F452938

General Info

Members Datasets Scaffolds Average Seq Length
484 312 405 236

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10012587|Ga0157369_100125872
Length 283
Sequence MTRSDAGQGANGNVGHAVFDADVSSDCFHPISCARRARAPAINPRKGCVMKIEGSVVLVTGANRGLGLEFARQALQRGARKVYAGARDPASVTLPGVVPLKLDVTDPAAVAAAAEAARDVTLLINNAGIARLGSLTDDGALDVLRDHFETNVFGMLAMSRAFAGHLAGNGGGAILNVLSVASWINRPILSGYGVSKSAAWAVTNGLRHSLREQRTQVVGLHAGFIDTDLTRGLEVPKATPADVVRQAFDAIEAGAEEVSTDEFTREVKAALSAGVYLNEPAPR

Samples

Sample ID Description Type Environment
1 2511231018 Pseudomonas sp. GM60 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
5 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
8 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
9 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
14 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
15 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
18 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
19 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
20 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
21 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
22 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
23 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
24 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
25 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
26 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
27 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
28 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
29 2818991452 Burkholderia cepacia 561 Isolate Unclassified
30 2821131069 Duganella sp. 1224 Isolate Unclassified
31 2831864461 Roseateles noduli HZ7 Isolate Nodule
32 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
33 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
34 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
35 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
36 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
37 2904424332 Duganella sp. 1411 Isolate Rhizosphere
38 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
39 2904564687 Burkholderia sp. 571 Isolate Unclassified
40 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
41 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
42 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
43 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
44 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
45 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
46 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
47 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
48 2928163908 Burkholderia sp. 567 Isolate Unclassified
49 2928170801 Burkholderia sp. 572 Isolate Unclassified
50 2928536128 Burkholderia sola 565 Isolate Unclassified
51 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
52 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
53 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
54 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
55 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
56 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
57 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
58 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
59 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
65 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
69 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
70 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
71 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
72 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
73 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
74 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
75 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
76 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
77 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
80 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
186 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
297 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
304 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
305 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
306 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
307 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
308 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
309 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
310 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
311 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
312 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.54
Metatranscriptomes 0
Isolates 14.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.77
Nodule 5.17
Rhizoplane 3.1
Rhizosphere 62.19
Stem 0
Stem Tuber 0
Unclassified 11.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018115 3300001979 Bacteria 2506
2 JGI24739J22299_10000469 3300001989 Bacteria 14200
3 JGI24735J21928_10003603 3300002067 Bacteria 5258
4 JGI25156J39149_1001230 3300002705 Bacteria 11246
5 JGI25162J39368_1000053 3300002737 Bacteria 148653
6 JGI25163J39215_1001679 3300002771 Bacteria 3189
7 JGI25164J39214_1000042 3300002772 Bacteria 126523
8 JGI25164J39214_1000080 3300002772 Bacteria 94261
9 JGI25164J39214_1000081 3300002772 Bacteria 93862
10 JGI25165J46597_1000060 3300003214 Bacteria 208907
11 JGI25165J46597_1000606 3300003214 Bacteria 30552
12 rootH1_10043278 3300003323 Bacteria 5302
13 rootH1_10119473 3300003323 Bacteria 2520
14 Ga0055538_1000413 3300003751 Bacteria 16688
15 Ga0055539_1000404 3300003752 Bacteria 16684
16 Ga0055533_1000140 3300003756 Bacteria 76502
17 Ga0055533_1000411 3300003756 Bacteria 16684
18 Ga0055532_1000003 3300003758 Bacteria 494004
19 Ga0055532_1000531 3300003758 Bacteria 16651
20 Ga0055532_1000579 3300003758 Bacteria 15077
21 Ga0055525_1000564 3300003759 Bacteria 16684
22 Ga0055527_1000006 3300003760 Bacteria 494004
23 Ga0055527_1003187 3300003760 Bacteria 2510
24 Ga0055535_1000003 3300003761 Bacteria 494004
25 Ga0055535_1000841 3300003761 Bacteria 21948
26 Ga0055542_1000007 3300003762 Bacteria 494004
27 Ga0055542_1000858 3300003762 Bacteria 21288
28 Ga0055529_1000003 3300003763 Bacteria 494004
29 Ga0055529_1000317 3300003763 Bacteria 54844
30 Ga0055524_1007759 3300003775 Bacteria 4525
31 Ga0055528_1001316 3300003790 Bacteria 15531
32 Ga0055540_1021420 3300003792 Bacteria 1679
33 Ga0055541_1000296 3300003841 Bacteria 16684
34 Ga0070658_10019818 3300005327 Bacteria 5387
35 Ga0070670_100460620 3300005331 Unclassified 1128
36 Ga0070680_100071372 3300005336 Bacteria 2853
37 Ga0070660_100000011 3300005339 Bacteria 133167
38 Ga0070668_100069584 3300005347 Bacteria 2738
39 Ga0070668_100161683 3300005347 Unclassified 1817
40 Ga0070669_100246984 3300005353 Bacteria 1420
41 Ga0070675_100553031 3300005354 Bacteria 1041
42 Ga0070674_100013294 3300005356 Bacteria 5086
43 Ga0070673_100356303 3300005364 Bacteria 1300
44 Ga0070659_100001681 3300005366 Bacteria 15902
45 Ga0070667_100001066 3300005367 Bacteria 25082
46 Ga0070667_100531308 3300005367 Bacteria 1080
47 Ga0070663_100000269 3300005455 Bacteria 26169
48 Ga0068867_100194358 3300005459 Bacteria 1621
49 Ga0070706_100116769 3300005467 Bacteria 2486
50 Ga0070707_100726420 3300005468 Bacteria 956
51 Ga0070679_100073402 3300005530 Bacteria 3413
52 Ga0070672_100410602 3300005543 Bacteria 1162
53 Ga0068855_100102204 3300005563 Bacteria 3299
54 Ga0068855_100384444 3300005563 Bacteria 1540
55 Ga0068852_100011830 3300005616 Bacteria 6593
56 Ga0068864_100210054 3300005618 Bacteria 1792
57 Ga0068858_100533280 3300005842 Bacteria 1136
58 Ga0068858_100854317 3300005842 Bacteria 889
59 Ga0068860_100471935 3300005843 Bacteria 1250
60 Ga0081540_1148184 3300005983 Unclassified 930
61 Ga0075368_10020763 3300006042 Bacteria 2489
62 Ga0075363_100058433 3300006048 Bacteria 2071
63 Ga0075364_10150245 3300006051 Bacteria 1570
64 Ga0075362_10001812 3300006177 Bacteria 6973
65 Ga0075367_10020075 3300006178 Bacteria 3716
66 Ga0075366_10000725 3300006195 Bacteria 15669
67 Ga0075366_10038773 3300006195 Bacteria 2814
68 Ga0075370_10003649 3300006353 Bacteria 7370
69 Ga0075370_10036917 3300006353 Bacteria 2746
70 Ga0068865_100627231 3300006881 Bacteria 911
71 Ga0097620_100275320 3300006931 Bacteria 1775
72 Ga0099823_1000110 3300006944 Bacteria 40918
73 Ga0079104_1002933 3300006946 Bacteria 8464
74 Ga0105240_10004799 3300009093 Bacteria 20372
75 Ga0105245_10000029 3300009098 Bacteria 155777
76 Ga0105248_10003881 3300009177 Bacteria 16523
77 Ga0105248_10298163 3300009177 Bacteria 1815
78 Ga0105248_10835086 3300009177 Bacteria 1040
79 Ga0105237_10161090 3300009545 Bacteria 2242
80 Ga0105237_10413728 3300009545 Bacteria 1353
81 Ga0105239_10088700 3300010375 Bacteria 3410
82 Ga0105246_10020348 3300011119 Plasmid 4254
83 Ga0157370_10017234 3300013104 Bacteria 7290
84 Ga0157370_10178875 3300013104 Bacteria 1971
85 Ga0157369_10012587 3300013105 Bacteria 9598
86 Ga0157369_10454845 3300013105 Bacteria 1326
87 Ga0157374_10098944 3300013296 Bacteria 2793
88 Ga0163162_10053273 3300013306 Bacteria 4066
89 Ga0163162_10163335 3300013306 Bacteria 2350
90 Ga0157372_10716156 3300013307 Bacteria 1164
91 Ga0157375_10001163 3300013308 Bacteria 22743
92 Ga0157375_10033794 3300013308 Bacteria 4864
93 Ga0157375_10222762 3300013308 Bacteria 2045
94 Ga0182008_10089803 3300014497 Bacteria 1514
95 Ga0157376_10096934 3300014969 Unclassified 2568
96 Ga0157376_10227843 3300014969 Bacteria 1730
97 Ga0182006_1004056 3300015261 Bacteria 7303
98 Ga0182007_10097768 3300015262 Bacteria 970
99 Ga0182007_10134155 3300015262 Bacteria 834
100 Ga0182005_1005810 3300015265 Bacteria 3826
101 Ga0182005_1021300 3300015265 Bacteria 1779
102 Ga0182005_1024681 3300015265 Bacteria 1641
103 Ga0163161_10009950 3300017792 Bacteria 6587
104 Ga0213872_10008575 3300021361 Bacteria 4943
105 Ga0213872_10075104 3300021361 Bacteria 1521
106 Ga0213872_10124578 3300021361 Bacteria 1138
107 Ga0209760_100013 3300025207 Bacteria 181451
108 Ga0209784_100005 3300025224 Bacteria 1040422
109 Ga0209566_100005 3300025225 Bacteria 1040422
110 Ga0209566_100250 3300025225 Bacteria 51454
111 Ga0209674_100009 3300025226 Bacteria 1040422
112 Ga0209674_100025 3300025226 Bacteria 515942
113 Ga0209674_101547 3300025226 Bacteria 5877
114 Ga0209672_100002 3300025228 Bacteria 1733325
115 Ga0209672_100057 3300025228 Bacteria 215485
116 Ga0209147_100003 3300025229 Bacteria 1733325
117 Ga0209147_100047 3300025229 Bacteria 288873
118 Ga0209147_100121 3300025229 Bacteria 139167
119 Ga0209563_100012 3300025230 Bacteria 1040422
120 Ga0209563_100206 3300025230 Bacteria 31352
121 Ga0207427_100011 3300025231 Bacteria 640076
122 Ga0207427_100471 3300025231 Bacteria 22019
123 Ga0209437_100025 3300025233 Bacteria 561333
124 Ga0209258_100005 3300025242 Bacteria 1087938
125 Ga0209258_100065 3300025242 Bacteria 288500
126 Ga0209258_106349 3300025242 Bacteria 1864
127 Ga0209677_100006 3300025253 Bacteria 1040422
128 Ga0209148_1000006 3300025254 Bacteria 1733325
129 Ga0209148_1000091 3300025254 Bacteria 250913
130 Ga0209759_1000014 3300025256 Bacteria 396291
131 Ga0209759_1012016 3300025256 Bacteria 2422
132 Ga0209233_1000012 3300025261 Bacteria 1019519
133 Ga0209233_1000018 3300025261 Bacteria 886857
134 Ga0209455_1000003 3300025272 Bacteria 1471893
135 Ga0209455_1000074 3300025272 Bacteria 289143
136 Ga0209673_1000437 3300025273 Bacteria 71770
137 Ga0209673_1002458 3300025273 Bacteria 12822
138 Ga0209564_1022836 3300025295 Bacteria 2194
139 Ga0209050_1007212 3300025298 Bacteria 6312
140 Ga0209256_1006328 3300025299 Bacteria 6326
141 Ga0209051_1002346 3300025303 Bacteria 13708
142 Ga0209257_1003042 3300025304 Bacteria 15129
143 Ga0207697_10007309 3300025315 Bacteria 4934
144 Ga0207655_1061434 3300025728 Bacteria 1450
145 Ga0207647_10004603 3300025904 Bacteria 10216
146 Ga0207645_10028636 3300025907 Bacteria 3595
147 Ga0207695_10000547 3300025913 Bacteria 78059
148 Ga0207695_10029812 3300025913 Bacteria 6019
149 Ga0207671_10008585 3300025914 Bacteria 8637
150 Ga0207660_10069047 3300025917 Bacteria 2565
151 Ga0207657_10000019 3300025919 Bacteria 159785
152 Ga0207649_10129764 3300025920 Bacteria 1710
153 Ga0207681_10220178 3300025923 Bacteria 1468
154 Ga0207681_10555811 3300025923 Unclassified 945
155 Ga0207659_10118732 3300025926 Bacteria 2023
156 Ga0207687_10000190 3300025927 Bacteria 41259
157 Ga0207664_10692097 3300025929 Bacteria 917
158 Ga0207690_10000028 3300025932 Bacteria 160775
159 Ga0207669_10049661 3300025937 Bacteria 2502
160 Ga0207704_10471166 3300025938 Bacteria 1006
161 Ga0207691_10012081 3300025940 Bacteria 8281
162 Ga0207691_10083142 3300025940 Bacteria 2874
163 Ga0207711_10010674 3300025941 Bacteria 7637
164 Ga0207711_10096865 3300025941 Bacteria 2604
165 Ga0207667_10171423 3300025949 Bacteria 2230
166 Ga0207667_10338417 3300025949 Bacteria 1536
167 Ga0207651_10124477 3300025960 Bacteria 1962
168 Ga0207668_10624258 3300025972 Bacteria 941
169 Ga0207658_10499112 3300025986 Bacteria 1084
170 Ga0207703_10383612 3300026035 Bacteria 1300
171 Ga0207678_10000326 3300026067 Bacteria 42831
172 Ga0207702_10064803 3300026078 Bacteria 3128
173 Ga0207702_10278794 3300026078 Bacteria 1579
174 Ga0207641_10156882 3300026088 Bacteria 2066
175 Ga0207648_10062728 3300026089 Bacteria 3240
176 Ga0207676_10158944 3300026095 Bacteria 1956
177 Ga0207676_10416783 3300026095 Bacteria 1259
178 Ga0207674_10011486 3300026116 Bacteria 9949
179 Ga0207674_10152331 3300026116 Bacteria 2269
180 Ga0207674_10205995 3300026116 Bacteria 1916
181 Ga0207698_10005421 3300026142 Bacteria 7885
182 Ga0207698_10331836 3300026142 Bacteria 1429
183 Ga0209281_1002159 3300027111 Bacteria 8613
184 Ga0209389_1000627 3300027296 Bacteria 21840
185 Ga0209371_1000180 3300027312 Bacteria 93452
186 Ga0209813_10017818 3300027866 Bacteria 1954
187 Ga0268266_10205862 3300028379 Bacteria 1803
188 Ga0307515_10026432 3300028794 Bacteria 9990
189 Ga0265338_10002191 3300028800 Bacteria 29919
190 Ga0268256_1000308 3300030500 Bacteria 49146
191 Ga0265327_10080048 3300031251 Bacteria 1616
192 Ga0307513_10000924 3300031456 Bacteria 42435
193 Ga0307508_10075541 3300031616 Bacteria 2947
194 Ga0307516_10017051 3300031730 Bacteria 7583
195 Ga0307405_10033930 3300031731 Bacteria 3032
196 Ga0307412_10000059 3300031911 Bacteria 138772
197 Ga0307411_10184705 3300032005 Bacteria 1586
198 Ga0373939_0138793 3300035114 Bacteria 875
199 Ga0373925_0016649 3300037068 Bacteria 5325
200 Ga0395905_0792436 3300037471 Bacteria 851
201 Ga0436361_0032762 3300039447 Bacteria 2691
202 Ga0436361_0094373 3300039447 Bacteria 2063
203 Ga0436361_0154154 3300039447 Bacteria 9413
204 Ga0436361_0227906 3300039447 Bacteria 10423
205 Ga0436361_0643315 3300039447 Bacteria 1693
206 Ga0436361_1205456 3300039447 Bacteria 5770
207 Ga0436362_1169247 3300039453 Bacteria 1402
208 Ga0451795_0904518 3300041456 Bacteria 2369
209 Ga0439457_011435 3300042014 Bacteria 2020
210 Ga0439434_0018431 3300042435 Bacteria 2090
211 Ga0439464_0114808 3300042439 Bacteria 826
212 Ga0495617_000690 3300046452 Bacteria 16913
213 Ga0495617_031014 3300046452 Bacteria 1797
214 Ga0495617_032185 3300046452 Bacteria 1760
215 Ga0495617_075072 3300046452 Unclassified 1109
216 Ga0495590_0000099 3300046457 Bacteria 52654
217 Ga0495629_0271755 3300046459 Bacteria 1164
218 Ga0495638_0002915 3300046460 Bacteria 13661
219 Ga0495638_0036668 3300046460 Bacteria 3122
220 Ga0495638_0092794 3300046460 Bacteria 1817
221 Ga0495651_0278585 3300046462 Bacteria 1131
222 Ga0495653_0163818 3300046463 Bacteria 1541
223 Ga0495650_0020860 3300046471 Bacteria 3183
224 Ga0495650_0039481 3300046471 Unclassified 2037
225 Ga0495605_0000773 3300046474 Bacteria 23060
226 Ga0495605_0001362 3300046474 Bacteria 16133
227 Ga0495605_0003506 3300046474 Bacteria 9331
228 Ga0495605_0016693 3300046474 Bacteria 3970
229 Ga0495605_0020651 3300046474 Bacteria 3498
230 Ga0495639_0003138 3300046475 Bacteria 7177
231 Ga0495584_0000249 3300046491 Bacteria 38940
232 Ga0495584_0016146 3300046491 Bacteria 3807
233 Ga0495584_0017475 3300046491 Bacteria 3651
234 Ga0495585_0006348 3300046492 Bacteria 7342
235 Ga0495585_0162374 3300046492 Bacteria 1158
236 Ga0495596_0000960 3300046500 Bacteria 17193
237 Ga0495596_0005396 3300046500 Bacteria 6046
238 Ga0495596_0014998 3300046500 Bacteria 3256
239 Ga0495607_0019258 3300046501 Bacteria 4337
240 Ga0495607_0093686 3300046501 Unclassified 1621
241 Ga0495583_0000113 3300046506 Bacteria 136475
242 Ga0495583_0005245 3300046506 Bacteria 8888
243 Ga0495583_0010957 3300046506 Bacteria 5234
244 Ga0495583_0030461 3300046506 Bacteria 2626
245 Ga0495606_0008108 3300046507 Bacteria 9210
246 Ga0495606_0010438 3300046507 Bacteria 7710
247 Ga0495606_0069932 3300046507 Bacteria 2215
248 Ga0495606_0289959 3300046507 Bacteria 891
249 Ga0495606_0313585 3300046507 Bacteria 845
250 Ga0495610_0000246 3300046512 Bacteria 56850
251 Ga0495616_0000150 3300046513 Bacteria 60876
252 Ga0495616_0000761 3300046513 Bacteria 23546
253 Ga0495616_0001399 3300046513 Bacteria 16813
254 Ga0495616_0001429 3300046513 Bacteria 16631
255 Ga0495631_0000337 3300046518 Bacteria 32281
256 Ga0495631_0000494 3300046518 Bacteria 26281
257 Ga0495632_0000012 3300046519 Bacteria 264389
258 Ga0495632_0000034 3300046519 Bacteria 162850
259 Ga0495637_0003812 3300046520 Bacteria 7922
260 Ga0495644_0000027 3300046523 Bacteria 70142
261 Ga0495644_0000298 3300046523 Bacteria 22994
262 Ga0495644_0008318 3300046523 Bacteria 3997
263 Ga0495644_0016979 3300046523 Bacteria 2785
264 Ga0495648_0000403 3300046524 Bacteria 47579
265 Ga0495648_0003448 3300046524 Bacteria 13910
266 Ga0495648_0015172 3300046524 Bacteria 5609
267 Ga0495666_0004356 3300046526 Bacteria 7145
268 Ga0495642_0017446 3300046528 Unclassified 2804
269 Ga0495642_0075339 3300046528 Bacteria 1415
270 Ga0495654_0000624 3300046530 Bacteria 28093
271 Ga0495654_0002621 3300046530 Bacteria 11464
272 Ga0495640_0037243 3300046533 Bacteria 3432
273 Ga0495609_0000669 3300046538 Bacteria 26599
274 Ga0495609_0001335 3300046538 Bacteria 16726
275 Ga0495609_0027857 3300046538 Bacteria 2581
276 Ga0495597_0000718 3300046542 Bacteria 26559
277 Ga0495645_0231888 3300046543 Bacteria 1236
278 Ga0495633_0001110 3300046558 Bacteria 21652
279 Ga0495633_0002286 3300046558 Bacteria 13696
280 Ga0495633_0008133 3300046558 Bacteria 5946
281 Ga0495656_0080025 3300046615 Bacteria 1472
282 Ga0495668_0097066 3300046616 Bacteria 1612
283 Ga0495634_0020487 3300046642 Bacteria 4689
284 Ga0495611_0000287 3300046648 Bacteria 34415
285 Ga0495611_0004155 3300046648 Bacteria 6301
286 Ga0495611_0005520 3300046648 Bacteria 5403
287 Ga0495611_0009820 3300046648 Bacteria 4047
288 Ga0495625_0006190 3300046660 Bacteria 10719
289 Ga0495625_0165196 3300046660 Bacteria 1480
290 Ga0495635_0268923 3300046663 Bacteria 1147
291 Ga0495659_0000101 3300046664 Bacteria 37957
292 Ga0495661_0004301 3300046665 Bacteria 10331
293 Ga0495661_0010549 3300046665 Bacteria 6300
294 Ga0495661_0013826 3300046665 Bacteria 5415
295 Ga0495661_0026271 3300046665 Bacteria 3751
296 Ga0495661_0051323 3300046665 Bacteria 2491
297 Ga0495661_0087016 3300046665 Bacteria 1787
298 Ga0495661_0259004 3300046665 Bacteria 885
299 Ga0495657_0009964 3300046675 Bacteria 7170
300 Ga0495623_0002003 3300046679 Bacteria 13670
301 Ga0495670_0000515 3300046691 Bacteria 18226
302 Ga0495670_0000962 3300046691 Bacteria 13947
303 Ga0495670_0075412 3300046691 Unclassified 1712
304 Ga0495671_0010003 3300046692 Bacteria 5276
305 Ga0495671_0029943 3300046692 Bacteria 2791
306 Ga0495671_0089423 3300046692 Bacteria 1508
307 Ga0495671_0168262 3300046692 Bacteria 1066
308 Ga0495649_0010438 3300046694 Bacteria 5477
309 Ga0495649_0016834 3300046694 Bacteria 4139
310 Ga0495589_0028067 3300046794 Bacteria 2843
311 Ga0495589_0032611 3300046794 Bacteria 2618
312 Ga0495589_0038835 3300046794 Bacteria 2381
313 Ga0495660_0093740 3300046810 Bacteria 1556
314 Ga0495604_0000675 3300047317 Bacteria 28906
315 Ga0495604_0029509 3300047317 Bacteria 4363
316 Ga0495636_0017200 3300047318 Unclassified 2893
317 Ga0495636_0092135 3300047318 Bacteria 1316
318 Ga0495672_0000074 3300047320 Bacteria 179013
319 Ga0495672_0000109 3300047320 Bacteria 131335
320 Ga0495672_0000188 3300047320 Bacteria 89538
321 Ga0495672_0000823 3300047320 Bacteria 33235
322 Ga0495672_0001979 3300047320 Bacteria 19353
323 Ga0495676_0231338 3300047321 Bacteria 1269
324 Ga0495683_0011292 3300047323 Bacteria 4702
325 Ga0495683_0021836 3300047323 Bacteria 3297
326 Ga0495683_0025639 3300047323 Bacteria 3020
327 Ga0495683_0065972 3300047323 Bacteria 1784
328 Ga0495683_0080179 3300047323 Bacteria 1593
329 Ga0495687_000048 3300047443 Bacteria 205967
330 Ga0495687_000807 3300047443 Bacteria 33697
331 Ga0495687_038185 3300047443 Bacteria 2133
332 Ga0495687_103464 3300047443 Unclassified 1062
333 Ga0495675_0002282 3300047444 Bacteria 11455
334 Ga0495675_0071226 3300047444 Bacteria 2194
335 Ga0495677_0037432 3300047445 Bacteria 1772
336 Ga0495677_0049431 3300047445 Bacteria 1545
337 Ga0495677_0050425 3300047445 Bacteria 1531
338 Ga0495685_000112 3300047447 Bacteria 28941
339 Ga0495685_058575 3300047447 Bacteria 1300
340 Ga0495685_078334 3300047447 Bacteria 1102
341 Ga0495673_0006554 3300047469 Bacteria 6826
342 Ga0495673_0007527 3300047469 Bacteria 6240
343 Ga0495673_0074025 3300047469 Bacteria 1426
344 Ga0495681_0003061 3300047470 Bacteria 11731
345 Ga0495681_0012703 3300047470 Bacteria 4931
346 Ga0495686_0001173 3300047472 Bacteria 30578
347 Ga0495686_0098739 3300047472 Bacteria 1764
348 Ga0495602_0026057 3300048088 Bacteria 5647
349 Ga0495602_0097450 3300048088 Bacteria 2422
350 Ga0495614_0020889 3300048089 Bacteria 2829
351 Ga0495626_0006450 3300048091 Bacteria 6681
352 Ga0495626_0026013 3300048091 Bacteria 2856
353 Ga0495626_0056475 3300048091 Bacteria 1797
354 Ga0495626_0057512 3300048091 Bacteria 1779
355 Ga0495626_0085801 3300048091 Bacteria 1392
356 Ga0496101_0717279 3300048904 Unclassified 789
357 Ga0496102_0015332 3300048905 Bacteria 6674
358 Ga0496103_0246302 3300048906 Bacteria 1150
359 Ga0496105_0310879 3300048908 Bacteria 1265
360 Ga0496110_0000002 3300048913 Bacteria 166613
361 Ga0496110_0060851 3300048913 Bacteria 3332
362 Ga0496113_0265425 3300048916 Bacteria 1372
363 Ga0496114_0379287 3300048917 Bacteria 1252
364 Ga0496116_0028781 3300048919 Bacteria 4018
365 Ga0496116_0203562 3300048919 Bacteria 1033
366 Ga0496117_0012410 3300048920 Bacteria 7514
367 Ga0496118_0005967 3300048921 Bacteria 13588
368 Ga0496118_0197554 3300048921 Bacteria 1195
369 Ga0496119_0025527 3300048922 Bacteria 4123
370 Ga0496121_0000249 3300048924 Bacteria 114260
371 Ga0496121_0021301 3300048924 Bacteria 6357
372 Ga0496121_0299154 3300048924 Bacteria 1093
373 Ga0496122_0211905 3300048925 Unclassified 1121
374 Ga0496123_0133828 3300048926 Bacteria 1368
375 Ga0496123_0142322 3300048926 Bacteria 1309
376 Ga0496124_0124022 3300048927 Bacteria 2060
377 Ga0496124_0245906 3300048927 Bacteria 1327
378 Ga0496125_0003865 3300048928 Bacteria 17724
379 Ga0496125_0115040 3300048928 Bacteria 1936
380 Ga0496126_0026549 3300048929 Bacteria 5550
381 Ga0496126_0046447 3300048929 Bacteria 3983
382 Ga0495678_000060 3300049459 Bacteria 142851
383 Ga0495678_001908 3300049459 Bacteria 15146
384 Ga0495678_012143 3300049459 Bacteria 4091
385 Ga0495682_0000035 3300049460 Bacteria 126349
386 Ga0495682_0000522 3300049460 Bacteria 26585
387 Ga0495682_0000532 3300049460 Bacteria 26301
388 Ga0501299_025031 3300049522 Bacteria 1118
389 Ga0501043_0169944 3300049579 Bacteria 1701
390 Ga0501209_018245 3300049656 Bacteria 1618
391 nmdc:mga03683_3568_c1 3300050489 Bacteria 5042
392 nmdc:mga0k408_63832_c1 3300050493 Bacteria 2143
393 nmdc:mga0k408_776_c1 3300050493 Bacteria 17549
394 nmdc:mga0k408_789_c1 3300050493 Bacteria 17446
395 nmdc:mga06z11_30837_c1 3300050494 Bacteria 2599
396 nmdc:mga04h51_194459_c1 3300050495 Bacteria 795
397 nmdc:mga07m45_1296_c1 3300050496 Bacteria 11381
398 nmdc:mga07m45_439_c1 3300050496 Bacteria 17310
399 Ga0500610_0000212 3300053079 Bacteria 17831
400 Ga0500651_0057570 3300053093 Bacteria 2432
401 Ga0500562_026784 3300053108 Bacteria 1512
402 Ga0500568_0000168 3300053139 Bacteria 56752
403 Ga0500616_0003434 3300053153 Bacteria 12100
404 Ga0500622_0042046 3300053156 Bacteria 2376
405 Ga0500645_010042 3300053730 Bacteria 3153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100194358 Ga0068867_1001943582 206
2 3300026089 Ga0207648_10062728 Ga0207648_100627283 206
3 3300005618 Ga0068864_100210054 Ga0068864_1002100542 224
4 3300025938 Ga0207704_10471166 Ga0207704_104711661 224
5 3300025940 Ga0207691_10083142 Ga0207691_100831421 224
6 3300025986 Ga0207658_10499112 Ga0207658_104991122 224
7 3300026088 Ga0207641_10156882 Ga0207641_101568823 224
8 3300028379 Ga0268266_10205862 Ga0268266_102058622 224
9 iso_pu_bacteria 8003314358 8003316618 226
10 3300026095 Ga0207676_10158944 Ga0207676_101589442 227
11 3300046507 Ga0495606_0313585 Ga0495606_0313585_136_828 227
12 iso_pu_bacteria 2831864461 2831867870 227
13 iso_pu_bacteria 2515154189 2516023258 228
14 3300053079 Ga0500610_0000212 Ga0500610_0000212_10757_11452 229
15 iso_pu_bacteria 2765235802 2765469329 229
16 3300025929 Ga0207664_10692097 Ga0207664_106920971 230
17 3300046530 Ga0495654_0002621 Ga0495654_0002621_10040_10738 230
18 iso_pu_bacteria 2511231018 2511340083 230
19 iso_pu_bacteria 2511231027 2511390942 230
20 iso_pu_bacteria 2512047030 2512349531 230
21 iso_pu_bacteria 2513237082 2513553663 230
22 iso_pu_bacteria 2513237083 2513560340 230
23 iso_pu_bacteria 2513237084 2513569473 230
24 iso_pu_bacteria 2513237143 2513904760 230
25 iso_pu_bacteria 2513237144 2513914328 230
26 iso_pu_bacteria 2515154122 2515684067 230
27 iso_pu_bacteria 2516653046 2516898237 230
28 iso_pu_bacteria 2599185239 2599736189 230
29 iso_pu_bacteria 2599185240 2599746082 230
30 iso_pu_bacteria 2599185355 2600208084 230
31 iso_pu_bacteria 2643221654 2644302520 230
32 iso_pu_bacteria 2675903129 2676743673 230
33 iso_pu_bacteria 2738541296 2738821153 230
34 iso_pu_bacteria 2738541298 2738833635 230
35 iso_pu_bacteria 2738541306 2738877042 230
36 iso_pu_bacteria 2738543002 2739186791 230
37 iso_pu_bacteria 2738543008 2739223635 230
38 iso_pu_bacteria 2744054900 2746089975 230
39 iso_pu_bacteria 2744054900 2746091021 230
40 iso_pu_bacteria 2744054901 2746095497 230
41 iso_pu_bacteria 2751185846 2753569707 230
42 iso_pu_bacteria 2802428859 2802723970 230
43 iso_pu_bacteria 2808606382 2808958144 230
44 iso_pu_bacteria 2818991449 2819616759 230
45 iso_pu_bacteria 2818991452 2819634030 230
46 iso_pu_bacteria 2821131069 2821131655 230
47 iso_pu_bacteria 2842871566 2842874334 230
48 iso_pu_bacteria 2863421361 2863423836 230
49 iso_pu_bacteria 2870068957 2870073867 230
50 iso_pu_bacteria 2885270888 2885272627 230
51 iso_pu_bacteria 2902682994 2902688432 230
52 iso_pu_bacteria 2904424332 2904428600 230
53 iso_pu_bacteria 2904483920 2904486967 230
54 iso_pu_bacteria 2904564687 2904568419 230
55 iso_pu_bacteria 2904571731 2904575462 230
56 iso_pu_bacteria 2913844669 2913851810 230
57 iso_pu_bacteria 2916000859 2916003551 230
58 iso_pu_bacteria 2916021584 2916023679 230
59 iso_pu_bacteria 2919046199 2919049845 230
60 iso_pu_bacteria 2919527303 2919528282 230
61 iso_pu_bacteria 2924179722 2924182485 230
62 iso_pu_bacteria 2928157003 2928160801 230
63 iso_pu_bacteria 2928163908 2928169711 230
64 iso_pu_bacteria 2928170801 2928171375 230
65 iso_pu_bacteria 2928536128 2928536284 230
66 iso_pu_bacteria 2937009748 2937016275 230
67 iso_pu_bacteria 2941479691 2941481313 230
68 iso_pu_bacteria 2945934425 2945939448 230
69 iso_pu_bacteria 2964636051 2964638544 230
70 iso_pu_bacteria 2970026789 2970032411 230
71 iso_pu_bacteria 2970095765 2970096848 230
72 iso_pu_bacteria 2977565890 2977572506 230
73 iso_pu_bacteria 2981990288 2981991566 230
74 iso_pu_bacteria 2990703756 2990706790 230
75 iso_pu_bacteria 641736151 642424711 230
76 iso_pu_bacteria 641736154 642415309 230
77 iso_pu_bacteria 8003955200 8003957964 230
78 iso_pu_bacteria 8018845410 8018853754 230
79 iso_pu_bacteria 8020938398 8020938573 230
80 iso_pu_bacteria 8020945358 8020946331 230
81 iso_pu_bacteria 8020953355 8020954871 230
82 iso_pu_bacteria 8021120328 8021123536 230
83 iso_pu_bacteria 8055301274 8055306841 230
84 3300003323 rootH1_10043278 rootH1_100432783 231
85 3300003775 Ga0055524_1007759 Ga0055524_10077594 231
86 3300003792 Ga0055540_1021420 Ga0055540_10214202 231
87 3300006944 Ga0099823_1000110 Ga0099823_100011028 231
88 3300025242 Ga0209258_106349 Ga0209258_1063492 231
89 3300025273 Ga0209673_1002458 Ga0209673_100245812 231
90 3300025298 Ga0209050_1007212 Ga0209050_10072123 231
91 3300025299 Ga0209256_1006328 Ga0209256_10063286 231
92 3300025303 Ga0209051_1002346 Ga0209051_10023464 231
93 3300025304 Ga0209257_1003042 Ga0209257_100304212 231
94 3300027296 Ga0209389_1000627 Ga0209389_100062711 231
95 3300035114 Ga0373939_0138793 Ga0373939_0138793_33_734 231
96 3300046523 Ga0495644_0000027 Ga0495644_0000027_42356_43057 231
97 3300046665 Ga0495661_0010549 Ga0495661_0010549_4193_4894 231
98 3300005353 Ga0070669_100246984 Ga0070669_1002469842 232
99 3300005354 Ga0070675_100553031 Ga0070675_1005530311 232
100 3300005364 Ga0070673_100356303 Ga0070673_1003563032 232
101 3300005367 Ga0070667_100001066 Ga0070667_10000106619 232
102 3300005983 Ga0081540_1148184 Ga0081540_11481841 232
103 3300025256 Ga0209759_1012016 Ga0209759_10120162 232
104 3300025923 Ga0207681_10220178 Ga0207681_102201782 232
105 3300025949 Ga0207667_10338417 Ga0207667_103384172 232
106 3300025960 Ga0207651_10124477 Ga0207651_101244772 232
107 3300025972 Ga0207668_10624258 Ga0207668_106242581 232
108 3300026142 Ga0207698_10331836 Ga0207698_103318362 232
109 3300031251 Ga0265327_10080048 Ga0265327_100800481 232
110 3300031456 Ga0307513_10000924 Ga0307513_1000092416 232
111 3300031731 Ga0307405_10033930 Ga0307405_100339304 232
112 3300032005 Ga0307411_10184705 Ga0307411_101847052 232
113 3300037068 Ga0373925_0016649 Ga0373925_0016649_970_1677 232
114 3300037471 Ga0395905_0792436 Ga0395905_0792436_106_810 232
115 3300042014 Ga0439457_011435 Ga0439457_011435_870_1574 232
116 3300042435 Ga0439434_0018431 Ga0439434_0018431_788_1492 232
117 3300042439 Ga0439464_0114808 Ga0439464_0114808_16_720 232
118 3300046462 Ga0495651_0278585 Ga0495651_0278585_145_849 232
119 3300046475 Ga0495639_0003138 Ga0495639_0003138_285_989 232
120 3300046528 Ga0495642_0075339 Ga0495642_0075339_82_786 232
121 3300046543 Ga0495645_0231888 Ga0495645_0231888_357_1061 232
122 3300046663 Ga0495635_0268923 Ga0495635_0268923_391_1095 232
123 3300048913 Ga0496110_0060851 Ga0496110_0060851_543_1247 232
124 3300048917 Ga0496114_0379287 Ga0496114_0379287_136_840 232
125 3300053093 Ga0500651_0057570 Ga0500651_0057570_1280_1984 232
126 3300005467 Ga0070706_100116769 Ga0070706_1001167694 233
127 3300005468 Ga0070707_100726420 Ga0070707_1007264201 233
128 3300006042 Ga0075368_10020763 Ga0075368_100207632 233
129 3300006048 Ga0075363_100058433 Ga0075363_1000584332 233
130 3300006051 Ga0075364_10150245 Ga0075364_101502452 233
131 3300006177 Ga0075362_10001812 Ga0075362_100018124 233
132 3300006178 Ga0075367_10020075 Ga0075367_100200752 233
133 3300006195 Ga0075366_10000725 Ga0075366_100007253 233
134 3300006353 Ga0075370_10003649 Ga0075370_100036498 233
135 3300006353 Ga0075370_10036917 Ga0075370_100369171 233
136 3300006931 Ga0097620_100275320 Ga0097620_1002753202 233
137 3300009177 Ga0105248_10835086 Ga0105248_108350862 233
138 3300026116 Ga0207674_10011486 Ga0207674_100114862 233
139 3300026116 Ga0207674_10205995 Ga0207674_102059953 233
140 3300027866 Ga0209813_10017818 Ga0209813_100178182 233
141 3300028794 Ga0307515_10026432 Ga0307515_1002643210 233
142 3300028800 Ga0265338_10002191 Ga0265338_1000219124 233
143 3300031616 Ga0307508_10075541 Ga0307508_100755413 233
144 3300031730 Ga0307516_10017051 Ga0307516_100170514 233
145 3300041456 Ga0451795_0904518 Ga0451795_0904518_710_1426 233
146 3300046452 Ga0495617_000690 Ga0495617_000690_11373_12080 233
147 3300046452 Ga0495617_032185 Ga0495617_032185_971_1678 233
148 3300046452 Ga0495617_075072 Ga0495617_075072_71_778 233
149 3300046460 Ga0495638_0036668 Ga0495638_0036668_379_1086 233
150 3300046474 Ga0495605_0000773 Ga0495605_0000773_22073_22780 233
151 3300046491 Ga0495584_0000249 Ga0495584_0000249_17535_18242 233
152 3300046491 Ga0495584_0016146 Ga0495584_0016146_1286_1993 233
153 3300046492 Ga0495585_0006348 Ga0495585_0006348_1091_1798 233
154 3300046492 Ga0495585_0162374 Ga0495585_0162374_32_739 233
155 3300046501 Ga0495607_0019258 Ga0495607_0019258_2443_3150 233
156 3300046501 Ga0495607_0093686 Ga0495607_0093686_572_1279 233
157 3300046506 Ga0495583_0000113 Ga0495583_0000113_4508_5215 233
158 3300046506 Ga0495583_0005245 Ga0495583_0005245_7064_7771 233
159 3300046506 Ga0495583_0010957 Ga0495583_0010957_1755_2462 233
160 3300046513 Ga0495616_0000761 Ga0495616_0000761_19527_20234 233
161 3300046523 Ga0495644_0000298 Ga0495644_0000298_159_866 233
162 3300046523 Ga0495644_0016979 Ga0495644_0016979_527_1234 233
163 3300046524 Ga0495648_0000403 Ga0495648_0000403_23611_24318 233
164 3300046538 Ga0495609_0001335 Ga0495609_0001335_4635_5342 233
165 3300046538 Ga0495609_0027857 Ga0495609_0027857_1385_2092 233
166 3300046558 Ga0495633_0001110 Ga0495633_0001110_5191_5898 233
167 3300046558 Ga0495633_0008133 Ga0495633_0008133_3244_3951 233
168 3300046615 Ga0495656_0080025 Ga0495656_0080025_510_1217 233
169 3300046648 Ga0495611_0000287 Ga0495611_0000287_33407_34114 233
170 3300046648 Ga0495611_0004155 Ga0495611_0004155_36_743 233
171 3300046648 Ga0495611_0009820 Ga0495611_0009820_80_787 233
172 3300046660 Ga0495625_0006190 Ga0495625_0006190_1578_2285 233
173 3300046660 Ga0495625_0165196 Ga0495625_0165196_529_1236 233
174 3300046664 Ga0495659_0000101 Ga0495659_0000101_28467_29174 233
175 3300046665 Ga0495661_0013826 Ga0495661_0013826_4105_4812 233
176 3300046665 Ga0495661_0087016 Ga0495661_0087016_752_1459 233
177 3300046691 Ga0495670_0000515 Ga0495670_0000515_14207_14914 233
178 3300046691 Ga0495670_0000962 Ga0495670_0000962_4457_5164 233
179 3300047318 Ga0495636_0017200 Ga0495636_0017200_1170_1877 233
180 3300047318 Ga0495636_0092135 Ga0495636_0092135_153_860 233
181 3300047320 Ga0495672_0001979 Ga0495672_0001979_7442_8149 233
182 3300047323 Ga0495683_0011292 Ga0495683_0011292_143_850 233
183 3300047443 Ga0495687_000807 Ga0495687_000807_8784_9491 233
184 3300047443 Ga0495687_103464 Ga0495687_103464_113_820 233
185 3300047445 Ga0495677_0049431 Ga0495677_0049431_332_1039 233
186 3300047445 Ga0495677_0050425 Ga0495677_0050425_85_792 233
187 3300047447 Ga0495685_000112 Ga0495685_000112_3160_3867 233
188 3300047447 Ga0495685_058575 Ga0495685_058575_355_1062 233
189 3300047469 Ga0495673_0007527 Ga0495673_0007527_4541_5248 233
190 3300047472 Ga0495686_0001173 Ga0495686_0001173_28975_29682 233
191 3300047472 Ga0495686_0098739 Ga0495686_0098739_429_1136 233
192 3300048906 Ga0496103_0246302 Ga0496103_0246302_207_914 233
193 3300048925 Ga0496122_0211905 Ga0496122_0211905_55_762 233
194 3300048927 Ga0496124_0245906 Ga0496124_0245906_581_1288 233
195 3300048928 Ga0496125_0115040 Ga0496125_0115040_1114_1821 233
196 3300048929 Ga0496126_0026549 Ga0496126_0026549_1693_2403 233
197 3300049459 Ga0495678_001908 Ga0495678_001908_2274_2981 233
198 3300049460 Ga0495682_0000522 Ga0495682_0000522_15062_15769 233
199 3300049460 Ga0495682_0000532 Ga0495682_0000532_8783_9490 233
200 3300049579 Ga0501043_0169944 Ga0501043_0169944_888_1592 233
201 3300050489 nmdc:mga03683_3568_c1 nmdc:mga03683_3568_c1_1022_1738 233
202 3300050493 nmdc:mga0k408_776_c1 nmdc:mga0k408_776_c1_8233_8949 233
203 3300050493 nmdc:mga0k408_789_c1 nmdc:mga0k408_789_c1_13140_13856 233
204 3300050494 nmdc:mga06z11_30837_c1 nmdc:mga06z11_30837_c1_926_1642 233
205 3300050495 nmdc:mga04h51_194459_c1 nmdc:mga04h51_194459_c1_54_770 233
206 3300050496 nmdc:mga07m45_1296_c1 nmdc:mga07m45_1296_c1_3036_3752 233
207 3300050496 nmdc:mga07m45_439_c1 nmdc:mga07m45_439_c1_7273_7989 233
208 3300001979 JGI24740J21852_10018115 JGI24740J21852_100181153 234
209 3300001989 JGI24739J22299_10000469 JGI24739J22299_100004698 234
210 3300002067 JGI24735J21928_10003603 JGI24735J21928_100036036 234
211 3300002705 JGI25156J39149_1001230 JGI25156J39149_10012306 234
212 3300002737 JGI25162J39368_1000053 JGI25162J39368_100005385 234
213 3300002771 JGI25163J39215_1001679 JGI25163J39215_10016794 234
214 3300002772 JGI25164J39214_1000042 JGI25164J39214_100004263 234
215 3300002772 JGI25164J39214_1000080 JGI25164J39214_100008084 234
216 3300002772 JGI25164J39214_1000081 JGI25164J39214_100008170 234
217 3300003214 JGI25165J46597_1000060 JGI25165J46597_100006085 234
218 3300003214 JGI25165J46597_1000606 JGI25165J46597_100060627 234
219 3300003323 rootH1_10119473 rootH1_101194733 234
220 3300003751 Ga0055538_1000413 Ga0055538_100041316 234
221 3300003752 Ga0055539_1000404 Ga0055539_100040416 234
222 3300003756 Ga0055533_1000140 Ga0055533_100014059 234
223 3300003756 Ga0055533_1000411 Ga0055533_100041116 234
224 3300003758 Ga0055532_1000003 Ga0055532_1000003289 234
225 3300003758 Ga0055532_1000531 Ga0055532_10005312 234
226 3300003758 Ga0055532_1000579 Ga0055532_10005791 234
227 3300003759 Ga0055525_1000564 Ga0055525_100056416 234
228 3300003760 Ga0055527_1000006 Ga0055527_1000006167 234
229 3300003760 Ga0055527_1003187 Ga0055527_10031873 234
230 3300003761 Ga0055535_1000003 Ga0055535_1000003289 234
231 3300003761 Ga0055535_1000841 Ga0055535_10008412 234
232 3300003762 Ga0055542_1000007 Ga0055542_1000007289 234
233 3300003762 Ga0055542_1000858 Ga0055542_100085823 234
234 3300003763 Ga0055529_1000003 Ga0055529_1000003167 234
235 3300003763 Ga0055529_1000317 Ga0055529_100031715 234
236 3300003790 Ga0055528_1001316 Ga0055528_100131612 234
237 3300003841 Ga0055541_1000296 Ga0055541_100029616 234
238 3300005327 Ga0070658_10019818 Ga0070658_100198186 234
239 3300005331 Ga0070670_100460620 Ga0070670_1004606202 234
240 3300005336 Ga0070680_100071372 Ga0070680_1000713721 234
241 3300005339 Ga0070660_100000011 Ga0070660_10000001112 234
242 3300005347 Ga0070668_100069584 Ga0070668_1000695842 234
243 3300005347 Ga0070668_100161683 Ga0070668_1001616832 234
244 3300005356 Ga0070674_100013294 Ga0070674_1000132942 234
245 3300005366 Ga0070659_100001681 Ga0070659_1000016817 234
246 3300005367 Ga0070667_100531308 Ga0070667_1005313082 234
247 3300005455 Ga0070663_100000269 Ga0070663_1000002693 234
248 3300005530 Ga0070679_100073402 Ga0070679_1000734024 234
249 3300005543 Ga0070672_100410602 Ga0070672_1004106021 234
250 3300005563 Ga0068855_100102204 Ga0068855_1001022043 234
251 3300005563 Ga0068855_100384444 Ga0068855_1003844442 234
252 3300005616 Ga0068852_100011830 Ga0068852_1000118304 234
253 3300005842 Ga0068858_100533280 Ga0068858_1005332801 234
254 3300005842 Ga0068858_100854317 Ga0068858_1008543172 234
255 3300005843 Ga0068860_100471935 Ga0068860_1004719352 234
256 3300006195 Ga0075366_10038773 Ga0075366_100387732 234
257 3300006881 Ga0068865_100627231 Ga0068865_1006272312 234
258 3300006946 Ga0079104_1002933 Ga0079104_10029339 234
259 3300009093 Ga0105240_10004799 Ga0105240_100047993 234
260 3300009098 Ga0105245_10000029 Ga0105245_1000002989 234
261 3300009177 Ga0105248_10003881 Ga0105248_100038816 234
262 3300009177 Ga0105248_10298163 Ga0105248_102981632 234
263 3300009545 Ga0105237_10161090 Ga0105237_101610902 234
264 3300009545 Ga0105237_10413728 Ga0105237_104137282 234
265 3300010375 Ga0105239_10088700 Ga0105239_100887003 234
266 3300011119 Ga0105246_10020348 Ga0105246_100203482 234
267 3300013104 Ga0157370_10017234 Ga0157370_100172347 234
268 3300013104 Ga0157370_10178875 Ga0157370_101788752 234
269 3300013105 Ga0157369_10012587 Ga0157369_100125872 234
270 3300013105 Ga0157369_10454845 Ga0157369_104548452 234
271 3300013296 Ga0157374_10098944 Ga0157374_100989443 234
272 3300013306 Ga0163162_10053273 Ga0163162_100532733 234
273 3300013306 Ga0163162_10163335 Ga0163162_101633352 234
274 3300013307 Ga0157372_10716156 Ga0157372_107161561 234
275 3300013308 Ga0157375_10001163 Ga0157375_1000116316 234
276 3300013308 Ga0157375_10033794 Ga0157375_100337944 234
277 3300013308 Ga0157375_10222762 Ga0157375_102227622 234
278 3300014497 Ga0182008_10089803 Ga0182008_100898032 234
279 3300014969 Ga0157376_10096934 Ga0157376_100969342 234
280 3300014969 Ga0157376_10227843 Ga0157376_102278432 234
281 3300015261 Ga0182006_1004056 Ga0182006_10040562 234
282 3300015262 Ga0182007_10097768 Ga0182007_100977682 234
283 3300015262 Ga0182007_10134155 Ga0182007_101341551 234
284 3300015265 Ga0182005_1005810 Ga0182005_10058103 234
285 3300015265 Ga0182005_1021300 Ga0182005_10213002 234
286 3300015265 Ga0182005_1024681 Ga0182005_10246812 234
287 3300017792 Ga0163161_10009950 Ga0163161_100099504 234
288 3300021361 Ga0213872_10008575 Ga0213872_100085751 234
289 3300021361 Ga0213872_10075104 Ga0213872_100751042 234
290 3300021361 Ga0213872_10124578 Ga0213872_101245782 234
291 3300025207 Ga0209760_100013 Ga0209760_10001363 234
292 3300025224 Ga0209784_100005 Ga0209784_100005403 234
293 3300025225 Ga0209566_100005 Ga0209566_100005403 234
294 3300025225 Ga0209566_100250 Ga0209566_10025054 234
295 3300025226 Ga0209674_100009 Ga0209674_100009403 234
296 3300025226 Ga0209674_100025 Ga0209674_100025290 234
297 3300025226 Ga0209674_101547 Ga0209674_1015474 234
298 3300025228 Ga0209672_100002 Ga0209672_1000021183 234
299 3300025228 Ga0209672_100057 Ga0209672_10005741 234
300 3300025229 Ga0209147_100003 Ga0209147_1000031183 234
301 3300025229 Ga0209147_100047 Ga0209147_100047166 234
302 3300025229 Ga0209147_100121 Ga0209147_10012138 234
303 3300025230 Ga0209563_100012 Ga0209563_100012403 234
304 3300025230 Ga0209563_100206 Ga0209563_10020618 234
305 3300025231 Ga0207427_100011 Ga0207427_100011452 234
306 3300025231 Ga0207427_100471 Ga0207427_10047112 234
307 3300025233 Ga0209437_100025 Ga0209437_100025118 234
308 3300025242 Ga0209258_100005 Ga0209258_100005825 234
309 3300025242 Ga0209258_100065 Ga0209258_100065114 234
310 3300025253 Ga0209677_100006 Ga0209677_100006403 234
311 3300025254 Ga0209148_1000006 Ga0209148_10000061183 234
312 3300025254 Ga0209148_1000091 Ga0209148_100009191 234
313 3300025256 Ga0209759_1000014 Ga0209759_1000014163 234
314 3300025261 Ga0209233_1000012 Ga0209233_1000012637 234
315 3300025261 Ga0209233_1000018 Ga0209233_1000018163 234
316 3300025272 Ga0209455_1000003 Ga0209455_10000031183 234
317 3300025272 Ga0209455_1000074 Ga0209455_1000074166 234
318 3300025273 Ga0209673_1000437 Ga0209673_100043735 234
319 3300025295 Ga0209564_1022836 Ga0209564_10228362 234
320 3300025315 Ga0207697_10007309 Ga0207697_100073092 234
321 3300025728 Ga0207655_1061434 Ga0207655_10614342 234
322 3300025904 Ga0207647_10004603 Ga0207647_1000460312 234
323 3300025907 Ga0207645_10028636 Ga0207645_100286361 234
324 3300025913 Ga0207695_10000547 Ga0207695_1000054777 234
325 3300025913 Ga0207695_10029812 Ga0207695_100298126 234
326 3300025914 Ga0207671_10008585 Ga0207671_100085852 234
327 3300025917 Ga0207660_10069047 Ga0207660_100690472 234
328 3300025919 Ga0207657_10000019 Ga0207657_1000001912 234
329 3300025920 Ga0207649_10129764 Ga0207649_101297642 234
330 3300025923 Ga0207681_10555811 Ga0207681_105558111 234
331 3300025926 Ga0207659_10118732 Ga0207659_101187322 234
332 3300025927 Ga0207687_10000190 Ga0207687_100001909 234
333 3300025932 Ga0207690_10000028 Ga0207690_1000002812 234
334 3300025937 Ga0207669_10049661 Ga0207669_100496612 234
335 3300025940 Ga0207691_10012081 Ga0207691_100120812 234
336 3300025941 Ga0207711_10010674 Ga0207711_100106748 234
337 3300025941 Ga0207711_10096865 Ga0207711_100968652 234
338 3300025949 Ga0207667_10171423 Ga0207667_101714232 234
339 3300026035 Ga0207703_10383612 Ga0207703_103836122 234
340 3300026067 Ga0207678_10000326 Ga0207678_1000032612 234
341 3300026078 Ga0207702_10064803 Ga0207702_100648033 234
342 3300026078 Ga0207702_10278794 Ga0207702_102787942 234
343 3300026095 Ga0207676_10416783 Ga0207676_104167832 234
344 3300026116 Ga0207674_10152331 Ga0207674_101523312 234
345 3300026142 Ga0207698_10005421 Ga0207698_100054214 234
346 3300027111 Ga0209281_1002159 Ga0209281_10021598 234
347 3300027312 Ga0209371_1000180 Ga0209371_100018057 234
348 3300030500 Ga0268256_1000308 Ga0268256_100030835 234
349 3300031911 Ga0307412_10000059 Ga0307412_10000059128 234
350 3300039447 Ga0436361_0032762 Ga0436361_0032762_821_1525 234
351 3300039447 Ga0436361_0094373 Ga0436361_0094373_487_1200 234
352 3300039447 Ga0436361_0154154 Ga0436361_0154154_6217_6921 234
353 3300039447 Ga0436361_0227906 Ga0436361_0227906_6198_6917 234
354 3300039447 Ga0436361_0643315 Ga0436361_0643315_370_1074 234
355 3300039447 Ga0436361_1205456 Ga0436361_1205456_1776_2489 234
356 3300039453 Ga0436362_1169247 Ga0436362_1169247_530_1243 234
357 3300046452 Ga0495617_031014 Ga0495617_031014_15_728 234
358 3300046457 Ga0495590_0000099 Ga0495590_0000099_39113_39886 234
359 3300046457 Ga0495590_0000099 Ga0495590_0000099_40828_41541 234
360 3300046459 Ga0495629_0271755 Ga0495629_0271755_216_920 234
361 3300046460 Ga0495638_0002915 Ga0495638_0002915_2991_3704 234
362 3300046460 Ga0495638_0092794 Ga0495638_0092794_153_866 234
363 3300046463 Ga0495653_0163818 Ga0495653_0163818_491_1195 234
364 3300046471 Ga0495650_0020860 Ga0495650_0020860_448_1236 234
365 3300046471 Ga0495650_0039481 Ga0495650_0039481_371_1084 234
366 3300046474 Ga0495605_0001362 Ga0495605_0001362_14574_15287 234
367 3300046474 Ga0495605_0003506 Ga0495605_0003506_5234_5947 234
368 3300046474 Ga0495605_0016693 Ga0495605_0016693_103_816 234
369 3300046474 Ga0495605_0020651 Ga0495605_0020651_1317_2021 234
370 3300046491 Ga0495584_0017475 Ga0495584_0017475_2649_3362 234
371 3300046500 Ga0495596_0000960 Ga0495596_0000960_259_1038 234
372 3300046500 Ga0495596_0005396 Ga0495596_0005396_5024_5803 234
373 3300046500 Ga0495596_0014998 Ga0495596_0014998_345_1049 234
374 3300046506 Ga0495583_0030461 Ga0495583_0030461_454_1167 234
375 3300046507 Ga0495606_0008108 Ga0495606_0008108_741_1445 234
376 3300046507 Ga0495606_0010438 Ga0495606_0010438_3499_4212 234
377 3300046507 Ga0495606_0069932 Ga0495606_0069932_278_991 234
378 3300046507 Ga0495606_0289959 Ga0495606_0289959_91_804 234
379 3300046512 Ga0495610_0000246 Ga0495610_0000246_18462_19166 234
380 3300046513 Ga0495616_0000150 Ga0495616_0000150_24180_24893 234
381 3300046513 Ga0495616_0000150 Ga0495616_0000150_25871_26584 234
382 3300046513 Ga0495616_0001399 Ga0495616_0001399_12311_13024 234
383 3300046513 Ga0495616_0001429 Ga0495616_0001429_12013_12726 234
384 3300046518 Ga0495631_0000337 Ga0495631_0000337_28302_29015 234
385 3300046518 Ga0495631_0000337 Ga0495631_0000337_29993_30706 234
386 3300046518 Ga0495631_0000494 Ga0495631_0000494_3775_4488 234
387 3300046519 Ga0495632_0000012 Ga0495632_0000012_164209_164922 234
388 3300046519 Ga0495632_0000034 Ga0495632_0000034_113080_113838 234
389 3300046520 Ga0495637_0003812 Ga0495637_0003812_3608_4321 234
390 3300046523 Ga0495644_0008318 Ga0495644_0008318_2169_2882 234
391 3300046523 Ga0495644_0008318 Ga0495644_0008318_478_1191 234
392 3300046524 Ga0495648_0003448 Ga0495648_0003448_5925_6704 234
393 3300046524 Ga0495648_0015172 Ga0495648_0015172_2555_3268 234
394 3300046526 Ga0495666_0004356 Ga0495666_0004356_5530_6234 234
395 3300046528 Ga0495642_0017446 Ga0495642_0017446_354_1067 234
396 3300046530 Ga0495654_0000624 Ga0495654_0000624_23482_24195 234
397 3300046533 Ga0495640_0037243 Ga0495640_0037243_355_1059 234
398 3300046538 Ga0495609_0000669 Ga0495609_0000669_16453_17232 234
399 3300046542 Ga0495597_0000718 Ga0495597_0000718_21927_22640 234
400 3300046558 Ga0495633_0002286 Ga0495633_0002286_10204_10917 234
401 3300046616 Ga0495668_0097066 Ga0495668_0097066_479_1192 234
402 3300046642 Ga0495634_0020487 Ga0495634_0020487_367_1071 234
403 3300046648 Ga0495611_0005520 Ga0495611_0005520_2034_2747 234
404 3300046648 Ga0495611_0005520 Ga0495611_0005520_3725_4438 234
405 3300046665 Ga0495661_0004301 Ga0495661_0004301_4284_4997 234
406 3300046665 Ga0495661_0026271 Ga0495661_0026271_887_1645 234
407 3300046665 Ga0495661_0051323 Ga0495661_0051323_863_1576 234
408 3300046665 Ga0495661_0259004 Ga0495661_0259004_136_849 234
409 3300046675 Ga0495657_0009964 Ga0495657_0009964_3054_3758 234
410 3300046679 Ga0495623_0002003 Ga0495623_0002003_6011_6730 234
411 3300046691 Ga0495670_0075412 Ga0495670_0075412_615_1328 234
412 3300046692 Ga0495671_0010003 Ga0495671_0010003_1816_2529 234
413 3300046692 Ga0495671_0029943 Ga0495671_0029943_1324_2037 234
414 3300046692 Ga0495671_0089423 Ga0495671_0089423_416_1129 234
415 3300046692 Ga0495671_0168262 Ga0495671_0168262_255_968 234
416 3300046694 Ga0495649_0010438 Ga0495649_0010438_4477_5181 234
417 3300046694 Ga0495649_0016834 Ga0495649_0016834_1757_2470 234
418 3300046794 Ga0495589_0028067 Ga0495589_0028067_177_890 234
419 3300046794 Ga0495589_0032611 Ga0495589_0032611_250_963 234
420 3300046794 Ga0495589_0038835 Ga0495589_0038835_731_1444 234
421 3300046810 Ga0495660_0093740 Ga0495660_0093740_722_1435 234
422 3300047317 Ga0495604_0000675 Ga0495604_0000675_26170_26874 234
423 3300047317 Ga0495604_0029509 Ga0495604_0029509_615_1319 234
424 3300047320 Ga0495672_0000074 Ga0495672_0000074_55337_56050 234
425 3300047320 Ga0495672_0000109 Ga0495672_0000109_108058_108873 234
426 3300047320 Ga0495672_0000188 Ga0495672_0000188_16456_17235 234
427 3300047320 Ga0495672_0000823 Ga0495672_0000823_24884_25597 234
428 3300047321 Ga0495676_0231338 Ga0495676_0231338_75_779 234
429 3300047323 Ga0495683_0021836 Ga0495683_0021836_345_1049 234
430 3300047323 Ga0495683_0025639 Ga0495683_0025639_2016_2729 234
431 3300047323 Ga0495683_0025639 Ga0495683_0025639_325_1038 234
432 3300047323 Ga0495683_0065972 Ga0495683_0065972_335_1039 234
433 3300047323 Ga0495683_0080179 Ga0495683_0080179_841_1554 234
434 3300047443 Ga0495687_000048 Ga0495687_000048_109148_109861 234
435 3300047443 Ga0495687_038185 Ga0495687_038185_1354_2058 234
436 3300047444 Ga0495675_0002282 Ga0495675_0002282_5952_6656 234
437 3300047444 Ga0495675_0071226 Ga0495675_0071226_1300_2004 234
438 3300047445 Ga0495677_0037432 Ga0495677_0037432_423_1136 234
439 3300047447 Ga0495685_078334 Ga0495685_078334_350_1063 234
440 3300047469 Ga0495673_0006554 Ga0495673_0006554_3388_4101 234
441 3300047469 Ga0495673_0074025 Ga0495673_0074025_551_1264 234
442 3300047470 Ga0495681_0003061 Ga0495681_0003061_7165_7878 234
443 3300047470 Ga0495681_0003061 Ga0495681_0003061_8856_9569 234
444 3300047470 Ga0495681_0012703 Ga0495681_0012703_2033_2746 234
445 3300048088 Ga0495602_0026057 Ga0495602_0026057_1381_2085 234
446 3300048088 Ga0495602_0097450 Ga0495602_0097450_19_723 234
447 3300048089 Ga0495614_0020889 Ga0495614_0020889_2091_2795 234
448 3300048091 Ga0495626_0006450 Ga0495626_0006450_4840_5544 234
449 3300048091 Ga0495626_0026013 Ga0495626_0026013_686_1399 234
450 3300048091 Ga0495626_0056475 Ga0495626_0056475_61_774 234
451 3300048091 Ga0495626_0057512 Ga0495626_0057512_511_1215 234
452 3300048091 Ga0495626_0085801 Ga0495626_0085801_33_812 234
453 3300048904 Ga0496101_0717279 Ga0496101_0717279_58_771 234
454 3300048905 Ga0496102_0015332 Ga0496102_0015332_1096_1809 234
455 3300048908 Ga0496105_0310879 Ga0496105_0310879_431_1144 234
456 3300048913 Ga0496110_0000002 Ga0496110_0000002_46065_46778 234
457 3300048916 Ga0496113_0265425 Ga0496113_0265425_538_1257 234
458 3300048919 Ga0496116_0028781 Ga0496116_0028781_71_784 234
459 3300048919 Ga0496116_0203562 Ga0496116_0203562_10_729 234
460 3300048920 Ga0496117_0012410 Ga0496117_0012410_5626_6441 234
461 3300048921 Ga0496118_0005967 Ga0496118_0005967_7106_7921 234
462 3300048921 Ga0496118_0197554 Ga0496118_0197554_401_1105 234
463 3300048922 Ga0496119_0025527 Ga0496119_0025527_1661_2374 234
464 3300048924 Ga0496121_0000249 Ga0496121_0000249_40820_41533 234
465 3300048924 Ga0496121_0021301 Ga0496121_0021301_5307_6026 234
466 3300048924 Ga0496121_0299154 Ga0496121_0299154_331_1044 234
467 3300048926 Ga0496123_0133828 Ga0496123_0133828_486_1199 234
468 3300048926 Ga0496123_0142322 Ga0496123_0142322_489_1193 234
469 3300048927 Ga0496124_0124022 Ga0496124_0124022_96_809 234
470 3300048928 Ga0496125_0003865 Ga0496125_0003865_6531_7244 234
471 3300048929 Ga0496126_0046447 Ga0496126_0046447_265_978 234
472 3300049459 Ga0495678_000060 Ga0495678_000060_86712_87425 234
473 3300049459 Ga0495678_000060 Ga0495678_000060_88403_89116 234
474 3300049459 Ga0495678_012143 Ga0495678_012143_2498_3211 234
475 3300049460 Ga0495682_0000035 Ga0495682_0000035_88673_89386 234
476 3300049460 Ga0495682_0000035 Ga0495682_0000035_90364_91077 234
477 3300049522 Ga0501299_025031 Ga0501299_025031_214_927 234
478 3300049656 Ga0501209_018245 Ga0501209_018245_802_1515 234
479 3300050493 nmdc:mga0k408_63832_c1 nmdc:mga0k408_63832_c1_1054_1770 234
480 3300053108 Ga0500562_026784 Ga0500562_026784_283_996 234
481 3300053139 Ga0500568_0000168 Ga0500568_0000168_39115_39828 234
482 3300053153 Ga0500616_0003434 Ga0500616_0003434_5588_6301 234
483 3300053156 Ga0500622_0042046 Ga0500622_0042046_1387_2100 234
484 3300053730 Ga0500645_010042 Ga0500645_010042_1321_2034 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

55

237

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

260

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4s-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.9507 1 224
5u4s-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.9494 1 225
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.914 2 212
5ff9-assembly1.cif.gz_B noroxomaritidine/norcraugsodine reductase in complex with nadp+ and tyramine 0.9139 2 212
1ahi-assembly1.cif.gz_A 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid 0.9124 2 210
ID Description Score Start End Superfamily
af_O53324_1_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9503 1 223 3.40.50.720
af_P9WGP9_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9253 2 223 3.40.50.720
af_O53398_1_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9245 4 224 3.40.50.720
af_Q9VU92_1_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 4 210 3.40.50.720
af_K7U3E5_26_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9167 1 221 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5WD94-F1-model_v4 deleted 1 1 180
AF-A0A519ZC40-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9978 1 158 GO:0005829
GO:0016491
AF-A0A328NL21-F1-model_v4 Short chain dehydrogenase 0.994 102 223
AF-A0A3D9ZCP2-F1-model_v4 Short-subunit dehydrogenase 0.993 1 224 GO:0005829
GO:0016491
AF-A0A158CX34-F1-model_v4 Short chain dehydrogenase 0.9924 1 225 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.17 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map