F452952

General Info

Members Datasets Scaffolds Average Seq Length
484 206 968 119

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10416202|Ga0207658_104162022
Length 141
Sequence VNLLVDLMCNSIFIIKPITRFLQLAHTKLDVYKFTQELALECYRITKQFPTDEKFAMIQQIRRAALSVHLNLAEGCSRKSEAERKRFFEISRGSVIEIDAATGIAFKLSYATLEDLKPLGDSIIKTFKILSGMINYEDTHS

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
195 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
196 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.87
Stem 0
Stem Tuber 0
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10416202 3300025986 Bacteria 1184
2 MBSR1b_contig_10676560 2162886012 Bacteria 1908
3 ARcpr5yngRDRAFT_c007554 3300000043 Unclassified 954
4 JGI24751J29686_10008532 3300002459 Bacteria 2097
5 JGI25154J39366_1016379 3300002738 Bacteria 751
6 rootH1_10260837 3300003323 Bacteria 1144
7 Ga0065714_10340517 3300005288 Unclassified 646
8 Ga0065712_10001520 3300005290 Bacteria 6912
9 Ga0065712_10154205 3300005290 Viruses 1336
10 Ga0065712_10476481 3300005290 Unclassified 666
11 Ga0065715_10921139 3300005293 Unclassified 568
12 Ga0065707_10097600 3300005295 Bacteria 3160
13 Ga0065707_10121016 3300005295 Bacteria 2120
14 Ga0070658_10194527 3300005327 Bacteria 1710
15 Ga0070676_10009474 3300005328 Bacteria 5261
16 Ga0070676_10404035 3300005328 Unclassified 951
17 Ga0070683_100027772 3300005329 Bacteria 5106
18 Ga0070690_100016504 3300005330 Bacteria 4425
19 Ga0070690_100020173 3300005330 Bacteria 4057
20 Ga0070690_100064729 3300005330 Unclassified 2363
21 Ga0070690_100277321 3300005330 Bacteria 1195
22 Ga0070670_100006902 3300005331 Bacteria 9621
23 Ga0070670_100032916 3300005331 Bacteria 4467
24 Ga0070670_100592354 3300005331 Viruses 992
25 Ga0070670_101234427 3300005331 Bacteria 683
26 Ga0068869_100125653 3300005334 Bacteria 1966
27 Ga0070666_10015841 3300005335 Bacteria 4815
28 Ga0070666_10904709 3300005335 Unclassified 652
29 Ga0070682_100044188 3300005337 Bacteria 2758
30 Ga0070682_100303542 3300005337 Bacteria 1172
31 Ga0068868_100066902 3300005338 Bacteria 2858
32 Ga0068868_100131542 3300005338 Bacteria 2048
33 Ga0068868_100162631 3300005338 Bacteria 1844
34 Ga0068868_100171508 3300005338 Bacteria 1796
35 Ga0068868_100853230 3300005338 Bacteria 825
36 Ga0068868_101147653 3300005338 Unclassified 716
37 Ga0070689_100031736 3300005340 Unclassified 4016
38 Ga0070689_100561007 3300005340 Bacteria 985
39 Ga0070687_100028834 3300005343 Bacteria 2696
40 Ga0070687_100179771 3300005343 Bacteria 1266
41 Ga0070661_100042410 3300005344 Bacteria 3321
42 Ga0070661_100059318 3300005344 Unclassified 2805
43 Ga0070669_100002586 3300005353 Bacteria 13083
44 Ga0070669_100079480 3300005353 Bacteria 2439
45 Ga0070669_100209172 3300005353 Bacteria 1538
46 Ga0070669_100527122 3300005353 Viruses 983
47 Ga0070669_101659738 3300005353 Bacteria 557
48 Ga0070675_100010319 3300005354 Bacteria 7292
49 Ga0070675_100116306 3300005354 Unclassified 2268
50 Ga0070675_100400860 3300005354 Bacteria 1224
51 Ga0070671_100441002 3300005355 Unclassified 1116
52 Ga0070671_100598820 3300005355 Bacteria 952
53 Ga0070671_100939848 3300005355 Bacteria 756
54 Ga0070671_101638872 3300005355 Bacteria 570
55 Ga0070673_100002320 3300005364 Bacteria 11558
56 Ga0070673_100024486 3300005364 Bacteria 4427
57 Ga0070673_100024865 3300005364 Bacteria 4397
58 Ga0070673_100112430 3300005364 Bacteria 2261
59 Ga0070673_100130521 3300005364 Viruses 2107
60 Ga0070673_101110741 3300005364 Bacteria 739
61 Ga0070673_101685088 3300005364 Bacteria 600
62 Ga0070688_100022484 3300005365 Bacteria 3696
63 Ga0070688_100157475 3300005365 Bacteria 1558
64 Ga0070688_101269105 3300005365 Bacteria 594
65 Ga0070688_101277230 3300005365 Bacteria 592
66 Ga0070659_100008356 3300005366 Bacteria 7560
67 Ga0070659_101071135 3300005366 Bacteria 710
68 Ga0070667_100483336 3300005367 Bacteria 1134
69 Ga0070667_100572170 3300005367 Viruses 1039
70 Ga0070667_100798317 3300005367 Unclassified 876
71 Ga0070701_10003603 3300005438 Bacteria 6152
72 Ga0070694_100205338 3300005444 Bacteria 1470
73 Ga0070708_102180722 3300005445 Unclassified 512
74 Ga0070663_101397801 3300005455 Bacteria 620
75 Ga0070678_100533656 3300005456 Bacteria 1040
76 Ga0070662_100004551 3300005457 Bacteria 8782
77 Ga0070662_100006375 3300005457 Bacteria 7600
78 Ga0070662_100010194 3300005457 Bacteria 6161
79 Ga0070662_100635604 3300005457 Bacteria 900
80 Ga0070662_101088315 3300005457 Unclassified 686
81 Ga0068867_100015351 3300005459 Bacteria 5431
82 Ga0068867_100283221 3300005459 Bacteria 1360
83 Ga0068867_100566278 3300005459 Bacteria 986
84 Ga0068867_100948183 3300005459 Bacteria 777
85 Ga0068867_101293352 3300005459 Bacteria 673
86 Ga0068867_102321900 3300005459 Bacteria 510
87 Ga0070685_10024921 3300005466 Bacteria 3290
88 Ga0070685_10029331 3300005466 Bacteria 3056
89 Ga0070685_11165192 3300005466 Unclassified 584
90 Ga0070706_100206418 3300005467 Bacteria 1835
91 Ga0070679_100341060 3300005530 Bacteria 1446
92 Ga0070684_100021442 3300005535 Bacteria 5377
93 Ga0070684_100028680 3300005535 Bacteria 4709
94 Ga0070684_100049901 3300005535 Bacteria 3633
95 Ga0068853_100222601 3300005539 Bacteria 1724
96 Ga0068853_100318148 3300005539 Bacteria 1442
97 Ga0070672_100118686 3300005543 Bacteria 2163
98 Ga0070672_100118696 3300005543 Bacteria 2163
99 Ga0070686_100124146 3300005544 Bacteria 1777
100 Ga0070686_100540482 3300005544 Bacteria 910
101 Ga0070695_100199423 3300005545 Bacteria 1429
102 Ga0070665_100197240 3300005548 Bacteria 2014
103 Ga0070665_100242478 3300005548 Bacteria 1803
104 Ga0070665_101925404 3300005548 Bacteria 597
105 Ga0070665_102507095 3300005548 Bacteria 517
106 Ga0068855_100267749 3300005563 Viruses 1901
107 Ga0070664_100026476 3300005564 Bacteria 4810
108 Ga0070664_100256919 3300005564 Viruses 1571
109 Ga0070664_100775833 3300005564 Bacteria 895
110 Ga0068857_100012971 3300005577 Bacteria 7263
111 Ga0068857_100113575 3300005577 Bacteria 2435
112 Ga0068857_100343330 3300005577 Bacteria 1381
113 Ga0068854_100208041 3300005578 Bacteria 1542
114 Ga0068854_100408990 3300005578 Bacteria 1124
115 Ga0068854_100611154 3300005578 Bacteria 932
116 Ga0070702_100111800 3300005615 Bacteria 1695
117 Ga0070702_100691835 3300005615 Bacteria 776
118 Ga0068852_100205315 3300005616 Bacteria 1866
119 Ga0068852_100679298 3300005616 Viruses 1039
120 Ga0068852_100811954 3300005616 Bacteria 950
121 Ga0068852_102259359 3300005616 Bacteria 565
122 Ga0068852_102379138 3300005616 Bacteria 550
123 Ga0068859_100006435 3300005617 Bacteria 11916
124 Ga0068859_100043549 3300005617 Bacteria 4511
125 Ga0068859_100051313 3300005617 Bacteria 4146
126 Ga0068859_100086464 3300005617 Unclassified 3182
127 Ga0068859_100124542 3300005617 Bacteria 2645
128 Ga0068859_100466437 3300005617 Bacteria 1358
129 Ga0068864_100006888 3300005618 Bacteria 9315
130 Ga0068864_100054228 3300005618 Bacteria 3460
131 Ga0068866_10708520 3300005718 Bacteria 691
132 Ga0068851_10158685 3300005834 Bacteria 1241
133 Ga0068851_10375271 3300005834 Bacteria 832
134 Ga0068863_100022303 3300005841 Bacteria 6045
135 Ga0068863_100072420 3300005841 Bacteria 3260
136 Ga0068863_100286446 3300005841 Bacteria 1597
137 Ga0068863_100674038 3300005841 Bacteria 1026
138 Ga0068863_101099053 3300005841 Bacteria 800
139 Ga0068858_100048379 3300005842 Bacteria 3941
140 Ga0068858_100408207 3300005842 Bacteria 1305
141 Ga0068858_101179056 3300005842 Bacteria 753
142 Ga0068860_100000948 3300005843 Bacteria 32094
143 Ga0068860_100004135 3300005843 Bacteria 14875
144 Ga0068860_100364353 3300005843 Bacteria 1424
145 Ga0068862_100011502 3300005844 Bacteria 7305
146 Ga0068862_100364416 3300005844 Bacteria 1344
147 Ga0068862_100558428 3300005844 Bacteria 1094
148 Ga0070715_10553404 3300006163 Bacteria 667
149 Ga0075366_10025761 3300006195 Bacteria 3440
150 Ga0097621_100026101 3300006237 Bacteria 4579
151 Ga0097621_100099568 3300006237 Bacteria 2443
152 Ga0097621_100405770 3300006237 Bacteria 1221
153 Ga0097621_100474928 3300006237 Bacteria 1129
154 Ga0097621_101113745 3300006237 Unclassified 742
155 Ga0097621_101531252 3300006237 Bacteria 633
156 Ga0097621_101711379 3300006237 Bacteria 599
157 Ga0068871_100023184 3300006358 Bacteria 4796
158 Ga0068871_100102773 3300006358 Bacteria 2395
159 Ga0068871_100259477 3300006358 Bacteria 1515
160 Ga0068871_100410508 3300006358 Bacteria 1207
161 Ga0068871_100451593 3300006358 Bacteria 1152
162 Ga0068871_100577314 3300006358 Bacteria 1020
163 Ga0075428_100196649 3300006844 Bacteria 2180
164 Ga0075428_100927845 3300006844 Bacteria 923
165 Ga0075434_101099552 3300006871 Bacteria 808
166 Ga0075434_102072387 3300006871 Bacteria 574
167 Ga0075429_100557168 3300006880 Bacteria 1004
168 Ga0068865_100011688 3300006881 Bacteria 5500
169 Ga0068865_100166058 3300006881 Bacteria 1688
170 Ga0068865_100602233 3300006881 Bacteria 929
171 Ga0097620_100006435 3300006931 Bacteria 11916
172 Ga0097620_100006713 3300006931 Bacteria 11689
173 Ga0097620_100043550 3300006931 Bacteria 4511
174 Ga0097620_100051313 3300006931 Bacteria 4146
175 Ga0097620_100086466 3300006931 Unclassified 3182
176 Ga0097620_100124541 3300006931 Bacteria 2645
177 Ga0097620_100466472 3300006931 Bacteria 1358
178 Ga0105240_11304742 3300009093 Bacteria 765
179 Ga0111539_10013886 3300009094 Bacteria 10071
180 Ga0111539_10424745 3300009094 Bacteria 1548
181 Ga0105245_10780304 3300009098 Bacteria 993
182 Ga0105247_10232560 3300009101 Bacteria 1252
183 Ga0105243_10111772 3300009148 Bacteria 2287
184 Ga0105243_10202477 3300009148 Bacteria 1742
185 Ga0105243_10301175 3300009148 Bacteria 1453
186 Ga0105241_10147673 3300009174 Bacteria 1920
187 Ga0105241_11715953 3300009174 Unclassified 611
188 Ga0105241_12170216 3300009174 Unclassified 550
189 Ga0105242_10028745 3300009176 Bacteria 4427
190 Ga0105242_10075399 3300009176 Bacteria 2808
191 Ga0105242_10086557 3300009176 Bacteria 2630
192 Ga0105242_10094522 3300009176 Unclassified 2522
193 Ga0105242_10169451 3300009176 Bacteria 1918
194 Ga0105242_10710519 3300009176 Bacteria 985
195 Ga0105242_10926027 3300009176 Bacteria 874
196 Ga0105248_11002261 3300009177 Bacteria 943
197 Ga0105248_13154663 3300009177 Bacteria 525
198 Ga0105249_10125298 3300009553 Bacteria 2446
199 Ga0105249_13443916 3300009553 Bacteria 509
200 Ga0105239_10370836 3300010375 Bacteria 1618
201 Ga0105239_10408707 3300010375 Unclassified 1537
202 Ga0105239_12577038 3300010375 Unclassified 593
203 Ga0105246_10101574 3300011119 Bacteria 2095
204 Ga0105246_10526411 3300011119 Bacteria 1009
205 Ga0157373_10096835 3300013100 Bacteria 2077
206 Ga0157371_10056930 3300013102 Bacteria 2772
207 Ga0157371_10136284 3300013102 Bacteria 1748
208 Ga0157371_10785831 3300013102 Bacteria 717
209 Ga0157371_11005339 3300013102 Bacteria 636
210 Ga0157371_11228554 3300013102 Unclassified 578
211 Ga0157370_10153683 3300013104 Bacteria 2141
212 Ga0157370_10503239 3300013104 Bacteria 1112
213 Ga0157370_10539833 3300013104 Bacteria 1069
214 Ga0157370_10771458 3300013104 Unclassified 875
215 Ga0157369_10417514 3300013105 Bacteria 1391
216 Ga0157369_11403635 3300013105 Unclassified 711
217 Ga0157369_12453747 3300013105 Bacteria 528
218 Ga0157374_10001929 3300013296 Bacteria 17404
219 Ga0157374_10016600 3300013296 Bacteria 6476
220 Ga0157374_10018572 3300013296 Bacteria 6139
221 Ga0157374_10077543 3300013296 Bacteria 3145
222 Ga0157374_10128445 3300013296 Bacteria 2451
223 Ga0157374_10269524 3300013296 Bacteria 1678
224 Ga0157374_10415364 3300013296 Bacteria 1344
225 Ga0157374_10871897 3300013296 Bacteria 917
226 Ga0157374_12261984 3300013296 Bacteria 571
227 Ga0157378_10025133 3300013297 Bacteria 5248
228 Ga0157378_10041833 3300013297 Bacteria 4066
229 Ga0157378_10096728 3300013297 Bacteria 2690
230 Ga0157378_10310458 3300013297 Bacteria 1529
231 Ga0157378_10348443 3300013297 Bacteria 1446
232 Ga0157378_10909760 3300013297 Bacteria 911
233 Ga0157378_10933033 3300013297 Bacteria 900
234 Ga0157378_10986532 3300013297 Bacteria 876
235 Ga0157378_11033027 3300013297 Bacteria 857
236 Ga0157378_11795145 3300013297 Bacteria 661
237 Ga0157378_12720746 3300013297 Bacteria 547
238 Ga0163162_10024921 3300013306 Bacteria 5909
239 Ga0163162_10068006 3300013306 Bacteria 3613
240 Ga0163162_10153086 3300013306 Bacteria 2424
241 Ga0163162_10270170 3300013306 Bacteria 1832
242 Ga0163162_10420864 3300013306 Bacteria 1468
243 Ga0163162_10571587 3300013306 Bacteria 1258
244 Ga0163162_10671557 3300013306 Bacteria 1159
245 Ga0163162_11238671 3300013306 Bacteria 847
246 Ga0163162_11486006 3300013306 Bacteria 772
247 Ga0163162_12348438 3300013306 Bacteria 613
248 Ga0157372_10026596 3300013307 Bacteria 6296
249 Ga0157372_10226379 3300013307 Bacteria 2168
250 Ga0157372_10436921 3300013307 Bacteria 1525
251 Ga0157372_10666796 3300013307 Unclassified 1211
252 Ga0157372_11186350 3300013307 Bacteria 882
253 Ga0157372_11727748 3300013307 Bacteria 720
254 Ga0157372_12027079 3300013307 Unclassified 661
255 Ga0157375_10009183 3300013308 Bacteria 8667
256 Ga0157375_10032320 3300013308 Bacteria 4962
257 Ga0157375_10033412 3300013308 Bacteria 4888
258 Ga0157375_10052625 3300013308 Bacteria 4003
259 Ga0157375_10727352 3300013308 Unclassified 1145
260 Ga0157375_11056455 3300013308 Bacteria 949
261 Ga0157375_11213566 3300013308 Unclassified 885
262 Ga0157375_12267892 3300013308 Bacteria 647
263 Ga0163163_10004106 3300014325 Bacteria 12416
264 Ga0163163_10025705 3300014325 Bacteria 5614
265 Ga0163163_10114757 3300014325 Unclassified 2725
266 Ga0163163_10153380 3300014325 Bacteria 2347
267 Ga0163163_10191612 3300014325 Bacteria 2093
268 Ga0163163_11988479 3300014325 Unclassified 641
269 Ga0157380_10059823 3300014326 Bacteria 3042
270 Ga0157380_11612423 3300014326 Bacteria 705
271 Ga0157380_12581035 3300014326 Bacteria 574
272 Ga0157377_10000921 3300014745 Bacteria 12285
273 Ga0157377_10009264 3300014745 Bacteria 4823
274 Ga0157377_10080803 3300014745 Bacteria 1900
275 Ga0157377_10096646 3300014745 Bacteria 1753
276 Ga0157377_11363667 3300014745 Bacteria 557
277 Ga0157379_10122907 3300014968 Bacteria 2336
278 Ga0157379_10195215 3300014968 Bacteria 1829
279 Ga0157379_10516842 3300014968 Viruses 1108
280 Ga0157379_10779734 3300014968 Bacteria 901
281 Ga0157379_11776081 3300014968 Bacteria 605
282 Ga0157376_10113788 3300014969 Bacteria 2386
283 Ga0157376_10127474 3300014969 Bacteria 2266
284 Ga0157376_10661025 3300014969 Bacteria 1046
285 Ga0163161_10003877 3300017792 Bacteria 10489
286 Ga0163161_10036915 3300017792 Bacteria 3501
287 Ga0163161_10149634 3300017792 Bacteria 1773
288 Ga0163161_10531735 3300017792 Bacteria 961
289 Ga0209646_1008478 3300025246 Bacteria 1652
290 Ga0207697_10211421 3300025315 Bacteria 855
291 Ga0207642_10124003 3300025899 Bacteria 1337
292 Ga0207680_10004335 3300025903 Bacteria 6723
293 Ga0207680_10133789 3300025903 Bacteria 1637
294 Ga0207647_10035518 3300025904 Unclassified 3175
295 Ga0207645_10011717 3300025907 Bacteria 5976
296 Ga0207645_10239287 3300025907 Bacteria 1199
297 Ga0207705_10127088 3300025909 Bacteria 1895
298 Ga0207705_11265173 3300025909 Bacteria 564
299 Ga0207695_10483414 3300025913 Unclassified 1120
300 Ga0207660_10748308 3300025917 Bacteria 798
301 Ga0207662_10090041 3300025918 Bacteria 1886
302 Ga0207662_10238214 3300025918 Bacteria 1190
303 Ga0207657_10126589 3300025919 Bacteria 2098
304 Ga0207657_10210924 3300025919 Unclassified 1559
305 Ga0207649_10157823 3300025920 Viruses 1569
306 Ga0207652_10834098 3300025921 Bacteria 817
307 Ga0207681_10004428 3300025923 Bacteria 8650
308 Ga0207681_10297170 3300025923 Bacteria 1277
309 Ga0207681_10427348 3300025923 Viruses 1074
310 Ga0207681_10590699 3300025923 Bacteria 917
311 Ga0207681_10770159 3300025923 Bacteria 803
312 Ga0207681_11743689 3300025923 Unclassified 520
313 Ga0207650_10007342 3300025925 Bacteria 7503
314 Ga0207650_10128081 3300025925 Bacteria 1983
315 Ga0207650_10369046 3300025925 Viruses 1184
316 Ga0207659_10019573 3300025926 Bacteria 4459
317 Ga0207659_10071780 3300025926 Bacteria 2529
318 Ga0207659_10306336 3300025926 Unclassified 1306
319 Ga0207644_10097995 3300025931 Bacteria 2197
320 Ga0207644_10151854 3300025931 Unclassified 1793
321 Ga0207644_10601565 3300025931 Bacteria 913
322 Ga0207644_11004891 3300025931 Bacteria 700
323 Ga0207690_10052982 3300025932 Bacteria 2720
324 Ga0207690_10676036 3300025932 Bacteria 847
325 Ga0207706_10004084 3300025933 Bacteria 13789
326 Ga0207706_10007649 3300025933 Bacteria 9985
327 Ga0207706_10069973 3300025933 Bacteria 3086
328 Ga0207706_11426540 3300025933 Bacteria 567
329 Ga0207686_10003918 3300025934 Bacteria 7982
330 Ga0207686_10010098 3300025934 Bacteria 5135
331 Ga0207686_10018224 3300025934 Bacteria 3971
332 Ga0207686_10050278 3300025934 Bacteria 2591
333 Ga0207709_10259038 3300025935 Bacteria 1274
334 Ga0207670_10160162 3300025936 Bacteria 1679
335 Ga0207670_10169711 3300025936 Viruses 1635
336 Ga0207670_10174257 3300025936 Bacteria 1615
337 Ga0207670_10382397 3300025936 Bacteria 1121
338 Ga0207704_10080660 3300025938 Unclassified 2101
339 Ga0207704_11069892 3300025938 Bacteria 684
340 Ga0207691_10067397 3300025940 Bacteria 3236
341 Ga0207691_10224263 3300025940 Bacteria 1629
342 Ga0207691_10754590 3300025940 Bacteria 819
343 Ga0207691_10805583 3300025940 Bacteria 789
344 Ga0207711_11958511 3300025941 Bacteria 529
345 Ga0207689_10018628 3300025942 Bacteria 5857
346 Ga0207689_10025955 3300025942 Bacteria 4905
347 Ga0207689_10067626 3300025942 Bacteria 2936
348 Ga0207689_10077548 3300025942 Bacteria 2731
349 Ga0207689_10843039 3300025942 Bacteria 774
350 Ga0207661_10000938 3300025944 Bacteria 19194
351 Ga0207661_10021370 3300025944 Bacteria 4847
352 Ga0207661_10736974 3300025944 Bacteria 907
353 Ga0207679_10160712 3300025945 Viruses 1839
354 Ga0207651_10005472 3300025960 Bacteria 6525
355 Ga0207651_10020151 3300025960 Bacteria 4018
356 Ga0207651_10083396 3300025960 Bacteria 2311
357 Ga0207651_10414740 3300025960 Bacteria 1148
358 Ga0207651_10660147 3300025960 Bacteria 919
359 Ga0207712_10075455 3300025961 Bacteria 2437
360 Ga0207640_10041884 3300025981 Bacteria 2916
361 Ga0207640_10206801 3300025981 Bacteria 1492
362 Ga0207640_10517370 3300025981 Bacteria 997
363 Ga0207658_10307432 3300025986 Unclassified 1368
364 Ga0207658_10974278 3300025986 Unclassified 773
365 Ga0207658_11076916 3300025986 Bacteria 734
366 Ga0207677_10188898 3300026023 Bacteria 1628
367 Ga0207677_10190278 3300026023 Bacteria 1622
368 Ga0207677_10211892 3300026023 Bacteria 1548
369 Ga0207677_10253231 3300026023 Bacteria 1431
370 Ga0207677_11541874 3300026023 Bacteria 614
371 Ga0207703_10571481 3300026035 Unclassified 1067
372 Ga0207703_12040929 3300026035 Bacteria 550
373 Ga0207639_10118153 3300026041 Bacteria 2174
374 Ga0207639_10278321 3300026041 Bacteria 1471
375 Ga0207678_10294811 3300026067 Viruses 1393
376 Ga0207641_10040306 3300026088 Bacteria 3910
377 Ga0207641_10212257 3300026088 Bacteria 1791
378 Ga0207641_10269967 3300026088 Viruses 1596
379 Ga0207641_10347818 3300026088 Bacteria 1412
380 Ga0207641_10721767 3300026088 Bacteria 982
381 Ga0207641_11572852 3300026088 Bacteria 659
382 Ga0207641_11953617 3300026088 Bacteria 588
383 Ga0207648_10018231 3300026089 Bacteria 6359
384 Ga0207648_10023009 3300026089 Bacteria 5588
385 Ga0207648_10030431 3300026089 Bacteria 4781
386 Ga0207648_10148823 3300026089 Bacteria 2066
387 Ga0207648_11414841 3300026089 Bacteria 654
388 Ga0207676_10068520 3300026095 Bacteria 2838
389 Ga0207676_10189789 3300026095 Bacteria 1807
390 Ga0207676_10651486 3300026095 Unclassified 1016
391 Ga0207674_10004198 3300026116 Bacteria 17385
392 Ga0207674_10353685 3300026116 Bacteria 1420
393 Ga0207674_11104383 3300026116 Bacteria 762
394 Ga0207675_100000673 3300026118 Bacteria 33675
395 Ga0207675_100328048 3300026118 Bacteria 1495
396 Ga0207683_10016498 3300026121 Bacteria 6286
397 Ga0207683_12182883 3300026121 Bacteria 502
398 Ga0207698_10221039 3300026142 Bacteria 1712
399 Ga0207698_10221452 3300026142 Bacteria 1710
400 Ga0207698_10591217 3300026142 Bacteria 1093
401 Ga0207698_10629984 3300026142 Bacteria 1060
402 Ga0207698_10923681 3300026142 Viruses 881
403 Ga0207428_10115194 3300027907 Bacteria 2065
404 Ga0268266_10439193 3300028379 Bacteria 1239
405 Ga0268266_12193198 3300028379 Bacteria 524
406 Ga0268265_10012539 3300028380 Bacteria 5745
407 Ga0268265_10799752 3300028380 Bacteria 919
408 Ga0268265_10918941 3300028380 Bacteria 860
409 Ga0268265_11432572 3300028380 Bacteria 693
410 Ga0268264_10002905 3300028381 Bacteria 14887
411 Ga0268264_10003983 3300028381 Bacteria 12642
412 Ga0268264_10268473 3300028381 Bacteria 1593
413 Ga0268264_10368145 3300028381 Bacteria 1373
414 Ga0268264_10628522 3300028381 Bacteria 1061
415 Ga0265318_10296475 3300028577 Bacteria 590
416 Ga0307517_10006326 3300028786 Bacteria 17574
417 Ga0265324_10017579 3300029957 Bacteria 2601
418 Ga0265327_10005855 3300031251 Bacteria 10057
419 Ga0265316_10366119 3300031344 Bacteria 1042
420 Ga0307405_11410141 3300031731 Unclassified 609
421 Ga0307413_10794692 3300031824 Unclassified 795
422 Ga0307406_10108742 3300031901 Bacteria 1904
423 Ga0307416_100000290 3300032002 Bacteria 26271
424 Ga0307415_100017974 3300032126 Bacteria 4256
425 Ga0373956_0537314 3300035119 Unclassified 558
426 Ga0373955_0037711 3300035172 Unclassified 2571
427 Ga0373924_0080173 3300035410 Unclassified 1387
428 Ga0373937_0059624 3300036401 Bacteria 3507
429 Ga0451851_0080711 3300041507 Bacteria 679
430 Ga0451851_0658338 3300041507 Bacteria 1076
431 Ga0451853_1083660 3300041512 Bacteria 648
432 Ga0451577_0196983 3300042876 Bacteria 1818
433 Ga0466972_0051683 3300044658 Bacteria 1982
434 Ga0466967_1318750 3300045976 Bacteria 719
435 Ga0495608_0422475 3300046511 Bacteria 813
436 Ga0495628_0063890 3300046516 Unclassified 2883
437 Ga0495630_0017802 3300046517 Bacteria 5210
438 Ga0495640_0567005 3300046533 Unclassified 687
439 Ga0495586_0116857 3300046535 Unclassified 1488
440 Ga0495587_0477535 3300046536 Bacteria 690
441 Ga0495645_0054922 3300046543 Unclassified 2893
442 Ga0495634_0104001 3300046642 Bacteria 1832
443 Ga0495599_0291343 3300046678 Bacteria 987
444 Ga0495646_0255379 3300046680 Unclassified 938
445 Ga0495671_0544582 3300046692 Unclassified 553
446 Ga0495604_0569110 3300047317 Unclassified 729
447 Ga0495674_0817063 3300047319 Unclassified 724
448 Ga0495676_0437275 3300047321 Unclassified 864
449 Ga0495675_0183319 3300047444 Unclassified 1281
450 Ga0495684_0370052 3300047471 Bacteria 1013
451 Ga0495602_0736340 3300048088 Unclassified 666
452 Ga0496100_0721378 3300048903 Bacteria 779
453 Ga0496105_0784431 3300048908 Bacteria 726
454 Ga0496108_0392083 3300048911 Viruses 1213
455 Ga0496109_0492846 3300048912 Viruses 1157
456 Ga0496110_0071134 3300048913 Unclassified 3084
457 Ga0496111_0063848 3300048914 Bacteria 2671
458 Ga0496111_0320049 3300048914 Viruses 1149
459 Ga0496114_0637487 3300048917 Bacteria 938
460 Ga0501034_0815757 3300049571 Bacteria 825
461 Ga0501037_0619715 3300049573 Bacteria 725
462 Ga0501038_1202991 3300049574 Unclassified 550
463 Ga0501043_0523658 3300049579 Bacteria 883
464 Ga0501047_0015360 3300049581 Bacteria 7295
465 Ga0501199_041534 3300049650 Bacteria 598
466 Ga0501217_006558 3300049661 Bacteria 2477
467 Ga0501243_036823 3300049675 Bacteria 849
468 Ga0501250_001917 3300049680 Bacteria 1807
469 Ga0501257_009245 3300049686 Bacteria 2223
470 Ga0501261_054215 3300049690 Bacteria 665
471 Ga0501221_076303 3300049704 Bacteria 799
472 Ga0501279_099820 3300049775 Bacteria 522
473 Ga0501035_0069443 3300049822 Bacteria 3123
474 Ga0501044_0046903 3300049823 Bacteria 4471
475 nmdc:mga0k408_23440_c1 3300050493 Bacteria 3482
476 nmdc:mga09592_20923_c1 3300050508 Bacteria 5388
477 nmdc:mga08y16_632494_c1 3300050511 Bacteria 1076
478 nmdc:mga08y16_691967_c1 3300050511 Bacteria 1020
479 nmdc:mga08y16_70048_c1 3300050511 Bacteria 3656
480 nmdc:mga0rr50_452679_c1 3300050513 Bacteria 1088
481 Ga0495619_0035448 3300053085 Unclassified 3245
482 Ga0500578_0000934 3300053086 Bacteria 32814
483 Ga0500572_063684 3300053111 Bacteria 1126
484 Ga0500589_029496 3300053147 Bacteria 2552
485 Ga0207658_10416202
486 MBSR1b_contig_10676560
487 ARcpr5yngRDRAFT_c007554
488 JGI24751J29686_10008532
489 JGI25154J39366_1016379
490 rootH1_10260837
491 Ga0065714_10340517
492 Ga0065712_10001520
493 Ga0065712_10154205
494 Ga0065712_10476481
495 Ga0065715_10921139
496 Ga0065707_10097600
497 Ga0065707_10121016
498 Ga0070658_10194527
499 Ga0070676_10009474
500 Ga0070676_10404035
501 Ga0070683_100027772
502 Ga0070690_100016504
503 Ga0070690_100020173
504 Ga0070690_100064729
505 Ga0070690_100277321
506 Ga0070670_100006902
507 Ga0070670_100032916
508 Ga0070670_100592354
509 Ga0070670_101234427
510 Ga0068869_100125653
511 Ga0070666_10015841
512 Ga0070666_10904709
513 Ga0070682_100044188
514 Ga0070682_100303542
515 Ga0068868_100066902
516 Ga0068868_100131542
517 Ga0068868_100162631
518 Ga0068868_100171508
519 Ga0068868_100853230
520 Ga0068868_101147653
521 Ga0070689_100031736
522 Ga0070689_100561007
523 Ga0070687_100028834
524 Ga0070687_100179771
525 Ga0070661_100042410
526 Ga0070661_100059318
527 Ga0070669_100002586
528 Ga0070669_100079480
529 Ga0070669_100209172
530 Ga0070669_100527122
531 Ga0070669_101659738
532 Ga0070675_100010319
533 Ga0070675_100116306
534 Ga0070675_100400860
535 Ga0070671_100441002
536 Ga0070671_100598820
537 Ga0070671_100939848
538 Ga0070671_101638872
539 Ga0070673_100002320
540 Ga0070673_100024486
541 Ga0070673_100024865
542 Ga0070673_100112430
543 Ga0070673_100130521
544 Ga0070673_101110741
545 Ga0070673_101685088
546 Ga0070688_100022484
547 Ga0070688_100157475
548 Ga0070688_101269105
549 Ga0070688_101277230
550 Ga0070659_100008356
551 Ga0070659_101071135
552 Ga0070667_100483336
553 Ga0070667_100572170
554 Ga0070667_100798317
555 Ga0070701_10003603
556 Ga0070694_100205338
557 Ga0070708_102180722
558 Ga0070663_101397801
559 Ga0070678_100533656
560 Ga0070662_100004551
561 Ga0070662_100006375
562 Ga0070662_100010194
563 Ga0070662_100635604
564 Ga0070662_101088315
565 Ga0068867_100015351
566 Ga0068867_100283221
567 Ga0068867_100566278
568 Ga0068867_100948183
569 Ga0068867_101293352
570 Ga0068867_102321900
571 Ga0070685_10024921
572 Ga0070685_10029331
573 Ga0070685_11165192
574 Ga0070706_100206418
575 Ga0070679_100341060
576 Ga0070684_100021442
577 Ga0070684_100028680
578 Ga0070684_100049901
579 Ga0068853_100222601
580 Ga0068853_100318148
581 Ga0070672_100118686
582 Ga0070672_100118696
583 Ga0070686_100124146
584 Ga0070686_100540482
585 Ga0070695_100199423
586 Ga0070665_100197240
587 Ga0070665_100242478
588 Ga0070665_101925404
589 Ga0070665_102507095
590 Ga0068855_100267749
591 Ga0070664_100026476
592 Ga0070664_100256919
593 Ga0070664_100775833
594 Ga0068857_100012971
595 Ga0068857_100113575
596 Ga0068857_100343330
597 Ga0068854_100208041
598 Ga0068854_100408990
599 Ga0068854_100611154
600 Ga0070702_100111800
601 Ga0070702_100691835
602 Ga0068852_100205315
603 Ga0068852_100679298
604 Ga0068852_100811954
605 Ga0068852_102259359
606 Ga0068852_102379138
607 Ga0068859_100006435
608 Ga0068859_100043549
609 Ga0068859_100051313
610 Ga0068859_100086464
611 Ga0068859_100124542
612 Ga0068859_100466437
613 Ga0068864_100006888
614 Ga0068864_100054228
615 Ga0068866_10708520
616 Ga0068851_10158685
617 Ga0068851_10375271
618 Ga0068863_100022303
619 Ga0068863_100072420
620 Ga0068863_100286446
621 Ga0068863_100674038
622 Ga0068863_101099053
623 Ga0068858_100048379
624 Ga0068858_100408207
625 Ga0068858_101179056
626 Ga0068860_100000948
627 Ga0068860_100004135
628 Ga0068860_100364353
629 Ga0068862_100011502
630 Ga0068862_100364416
631 Ga0068862_100558428
632 Ga0070715_10553404
633 Ga0075366_10025761
634 Ga0097621_100026101
635 Ga0097621_100099568
636 Ga0097621_100405770
637 Ga0097621_100474928
638 Ga0097621_101113745
639 Ga0097621_101531252
640 Ga0097621_101711379
641 Ga0068871_100023184
642 Ga0068871_100102773
643 Ga0068871_100259477
644 Ga0068871_100410508
645 Ga0068871_100451593
646 Ga0068871_100577314
647 Ga0075428_100196649
648 Ga0075428_100927845
649 Ga0075434_101099552
650 Ga0075434_102072387
651 Ga0075429_100557168
652 Ga0068865_100011688
653 Ga0068865_100166058
654 Ga0068865_100602233
655 Ga0097620_100006435
656 Ga0097620_100006713
657 Ga0097620_100043550
658 Ga0097620_100051313
659 Ga0097620_100086466
660 Ga0097620_100124541
661 Ga0097620_100466472
662 Ga0105240_11304742
663 Ga0111539_10013886
664 Ga0111539_10424745
665 Ga0105245_10780304
666 Ga0105247_10232560
667 Ga0105243_10111772
668 Ga0105243_10202477
669 Ga0105243_10301175
670 Ga0105241_10147673
671 Ga0105241_11715953
672 Ga0105241_12170216
673 Ga0105242_10028745
674 Ga0105242_10075399
675 Ga0105242_10086557
676 Ga0105242_10094522
677 Ga0105242_10169451
678 Ga0105242_10710519
679 Ga0105242_10926027
680 Ga0105248_11002261
681 Ga0105248_13154663
682 Ga0105249_10125298
683 Ga0105249_13443916
684 Ga0105239_10370836
685 Ga0105239_10408707
686 Ga0105239_12577038
687 Ga0105246_10101574
688 Ga0105246_10526411
689 Ga0157373_10096835
690 Ga0157371_10056930
691 Ga0157371_10136284
692 Ga0157371_10785831
693 Ga0157371_11005339
694 Ga0157371_11228554
695 Ga0157370_10153683
696 Ga0157370_10503239
697 Ga0157370_10539833
698 Ga0157370_10771458
699 Ga0157369_10417514
700 Ga0157369_11403635
701 Ga0157369_12453747
702 Ga0157374_10001929
703 Ga0157374_10016600
704 Ga0157374_10018572
705 Ga0157374_10077543
706 Ga0157374_10128445
707 Ga0157374_10269524
708 Ga0157374_10415364
709 Ga0157374_10871897
710 Ga0157374_12261984
711 Ga0157378_10025133
712 Ga0157378_10041833
713 Ga0157378_10096728
714 Ga0157378_10310458
715 Ga0157378_10348443
716 Ga0157378_10909760
717 Ga0157378_10933033
718 Ga0157378_10986532
719 Ga0157378_11033027
720 Ga0157378_11795145
721 Ga0157378_12720746
722 Ga0163162_10024921
723 Ga0163162_10068006
724 Ga0163162_10153086
725 Ga0163162_10270170
726 Ga0163162_10420864
727 Ga0163162_10571587
728 Ga0163162_10671557
729 Ga0163162_11238671
730 Ga0163162_11486006
731 Ga0163162_12348438
732 Ga0157372_10026596
733 Ga0157372_10226379
734 Ga0157372_10436921
735 Ga0157372_10666796
736 Ga0157372_11186350
737 Ga0157372_11727748
738 Ga0157372_12027079
739 Ga0157375_10009183
740 Ga0157375_10032320
741 Ga0157375_10033412
742 Ga0157375_10052625
743 Ga0157375_10727352
744 Ga0157375_11056455
745 Ga0157375_11213566
746 Ga0157375_12267892
747 Ga0163163_10004106
748 Ga0163163_10025705
749 Ga0163163_10114757
750 Ga0163163_10153380
751 Ga0163163_10191612
752 Ga0163163_11988479
753 Ga0157380_10059823
754 Ga0157380_11612423
755 Ga0157380_12581035
756 Ga0157377_10000921
757 Ga0157377_10009264
758 Ga0157377_10080803
759 Ga0157377_10096646
760 Ga0157377_11363667
761 Ga0157379_10122907
762 Ga0157379_10195215
763 Ga0157379_10516842
764 Ga0157379_10779734
765 Ga0157379_11776081
766 Ga0157376_10113788
767 Ga0157376_10127474
768 Ga0157376_10661025
769 Ga0163161_10003877
770 Ga0163161_10036915
771 Ga0163161_10149634
772 Ga0163161_10531735
773 Ga0209646_1008478
774 Ga0207697_10211421
775 Ga0207642_10124003
776 Ga0207680_10004335
777 Ga0207680_10133789
778 Ga0207647_10035518
779 Ga0207645_10011717
780 Ga0207645_10239287
781 Ga0207705_10127088
782 Ga0207705_11265173
783 Ga0207695_10483414
784 Ga0207660_10748308
785 Ga0207662_10090041
786 Ga0207662_10238214
787 Ga0207657_10126589
788 Ga0207657_10210924
789 Ga0207649_10157823
790 Ga0207652_10834098
791 Ga0207681_10004428
792 Ga0207681_10297170
793 Ga0207681_10427348
794 Ga0207681_10590699
795 Ga0207681_10770159
796 Ga0207681_11743689
797 Ga0207650_10007342
798 Ga0207650_10128081
799 Ga0207650_10369046
800 Ga0207659_10019573
801 Ga0207659_10071780
802 Ga0207659_10306336
803 Ga0207644_10097995
804 Ga0207644_10151854
805 Ga0207644_10601565
806 Ga0207644_11004891
807 Ga0207690_10052982
808 Ga0207690_10676036
809 Ga0207706_10004084
810 Ga0207706_10007649
811 Ga0207706_10069973
812 Ga0207706_11426540
813 Ga0207686_10003918
814 Ga0207686_10010098
815 Ga0207686_10018224
816 Ga0207686_10050278
817 Ga0207709_10259038
818 Ga0207670_10160162
819 Ga0207670_10169711
820 Ga0207670_10174257
821 Ga0207670_10382397
822 Ga0207704_10080660
823 Ga0207704_11069892
824 Ga0207691_10067397
825 Ga0207691_10224263
826 Ga0207691_10754590
827 Ga0207691_10805583
828 Ga0207711_11958511
829 Ga0207689_10018628
830 Ga0207689_10025955
831 Ga0207689_10067626
832 Ga0207689_10077548
833 Ga0207689_10843039
834 Ga0207661_10000938
835 Ga0207661_10021370
836 Ga0207661_10736974
837 Ga0207679_10160712
838 Ga0207651_10005472
839 Ga0207651_10020151
840 Ga0207651_10083396
841 Ga0207651_10414740
842 Ga0207651_10660147
843 Ga0207712_10075455
844 Ga0207640_10041884
845 Ga0207640_10206801
846 Ga0207640_10517370
847 Ga0207658_10307432
848 Ga0207658_10974278
849 Ga0207658_11076916
850 Ga0207677_10188898
851 Ga0207677_10190278
852 Ga0207677_10211892
853 Ga0207677_10253231
854 Ga0207677_11541874
855 Ga0207703_10571481
856 Ga0207703_12040929
857 Ga0207639_10118153
858 Ga0207639_10278321
859 Ga0207678_10294811
860 Ga0207641_10040306
861 Ga0207641_10212257
862 Ga0207641_10269967
863 Ga0207641_10347818
864 Ga0207641_10721767
865 Ga0207641_11572852
866 Ga0207641_11953617
867 Ga0207648_10018231
868 Ga0207648_10023009
869 Ga0207648_10030431
870 Ga0207648_10148823
871 Ga0207648_11414841
872 Ga0207676_10068520
873 Ga0207676_10189789
874 Ga0207676_10651486
875 Ga0207674_10004198
876 Ga0207674_10353685
877 Ga0207674_11104383
878 Ga0207675_100000673
879 Ga0207675_100328048
880 Ga0207683_10016498
881 Ga0207683_12182883
882 Ga0207698_10221039
883 Ga0207698_10221452
884 Ga0207698_10591217
885 Ga0207698_10629984
886 Ga0207698_10923681
887 Ga0207428_10115194
888 Ga0268266_10439193
889 Ga0268266_12193198
890 Ga0268265_10012539
891 Ga0268265_10799752
892 Ga0268265_10918941
893 Ga0268265_11432572
894 Ga0268264_10002905
895 Ga0268264_10003983
896 Ga0268264_10268473
897 Ga0268264_10368145
898 Ga0268264_10628522
899 Ga0265318_10296475
900 Ga0307517_10006326
901 Ga0265324_10017579
902 Ga0265327_10005855
903 Ga0265316_10366119
904 Ga0307405_11410141
905 Ga0307413_10794692
906 Ga0307406_10108742
907 Ga0307416_100000290
908 Ga0307415_100017974
909 Ga0373956_0537314
910 Ga0373955_0037711
911 Ga0373924_0080173
912 Ga0373937_0059624
913 Ga0451851_0080711
914 Ga0451851_0658338
915 Ga0451853_1083660
916 Ga0451577_0196983
917 Ga0466972_0051683
918 Ga0466967_1318750
919 Ga0495608_0422475
920 Ga0495628_0063890
921 Ga0495630_0017802
922 Ga0495640_0567005
923 Ga0495586_0116857
924 Ga0495587_0477535
925 Ga0495645_0054922
926 Ga0495634_0104001
927 Ga0495599_0291343
928 Ga0495646_0255379
929 Ga0495671_0544582
930 Ga0495604_0569110
931 Ga0495674_0817063
932 Ga0495676_0437275
933 Ga0495675_0183319
934 Ga0495684_0370052
935 Ga0495602_0736340
936 Ga0496100_0721378
937 Ga0496105_0784431
938 Ga0496108_0392083
939 Ga0496109_0492846
940 Ga0496110_0071134
941 Ga0496111_0063848
942 Ga0496111_0320049
943 Ga0496114_0637487
944 Ga0501034_0815757
945 Ga0501037_0619715
946 Ga0501038_1202991
947 Ga0501043_0523658
948 Ga0501047_0015360
949 Ga0501199_041534
950 Ga0501217_006558
951 Ga0501243_036823
952 Ga0501250_001917
953 Ga0501257_009245
954 Ga0501261_054215
955 Ga0501221_076303
956 Ga0501279_099820
957 Ga0501035_0069443
958 Ga0501044_0046903
959 nmdc:mga0k408_23440_c1
960 nmdc:mga09592_20923_c1
961 nmdc:mga08y16_632494_c1
962 nmdc:mga08y16_691967_c1
963 nmdc:mga08y16_70048_c1
964 nmdc:mga0rr50_452679_c1
965 Ga0495619_0035448
966 Ga0500578_0000934
967 Ga0500572_063684
968 Ga0500589_029496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

27

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5k-assembly1.cif.gz_E m. xanthus ferritin-like protein encb 0.9846 38 85
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.9759 38 89
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.9737 38 89
7s5c-assembly1.cif.gz_E m. xanthus ferritin-like protein encb 0.9676 38 89
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9576 7 114
ID Description Score Start End Superfamily
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9576 7 114 1.20.1440.60
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9569 7 114 1.20.1440.60
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9139 12 115 1.20.1440.60
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9026 12 114 1.20.1440.60
2rldB00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.8992 12 114 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A537IK21-F1-model_v4 Four helix bundle protein 0.9871 10 115
AF-A0A522BP79-F1-model_v4 Four helix bundle protein 0.983 7 114
AF-A0A4Q5YD91-F1-model_v4 Four helix bundle protein 0.9825 1 114
AF-F4KMJ2-F1-model_v4 S23 ribosomal protein 0.9815 7 114 GO:0005840
AF-A0A4S8HWU5-F1-model_v4 Four helix bundle protein 0.9814 3 115

Map