044765 | Ga0466970_0004992 | Ga0466970_0004992_5479_6468 | 329 |
| 318 | 3300044765 | Ga0466970_0010287 | Ga0466970_0010287_1061_2050 | 329 |
| 319 | 3300044765 | Ga0466970_0013631 | Ga0466970_0013631_3159_4148 | 329 |
| 320 | 3300044842 | Ga0466957_0016439 | Ga0466957_0016439_3186_4175 | 329 |
| 321 | 3300044842 | Ga0466957_0018882 | Ga0466957_0018882_845_1834 | 329 |
| 322 | 3300044842 | Ga0466957_0020058 | Ga0466957_0020058_1987_2976 | 329 |
| 323 | 3300044842 | Ga0466957_0134876 | Ga0466957_0134876_110_1099 | 329 |
| 324 | 3300044901 | Ga0466960_0022306 | Ga0466960_0022306_341_1330 | 329 |
| 325 | 3300044901 | Ga0466960_0044943 | Ga0466960_0044943_1055_2044 | 329 |
| 326 | 3300045049 | Ga0466959_0022184 | Ga0466959_0022184_3434_4423 | 329 |
| 327 | 3300045836 | Ga0466958_0026698 | Ga0466958_0026698_551_1540 | 329 |
| 328 | 3300045976 | Ga0466967_0020016 | Ga0466967_0020016_2760_3752 | 329 |
| 329 | 3300045976 | Ga0466967_0072056 | Ga0466967_0072056_1506_2495 | 329 |
| 330 | 3300045976 | Ga0466967_0082113 | Ga0466967_0082113_807_1796 | 329 |
| 331 | 3300045976 | Ga0466967_0159145 | Ga0466967_0159145_563_1552 | 329 |
| 332 | 3300046459 | Ga0495629_0211477 | Ga0495629_0211477_99_1088 | 329 |
| 333 | 3300046460 | Ga0495638_0017592 | Ga0495638_0017592_2984_3973 | 329 |
| 334 | 3300046473 | Ga0495582_0007927 | Ga0495582_0007927_3755_4744 | 329 |
| 335 | 3300046501 | Ga0495607_0021557 | Ga0495607_0021557_2238_3230 | 329 |
| 336 | 3300046506 | Ga0495583_0056437 | Ga0495583_0056437_745_1737 | 329 |
| 337 | 3300046507 | Ga0495606_0007421 | Ga0495606_0007421_6707_7705 | 329 |
| 338 | 3300046511 | Ga0495608_0068205 | Ga0495608_0068205_86_1075 | 329 |
| 339 | 3300046524 | Ga0495648_0014111 | Ga0495648_0014111_2192_3190 | 329 |
| 340 | 3300046529 | Ga0495652_0174887 | Ga0495652_0174887_539_1528 | 329 |
| 341 | 3300046616 | Ga0495668_0080801 | Ga0495668_0080801_320_1318 | 329 |
| 342 | 3300046683 | Ga0495658_0035937 | Ga0495658_0035937_947_1936 | 329 |
| 343 | 3300046690 | Ga0495624_0144356 | Ga0495624_0144356_222_1256 | 329 |
| 344 | 3300046692 | Ga0495671_0048377 | Ga0495671_0048377_842_1840 | 329 |
| 345 | 3300047319 | Ga0495674_0028281 | Ga0495674_0028281_3413_4402 | 329 |
| 346 | 3300047320 | Ga0495672_0026524 | Ga0495672_0026524_2218_3216 | 329 |
| 347 | 3300047321 | Ga0495676_0156854 | Ga0495676_0156854_394_1383 | 329 |
| 348 | 3300047323 | Ga0495683_0004511 | Ga0495683_0004511_3322_4314 | 329 |
| 349 | 3300047469 | Ga0495673_0004486 | Ga0495673_0004486_602_1600 | 329 |
| 350 | 3300047472 | Ga0495686_0020947 | Ga0495686_0020947_1716_2705 | 329 |
| 351 | 3300047472 | Ga0495686_0054040 | Ga0495686_0054040_145_1203 | 329 |
| 352 | 3300047673 | Ga0495593_0004484 | Ga0495593_0004484_2962_3951 | 329 |
| 353 | 3300048903 | Ga0496100_0004302 | Ga0496100_0004302_5410_6402 | 329 |
| 354 | 3300048903 | Ga0496100_0005940 | Ga0496100_0005940_2978_3976 | 329 |
| 355 | 3300048903 | Ga0496100_0007056 | Ga0496100_0007056_3124_4242 | 329 |
| 356 | 3300048903 | Ga0496100_0015984 | Ga0496100_0015984_554_1546 | 329 |
| 357 | 3300048903 | Ga0496100_0310003 | Ga0496100_0310003_55_1044 | 329 |
| 358 | 3300048904 | Ga0496101_0000031 | Ga0496101_0000031_191580_192578 | 329 |
| 359 | 3300048904 | Ga0496101_0000376 | Ga0496101_0000376_1616_2608 | 329 |
| 360 | 3300048904 | Ga0496101_0002865 | Ga0496101_0002865_780_1769 | 329 |
| 361 | 3300048904 | Ga0496101_0034625 | Ga0496101_0034625_2174_3292 | 329 |
| 362 | 3300048904 | Ga0496101_0071924 | Ga0496101_0071924_67_1056 | 329 |
| 363 | 3300048904 | Ga0496101_0174342 | Ga0496101_0174342_625_1617 | 329 |
| 364 | 3300048905 | Ga0496102_0000011 | Ga0496102_0000011_79783_80781 | 329 |
| 365 | 3300048905 | Ga0496102_0000197 | Ga0496102_0000197_61802_62791 | 329 |
| 366 | 3300048905 | Ga0496102_0002308 | Ga0496102_0002308_1046_2164 | 329 |
| 367 | 3300048905 | Ga0496102_0070834 | Ga0496102_0070834_1116_2108 | 329 |
| 368 | 3300048905 | Ga0496102_0187341 | Ga0496102_0187341_908_1897 | 329 |
| 369 | 3300048906 | Ga0496103_0000124 | Ga0496103_0000124_79783_80781 | 329 |
| 370 | 3300048906 | Ga0496103_0000842 | Ga0496103_0000842_1133_2125 | 329 |
| 371 | 3300048906 | Ga0496103_0001721 | Ga0496103_0001721_8611_9600 | 329 |
| 372 | 3300048906 | Ga0496103_0012537 | Ga0496103_0012537_1856_2974 | 329 |
| 373 | 3300048907 | Ga0496104_0028796 | Ga0496104_0028796_3913_4902 | 329 |
| 374 | 3300048908 | Ga0496105_0001822 | Ga0496105_0001822_1475_2467 | 329 |
| 375 | 3300048908 | Ga0496105_0091227 | Ga0496105_0091227_318_1307 | 329 |
| 376 | 3300048909 | Ga0496106_0001477 | Ga0496106_0001477_13481_14473 | 329 |
| 377 | 3300048909 | Ga0496106_0002768 | Ga0496106_0002768_10369_11487 | 329 |
| 378 | 3300048909 | Ga0496106_0007731 | Ga0496106_0007731_6613_7605 | 329 |
| 379 | 3300048909 | Ga0496106_0044611 | Ga0496106_0044611_1457_2455 | 329 |
| 380 | 3300048910 | Ga0496107_0000825 | Ga0496107_0000825_5533_6651 | 329 |
| 381 | 3300048910 | Ga0496107_0029614 | Ga0496107_0029614_2026_3015 | 329 |
| 382 | 3300048911 | Ga0496108_0003052 | Ga0496108_0003052_4347_5336 | 329 |
| 383 | 3300048911 | Ga0496108_0007913 | Ga0496108_0007913_4950_5942 | 329 |
| 384 | 3300048911 | Ga0496108_0119081 | Ga0496108_0119081_1030_2019 | 329 |
| 385 | 3300048912 | Ga0496109_0000030 | Ga0496109_0000030_156179_157171 | 329 |
| 386 | 3300048912 | Ga0496109_0000948 | Ga0496109_0000948_19840_20829 | 329 |
| 387 | 3300048912 | Ga0496109_0021983 | Ga0496109_0021983_1777_2766 | 329 |
| 388 | 3300048912 | Ga0496109_0022239 | Ga0496109_0022239_1693_2682 | 329 |
| 389 | 3300048912 | Ga0496109_0341825 | Ga0496109_0341825_202_1191 | 329 |
| 390 | 3300048913 | Ga0496110_0011549 | Ga0496110_0011549_1107_2099 | 329 |
| 391 | 3300048913 | Ga0496110_0180430 | Ga0496110_0180430_577_1566 | 329 |
| 392 | 3300048913 | Ga0496110_0376642 | Ga0496110_0376642_256_1245 | 329 |
| 393 | 3300048913 | Ga0496110_0468605 | Ga0496110_0468605_18_1007 | 329 |
| 394 | 3300048914 | Ga0496111_0218499 | Ga0496111_0218499_174_1163 | 329 |
| 395 | 3300048915 | Ga0496112_0003459 | Ga0496112_0003459_7375_8364 | 329 |
| 396 | 3300048916 | Ga0496113_0071694 | Ga0496113_0071694_418_1407 | 329 |
| 397 | 3300048917 | Ga0496114_0000312 | Ga0496114_0000312_25998_26990 | 329 |
| 398 | 3300048917 | Ga0496114_0003137 | Ga0496114_0003137_2186_3304 | 329 |
| 399 | 3300048917 | Ga0496114_0006995 | Ga0496114_0006995_1130_2122 | 329 |
| 400 | 3300048917 | Ga0496114_0124607 | Ga0496114_0124607_65_1057 | 329 |
| 401 | 3300048918 | Ga0496115_0020623 | Ga0496115_0020623_2844_3836 | 329 |
| 402 | 3300048918 | Ga0496115_0047807 | Ga0496115_0047807_1897_2889 | 329 |
| 403 | 3300048918 | Ga0496115_0179923 | Ga0496115_0179923_610_1728 | 329 |
| 404 | 3300048918 | Ga0496115_0419187 | Ga0496115_0419187_60_1052 | 329 |
| 405 | 3300048919 | Ga0496116_0000297 | Ga0496116_0000297_79783_80781 | 329 |
| 406 | 3300048919 | Ga0496116_0001267 | Ga0496116_0001267_26984_27976 | 329 |
| 407 | 3300048919 | Ga0496116_0003727 | Ga0496116_0003727_2659_3648 | 329 |
| 408 | 3300048920 | Ga0496117_0000039 | Ga0496117_0000039_241363_242361 | 329 |
| 409 | 3300048920 | Ga0496117_0000160 | Ga0496117_0000160_74471_75460 | 329 |
| 410 | 3300048920 | Ga0496117_0011502 | Ga0496117_0011502_1798_2790 | 329 |
| 411 | 3300048921 | Ga0496118_0000035 | Ga0496118_0000035_79783_80781 | 329 |
| 412 | 3300048921 | Ga0496118_0000391 | Ga0496118_0000391_18870_19859 | 329 |
| 413 | 3300048921 | Ga0496118_0018788 | Ga0496118_0018788_4083_5075 | 329 |
| 414 | 3300048922 | Ga0496119_0008591 | Ga0496119_0008591_1121_2113 | 329 |
| 415 | 3300048922 | Ga0496119_0011337 | Ga0496119_0011337_3043_4041 | 329 |
| 416 | 3300048922 | Ga0496119_0032005 | Ga0496119_0032005_730_1719 | 329 |
| 417 | 3300048923 | Ga0496120_0005344 | Ga0496120_0005344_2644_3642 | 329 |
| 418 | 3300048923 | Ga0496120_0027956 | Ga0496120_0027956_1364_2356 | 329 |
| 419 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_478997_479989 | 329 |
| 420 | 3300048924 | Ga0496121_0000425 | Ga0496121_0000425_78989_79987 | 329 |
| 421 | 3300048924 | Ga0496121_0024475 | Ga0496121_0024475_4552_5541 | 329 |
| 422 | 3300048925 | Ga0496122_0000138 | Ga0496122_0000138_6829_7821 | 329 |
| 423 | 3300048925 | Ga0496122_0028122 | Ga0496122_0028122_2562_3551 | 329 |
| 424 | 3300048926 | Ga0496123_0007604 | Ga0496123_0007604_3369_4361 | 329 |
| 425 | 3300048926 | Ga0496123_0016687 | Ga0496123_0016687_3445_4434 | 329 |
| 426 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_203790_204782 | 329 |
| 427 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_709779_710771 | 329 |
| 428 | 3300048928 | Ga0496125_0199311 | Ga0496125_0199311_177_1166 | 329 |
| 429 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_478997_479989 | 329 |
| 430 | 3300048929 | Ga0496126_0003942 | Ga0496126_0003942_11055_12044 | 329 |
| 431 | 3300048929 | Ga0496126_0004985 | Ga0496126_0004985_3087_4085 | 329 |
| 432 | 3300048929 | Ga0496126_0046261 | Ga0496126_0046261_655_1644 | 329 |
| 433 | 3300049569 | Ga0501032_0005015 | Ga0501032_0005015_6587_7576 | 329 |
| 434 | 3300049570 | Ga0501033_0196080 | Ga0501033_0196080_33_1022 | 329 |
| 435 | 3300049571 | Ga0501034_0009748 | Ga0501034_0009748_7747_8736 | 329 |
| 436 | 3300049572 | Ga0501036_0224089 | Ga0501036_0224089_335_1324 | 329 |
| 437 | 3300049573 | Ga0501037_0001249 | Ga0501037_0001249_7939_8928 | 329 |
| 438 | 3300049575 | Ga0501039_0000299 | Ga0501039_0000299_18472_19461 | 329 |
| 439 | 3300049576 | Ga0501040_0108652 | Ga0501040_0108652_94_1083 | 329 |
| 440 | 3300049579 | Ga0501043_0002900 | Ga0501043_0002900_2506_3495 | 329 |
| 441 | 3300049586 | Ga0501070_0002832 | Ga0501070_0002832_5958_6947 | 329 |
| 442 | 3300049589 | Ga0501073_0043023 | Ga0501073_0043023_1869_2858 | 329 |
| 443 | 3300049742 | Ga0501080_0124193 | Ga0501080_0124193_1378_2367 | 329 |
| 444 | 3300049823 | Ga0501044_0002556 | Ga0501044_0002556_13343_14332 | 329 |
| 445 | 3300050490 | nmdc:mga03n38_21848_c1 | nmdc:mga03n38_21848_c1_1215_2243 | 329 |
| 446 | 3300050490 | nmdc:mga03n38_36707_c1 | nmdc:mga03n38_36707_c1_385_1401 | 329 |
| 447 | 3300050490 | nmdc:mga03n38_53145_c1 | nmdc:mga03n38_53145_c1_664_1692 | 329 |
| 448 | 3300050490 | nmdc:mga03n38_73194_c1 | nmdc:mga03n38_73194_c1_207_1223 | 329 |
| 449 | 3300050491 | nmdc:mga00v17_12108_c1 | nmdc:mga00v17_12108_c1_1149_2138 | 329 |
| 450 | 3300050491 | nmdc:mga00v17_163160_c1 | nmdc:mga00v17_163160_c1_250_1239 | 329 |
| 451 | 3300050491 | nmdc:mga00v17_22485_c1 | nmdc:mga00v17_22485_c1_1780_2808 | 329 |
| 452 | 3300050491 | nmdc:mga00v17_225943_c1 | nmdc:mga00v17_225943_c1_13_1002 | 329 |
| 453 | 3300050491 | nmdc:mga00v17_27457_c1 | nmdc:mga00v17_27457_c1_803_1792 | 329 |
| 454 | 3300050491 | nmdc:mga00v17_8904_c1 | nmdc:mga00v17_8904_c1_322_1311 | 329 |
| 455 | 3300050491 | nmdc:mga00v17_974_c1 | nmdc:mga00v17_974_c1_1189_2214 | 329 |
| 456 | 3300050492 | nmdc:mga0yw44_1098_c1 | nmdc:mga0yw44_1098_c1_5710_6738 | 329 |
| 457 | 3300050492 | nmdc:mga0yw44_20738_c2 | nmdc:mga0yw44_20738_c2_403_1392 | 329 |
| 458 | 3300050492 | nmdc:mga0yw44_52402_c1 | nmdc:mga0yw44_52402_c1_410_1399 | 329 |
| 459 | 3300050492 | nmdc:mga0yw44_60856_c1 | nmdc:mga0yw44_60856_c1_596_1588 | 329 |
| 460 | 3300050494 | nmdc:mga06z11_18856_c1 | nmdc:mga06z11_18856_c1_1795_2784 | 329 |
| 461 | 3300050496 | nmdc:mga07m45_12910_c1 | nmdc:mga07m45_12910_c1_404_1432 | 329 |
| 462 | 3300050496 | nmdc:mga07m45_3050_c1 | nmdc:mga07m45_3050_c1_5508_6536 | 329 |
| 463 | 3300050496 | nmdc:mga07m45_42565_c2 | nmdc:mga07m45_42565_c2_203_1192 | 329 |
| 464 | 3300050496 | nmdc:mga07m45_64337_c1 | nmdc:mga07m45_64337_c1_550_1539 | 329 |
| 465 | 3300050509 | nmdc:mga0qj67_238431_c1 | nmdc:mga0qj67_238431_c1_363_1388 | 329 |
| 466 | 3300050509 | nmdc:mga0qj67_36693_c1 | nmdc:mga0qj67_36693_c1_2505_3494 | 329 |
| 467 | 3300050516 | nmdc:mga0sz30_100112_c1 | nmdc:mga0sz30_100112_c1_243_1232 | 329 |
| 468 | 3300050516 | nmdc:mga0sz30_1052_c1 | nmdc:mga0sz30_1052_c1_3415_4440 | 329 |
| 469 | 3300050516 | nmdc:mga0sz30_13105_c2 | nmdc:mga0sz30_13105_c2_1480_2469 | 329 |
| 470 | 3300050516 | nmdc:mga0sz30_13826_c1 | nmdc:mga0sz30_13826_c1_1813_2802 | 329 |
| 471 | 3300050516 | nmdc:mga0sz30_19956_c1 | nmdc:mga0sz30_19956_c1_442_1431 | 329 |
| 472 | 3300050516 | nmdc:mga0sz30_43867_c1 | nmdc:mga0sz30_43867_c1_498_1487 | 329 |
| 473 | 3300050516 | nmdc:mga0sz30_88909_c1 | nmdc:mga0sz30_88909_c1_71_1060 | 329 |
| 474 | 3300053080 | Ga0500635_0018492 | Ga0500635_0018492_61_1053 | 329 |
| 475 | 3300053084 | Ga0495595_0109916 | Ga0495595_0109916_116_1105 | 329 |
| 476 | 3300053085 | Ga0495619_0163734 | Ga0495619_0163734_33_1022 | 329 |
| 477 | 3300053087 | Ga0500643_044172 | Ga0500643_044172_129_1118 | 329 |
| 478 | 3300053090 | Ga0500646_0062241 | Ga0500646_0062241_50_1039 | 329 |
| 479 | 3300053122 | Ga0500608_112615 | Ga0500608_112615_156_1148 | 329 |
| 480 | 3300053131 | Ga0500652_001098 | Ga0500652_001098_5129_6121 | 329 |
| 481 | 3300053131 | Ga0500652_042979 | Ga0500652_042979_133_1122 | 329 |
| 482 | 3300053158 | Ga0500627_0158030 | Ga0500627_0158030_13_1005 | 329 |
| 483 | 3300053730 | Ga0500645_000025 | Ga0500645_000025_115838_116827 | 329 |
| 484 | 3300061719 | Ga0466962_0031156 | Ga0466962_0031156_147_1136 | 329 |
| 485 | iso_pu_bacteria | 2939582691 | 2939585013 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lxe-assembly1.cif.gz_B | f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 | 0.8547 | 1 | 328 |
| 5lxe-assembly1.cif.gz_B | f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 | 0.8388 | 1 | 328 |
| 1luc-assembly1.cif.gz_A | bacterial luciferase | 0.8351 | 1 | 329 |
| 1luc-assembly1.cif.gz_A | bacterial luciferase | 0.8255 | 1 | 329 |
| 3rao-assembly2.cif.gz_B | crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. | 0.8241 | 1 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95159_1_299_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8998 | 1 | 321 | 3.20.20.30 |
| af_P95159_1_299_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8883 | 1 | 321 | 3.20.20.30 |
| af_I6X9T8_35_343_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8611 | 39 | 329 | 3.20.20.30 |
| af_P71701_5_258_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8431 | 2 | 317 | 3.20.20.30 |
| af_P96809_35_360_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8248 | 2 | 329 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N2D1K6-F1-model_v4 | F420-dependent oxidoreductase-like protein | 0.9858 | 1 | 329 |
GO:0008726
GO:0046306 |
| AF-A0A3N2D1K6-F1-model_v4 | F420-dependent oxidoreductase-like protein | 0.9799 | 1 | 329 |
GO:0008726
GO:0046306 |
| AF-A0A7C0YIY5-F1-model_v4 | LLM class F420-dependent oxidoreductase | 0.9583 | 1 | 261 |
GO:0008726
GO:0046306 |
| AF-A0A7W1C6G0-F1-model_v4 | TIGR03560 family F420-dependent LLM class oxidoreductase | 0.9516 | 33 | 235 |
GO:0008726
GO:0046306 |
| AF-A0A838DNK8-F1-model_v4 | TIGR03560 family F420-dependent LLM class oxidoreductase | 0.9472 | 40 | 201 |
GO:0008726
GO:0046306 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar