F452899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 241 | 472 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100096651|Ga0068854_1000966512 |
| Length | 261 |
| Sequence | MGPVGGVDGAACAEATPAIDRRTTRNDLSMNMTKNDEIVIRADKVSKSVDGPDGRLTILDDVGFTLARGDSLAIVGASGSGKTTLLGLLAGLDRPSSGEITLAGERLDVLDEEARARLRRRRVGFVFQNFHLLPALNAEENVMLPLELEGGADARTRAGEALARVGLAGRKHHYPAQLSGGEQQRVALARAFVHAPEILFADEPTGNLDRRTGTAIGDLLFALNREHGTTLVLVTHDTVLAERCARRLALDGGRIVDAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 2 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 3 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 4 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 5 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 6 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 7 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 8 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 9 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 10 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 11 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 12 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 131 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 139 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 140 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 144 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 200 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 232 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 233 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 234 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 236 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 238 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 239 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 240 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.11 |
| Metatranscriptomes | 0.41 |
| Isolates | 2.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.75 |
| Nodule | 0 |
| Rhizoplane | 2.69 |
| Rhizosphere | 82.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000453 | 3300001904 | Bacteria | 7688 |
| 2 | Ga0006562J51391_1029719 | 3300003578 | Bacteria | 7370 |
| 3 | Ga0006562J51391_1029721 | 3300003578 | Bacteria | 2440 |
| 4 | Ga0055543_1011650 | 3300004625 | Bacteria | 1792 |
| 5 | Ga0065165_1000700 | 3300005262 | Bacteria | 47662 |
| 6 | Ga0070658_10000030 | 3300005327 | Bacteria | 153608 |
| 7 | Ga0070658_10016979 | 3300005327 | Bacteria | 5825 |
| 8 | Ga0070658_10017986 | 3300005327 | Bacteria | 5653 |
| 9 | Ga0070690_100040039 | 3300005330 | Bacteria | 2963 |
| 10 | Ga0070690_100068676 | 3300005330 | Bacteria | 2299 |
| 11 | Ga0070670_100016193 | 3300005331 | Bacteria | 6400 |
| 12 | Ga0070670_100268021 | 3300005331 | Bacteria | 1489 |
| 13 | Ga0070670_100554078 | 3300005331 | Bacteria | 1026 |
| 14 | Ga0068869_100004014 | 3300005334 | Bacteria | 9101 |
| 15 | Ga0068869_100147545 | 3300005334 | Bacteria | 1822 |
| 16 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 17 | Ga0070666_10000388 | 3300005335 | Bacteria | 27657 |
| 18 | Ga0070666_10029472 | 3300005335 | Bacteria | 3608 |
| 19 | Ga0070666_10143803 | 3300005335 | Bacteria | 1662 |
| 20 | Ga0070666_10158635 | 3300005335 | Bacteria | 1581 |
| 21 | Ga0068868_100006334 | 3300005338 | Bacteria | 8366 |
| 22 | Ga0070668_100159482 | 3300005347 | Bacteria | 1830 |
| 23 | Ga0070668_100448930 | 3300005347 | Bacteria | 1108 |
| 24 | Ga0070669_100018696 | 3300005353 | Bacteria | 4953 |
| 25 | Ga0070675_100028948 | 3300005354 | Bacteria | 4463 |
| 26 | Ga0070673_100052657 | 3300005364 | Bacteria | 3194 |
| 27 | Ga0070673_100059292 | 3300005364 | Bacteria | 3029 |
| 28 | Ga0070667_100000065 | 3300005367 | Bacteria | 135172 |
| 29 | Ga0070667_100024620 | 3300005367 | Bacteria | 5000 |
| 30 | Ga0070667_100046354 | 3300005367 | Bacteria | 3657 |
| 31 | Ga0070667_100120737 | 3300005367 | Bacteria | 2279 |
| 32 | Ga0070711_100398892 | 3300005439 | Bacteria | 1116 |
| 33 | Ga0070663_100000317 | 3300005455 | Bacteria | 24999 |
| 34 | Ga0070663_100129402 | 3300005455 | Bacteria | 1915 |
| 35 | Ga0070663_100170008 | 3300005455 | Bacteria | 1684 |
| 36 | Ga0070663_100293097 | 3300005455 | Bacteria | 1300 |
| 37 | Ga0070678_100662130 | 3300005456 | Bacteria | 937 |
| 38 | Ga0070662_100275150 | 3300005457 | Bacteria | 1361 |
| 39 | Ga0068867_100054593 | 3300005459 | Bacteria | 2951 |
| 40 | Ga0070685_10001421 | 3300005466 | Bacteria | 12566 |
| 41 | Ga0068853_100001386 | 3300005539 | Bacteria | 17508 |
| 42 | Ga0068853_100008885 | 3300005539 | Bacteria | 8084 |
| 43 | Ga0068853_100014323 | 3300005539 | Bacteria | 6490 |
| 44 | Ga0068853_100015974 | 3300005539 | Bacteria | 6172 |
| 45 | Ga0068853_100021188 | 3300005539 | Bacteria | 5414 |
| 46 | Ga0068853_100060062 | 3300005539 | Bacteria | 3284 |
| 47 | Ga0068853_100087598 | 3300005539 | Bacteria | 2732 |
| 48 | Ga0068853_100100308 | 3300005539 | Bacteria | 2559 |
| 49 | Ga0068853_100102310 | 3300005539 | Bacteria | 2535 |
| 50 | Ga0068853_100849248 | 3300005539 | Bacteria | 876 |
| 51 | Ga0070672_100024063 | 3300005543 | Bacteria | 4494 |
| 52 | Ga0070693_100133740 | 3300005547 | Bacteria | 1553 |
| 53 | Ga0070665_100000211 | 3300005548 | Bacteria | 100358 |
| 54 | Ga0070665_100003692 | 3300005548 | Bacteria | 16210 |
| 55 | Ga0070665_100009766 | 3300005548 | Bacteria | 9706 |
| 56 | Ga0070665_100015547 | 3300005548 | Bacteria | 7644 |
| 57 | Ga0070665_100024119 | 3300005548 | Bacteria | 6126 |
| 58 | Ga0070665_100027016 | 3300005548 | Bacteria | 5779 |
| 59 | Ga0070665_100086019 | 3300005548 | Bacteria | 3150 |
| 60 | Ga0070665_100170654 | 3300005548 | Bacteria | 2176 |
| 61 | Ga0068855_100006125 | 3300005563 | Bacteria | 14671 |
| 62 | Ga0068855_100045303 | 3300005563 | Bacteria | 5202 |
| 63 | Ga0068855_100205833 | 3300005563 | Bacteria | 2214 |
| 64 | Ga0068855_100896479 | 3300005563 | Bacteria | 937 |
| 65 | Ga0068857_100062054 | 3300005577 | Bacteria | 3322 |
| 66 | Ga0068857_100085866 | 3300005577 | Bacteria | 2813 |
| 67 | Ga0068854_100079193 | 3300005578 | Bacteria | 2422 |
| 68 | Ga0068854_100096651 | 3300005578 | Bacteria | 2207 |
| 69 | Ga0068856_100017618 | 3300005614 | Bacteria | 6922 |
| 70 | Ga0068852_100037755 | 3300005616 | Bacteria | 4053 |
| 71 | Ga0068859_100095929 | 3300005617 | Bacteria | 3018 |
| 72 | Ga0068859_100373281 | 3300005617 | Bacteria | 1522 |
| 73 | Ga0068861_100018011 | 3300005719 | Bacteria | 5023 |
| 74 | Ga0068861_100521932 | 3300005719 | Bacteria | 1077 |
| 75 | Ga0068870_10003680 | 3300005840 | Bacteria | 6514 |
| 76 | Ga0068863_100124098 | 3300005841 | Bacteria | 2463 |
| 77 | Ga0068858_100008109 | 3300005842 | Bacteria | 10106 |
| 78 | Ga0068858_100102276 | 3300005842 | Bacteria | 2673 |
| 79 | Ga0068858_100806365 | 3300005842 | Bacteria | 916 |
| 80 | Ga0075369_10015312 | 3300006186 | Bacteria | 3076 |
| 81 | Ga0068871_100031951 | 3300006358 | Bacteria | 4153 |
| 82 | Ga0068871_100067585 | 3300006358 | Bacteria | 2933 |
| 83 | Ga0075430_100803708 | 3300006846 | Bacteria | 775 |
| 84 | Ga0075434_100287852 | 3300006871 | Bacteria | 1663 |
| 85 | Ga0075429_100467430 | 3300006880 | Bacteria | 1105 |
| 86 | Ga0068865_100003536 | 3300006881 | Bacteria | 9371 |
| 87 | Ga0068865_100011005 | 3300006881 | Bacteria | 5646 |
| 88 | Ga0068865_100045770 | 3300006881 | Bacteria | 3000 |
| 89 | Ga0097620_100095931 | 3300006931 | Bacteria | 3018 |
| 90 | Ga0097620_100373273 | 3300006931 | Bacteria | 1522 |
| 91 | Ga0105240_10000026 | 3300009093 | Bacteria | 355569 |
| 92 | Ga0105240_10000685 | 3300009093 | Bacteria | 62397 |
| 93 | Ga0105240_10018536 | 3300009093 | Bacteria | 9343 |
| 94 | Ga0105240_10051039 | 3300009093 | Bacteria | 5208 |
| 95 | Ga0105240_10693671 | 3300009093 | Bacteria | 1112 |
| 96 | Ga0111539_10042207 | 3300009094 | Bacteria | 5480 |
| 97 | Ga0105245_10369991 | 3300009098 | Bacteria | 1425 |
| 98 | Ga0105247_10004486 | 3300009101 | Bacteria | 8902 |
| 99 | Ga0114129_10489881 | 3300009147 | Bacteria | 1607 |
| 100 | Ga0105241_10002302 | 3300009174 | Bacteria | 14344 |
| 101 | Ga0105242_10002451 | 3300009176 | Bacteria | 14549 |
| 102 | Ga0105248_10005666 | 3300009177 | Bacteria | 13721 |
| 103 | Ga0105237_10004639 | 3300009545 | Bacteria | 15836 |
| 104 | Ga0105237_10012010 | 3300009545 | Bacteria | 9149 |
| 105 | Ga0105237_10013243 | 3300009545 | Bacteria | 8654 |
| 106 | Ga0105237_10193615 | 3300009545 | Bacteria | 2033 |
| 107 | Ga0105237_10278720 | 3300009545 | Bacteria | 1674 |
| 108 | Ga0105238_10000477 | 3300009551 | Bacteria | 42013 |
| 109 | Ga0105238_10000928 | 3300009551 | Bacteria | 30018 |
| 110 | Ga0105238_10035800 | 3300009551 | Bacteria | 5046 |
| 111 | Ga0105238_10050628 | 3300009551 | Bacteria | 4181 |
| 112 | Ga0105238_10051952 | 3300009551 | Bacteria | 4121 |
| 113 | Ga0105238_10060532 | 3300009551 | Bacteria | 3791 |
| 114 | Ga0105238_10388029 | 3300009551 | Bacteria | 1388 |
| 115 | Ga0105249_10000367 | 3300009553 | Bacteria | 44838 |
| 116 | Ga0105249_10035185 | 3300009553 | Bacteria | 4541 |
| 117 | Ga0105239_10015277 | 3300010375 | Bacteria | 8507 |
| 118 | Ga0105239_10107457 | 3300010375 | Bacteria | 3091 |
| 119 | Ga0105239_10230640 | 3300010375 | Bacteria | 2077 |
| 120 | Ga0105239_10369404 | 3300010375 | Bacteria | 1621 |
| 121 | Ga0105239_10580125 | 3300010375 | Bacteria | 1278 |
| 122 | Ga0105246_10291030 | 3300011119 | Bacteria | 1314 |
| 123 | Ga0157373_10367864 | 3300013100 | Bacteria | 1027 |
| 124 | Ga0157370_10003809 | 3300013104 | Bacteria | 17595 |
| 125 | Ga0157370_10008099 | 3300013104 | Bacteria | 11376 |
| 126 | Ga0157370_10223213 | 3300013104 | Bacteria | 1745 |
| 127 | Ga0157369_10000011 | 3300013105 | Bacteria | 271560 |
| 128 | Ga0157369_10000529 | 3300013105 | Bacteria | 50408 |
| 129 | Ga0157369_10095262 | 3300013105 | Bacteria | 3177 |
| 130 | Ga0157374_10013357 | 3300013296 | Bacteria | 7167 |
| 131 | Ga0157374_10129747 | 3300013296 | Bacteria | 2439 |
| 132 | Ga0157378_10000018 | 3300013297 | Bacteria | 134075 |
| 133 | Ga0163162_10000061 | 3300013306 | Bacteria | 106351 |
| 134 | Ga0163162_10000508 | 3300013306 | Bacteria | 36193 |
| 135 | Ga0163162_10210798 | 3300013306 | Bacteria | 2073 |
| 136 | Ga0163162_10255162 | 3300013306 | Bacteria | 1885 |
| 137 | Ga0163162_10620860 | 3300013306 | Bacteria | 1206 |
| 138 | Ga0163162_10733689 | 3300013306 | Bacteria | 1108 |
| 139 | Ga0157372_10048685 | 3300013307 | Bacteria | 4711 |
| 140 | Ga0157375_10000144 | 3300013308 | Bacteria | 70151 |
| 141 | Ga0157375_10002238 | 3300013308 | Bacteria | 16732 |
| 142 | Ga0182008_10138327 | 3300014497 | Bacteria | 1217 |
| 143 | Ga0157379_10091642 | 3300014968 | Bacteria | 2726 |
| 144 | Ga0157376_10004137 | 3300014969 | Bacteria | 10053 |
| 145 | Ga0157376_10022486 | 3300014969 | Bacteria | 4918 |
| 146 | Ga0157376_10459529 | 3300014969 | Bacteria | 1244 |
| 147 | Ga0182006_1000093 | 3300015261 | Bacteria | 106185 |
| 148 | Ga0182006_1000416 | 3300015261 | Bacteria | 34218 |
| 149 | Ga0182007_10002081 | 3300015262 | Bacteria | 10274 |
| 150 | Ga0182005_1000536 | 3300015265 | Bacteria | 19181 |
| 151 | Ga0182005_1001172 | 3300015265 | Bacteria | 10832 |
| 152 | Ga0182005_1022246 | 3300015265 | Bacteria | 1737 |
| 153 | Ga0163161_10052230 | 3300017792 | Bacteria | 2962 |
| 154 | Ga0213876_10002499 | 3300021384 | Bacteria | 10793 |
| 155 | Ga0209674_100642 | 3300025226 | Bacteria | 12654 |
| 156 | Ga0209437_100605 | 3300025233 | Bacteria | 22268 |
| 157 | Ga0209148_1003616 | 3300025254 | Bacteria | 4149 |
| 158 | Ga0209129_1000439 | 3300025258 | Bacteria | 31012 |
| 159 | Ga0209758_1009460 | 3300025297 | Bacteria | 6054 |
| 160 | Ga0209256_1003092 | 3300025299 | Bacteria | 12197 |
| 161 | Ga0207426_1035747 | 3300025302 | Bacteria | 1584 |
| 162 | Ga0209051_1016130 | 3300025303 | Bacteria | 3403 |
| 163 | Ga0209051_1032712 | 3300025303 | Bacteria | 1979 |
| 164 | Ga0207710_10025248 | 3300025900 | Bacteria | 2564 |
| 165 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 166 | Ga0207680_10000227 | 3300025903 | Bacteria | 27167 |
| 167 | Ga0207680_10020123 | 3300025903 | Bacteria | 3584 |
| 168 | Ga0207680_10099671 | 3300025903 | Bacteria | 1864 |
| 169 | Ga0207680_10250703 | 3300025903 | Bacteria | 1223 |
| 170 | Ga0207680_10305551 | 3300025903 | Bacteria | 1109 |
| 171 | Ga0207680_10318011 | 3300025903 | Bacteria | 1088 |
| 172 | Ga0207647_10000277 | 3300025904 | Bacteria | 41661 |
| 173 | Ga0207647_10001812 | 3300025904 | Bacteria | 16389 |
| 174 | Ga0207645_10014002 | 3300025907 | Bacteria | 5380 |
| 175 | Ga0207645_10063518 | 3300025907 | Bacteria | 2359 |
| 176 | Ga0207705_10001065 | 3300025909 | Bacteria | 22324 |
| 177 | Ga0207705_10013746 | 3300025909 | Bacteria | 5839 |
| 178 | Ga0207705_10035889 | 3300025909 | Bacteria | 3548 |
| 179 | Ga0207705_10048171 | 3300025909 | Bacteria | 3065 |
| 180 | Ga0207654_10003118 | 3300025911 | Bacteria | 8397 |
| 181 | Ga0207654_10169230 | 3300025911 | Bacteria | 1418 |
| 182 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 183 | Ga0207695_10000246 | 3300025913 | Bacteria | 140972 |
| 184 | Ga0207695_10000809 | 3300025913 | Bacteria | 58219 |
| 185 | Ga0207695_10001826 | 3300025913 | Bacteria | 33473 |
| 186 | Ga0207695_10058579 | 3300025913 | Bacteria | 3997 |
| 187 | Ga0207695_10803297 | 3300025913 | Bacteria | 821 |
| 188 | Ga0207671_10001898 | 3300025914 | Bacteria | 23242 |
| 189 | Ga0207671_10004252 | 3300025914 | Bacteria | 13784 |
| 190 | Ga0207671_10008015 | 3300025914 | Bacteria | 9040 |
| 191 | Ga0207671_10162401 | 3300025914 | Bacteria | 1731 |
| 192 | Ga0207663_10307565 | 3300025916 | Bacteria | 1187 |
| 193 | Ga0207663_10423630 | 3300025916 | Bacteria | 1022 |
| 194 | Ga0207649_10036484 | 3300025920 | Bacteria | 2961 |
| 195 | Ga0207649_10069415 | 3300025920 | Bacteria | 2244 |
| 196 | Ga0207649_10083179 | 3300025920 | Bacteria | 2077 |
| 197 | Ga0207649_10096913 | 3300025920 | Bacteria | 1944 |
| 198 | Ga0207681_10021076 | 3300025923 | Bacteria | 4138 |
| 199 | Ga0207694_10000168 | 3300025924 | Bacteria | 67647 |
| 200 | Ga0207694_10004923 | 3300025924 | Bacteria | 10361 |
| 201 | Ga0207694_10013947 | 3300025924 | Bacteria | 6059 |
| 202 | Ga0207694_10085039 | 3300025924 | Bacteria | 2489 |
| 203 | Ga0207694_10184229 | 3300025924 | Bacteria | 1694 |
| 204 | Ga0207650_10005452 | 3300025925 | Bacteria | 8685 |
| 205 | Ga0207650_10129103 | 3300025925 | Bacteria | 1976 |
| 206 | Ga0207650_10306131 | 3300025925 | Bacteria | 1299 |
| 207 | Ga0207650_10533802 | 3300025925 | Bacteria | 983 |
| 208 | Ga0207659_10029802 | 3300025926 | Bacteria | 3722 |
| 209 | Ga0207687_10339801 | 3300025927 | Bacteria | 1220 |
| 210 | Ga0207706_10090769 | 3300025933 | Bacteria | 2686 |
| 211 | Ga0207704_10003301 | 3300025938 | Bacteria | 7328 |
| 212 | Ga0207704_10041613 | 3300025938 | Bacteria | 2696 |
| 213 | Ga0207704_10059539 | 3300025938 | Bacteria | 2358 |
| 214 | Ga0207691_10004583 | 3300025940 | Bacteria | 13385 |
| 215 | Ga0207689_10013703 | 3300025942 | Bacteria | 6912 |
| 216 | Ga0207689_10025606 | 3300025942 | Bacteria | 4943 |
| 217 | Ga0207667_10355794 | 3300025949 | Bacteria | 1493 |
| 218 | Ga0207667_10509101 | 3300025949 | Bacteria | 1220 |
| 219 | Ga0207667_10768453 | 3300025949 | Bacteria | 962 |
| 220 | Ga0207651_10103465 | 3300025960 | Bacteria | 2119 |
| 221 | Ga0207712_10000107 | 3300025961 | Bacteria | 94254 |
| 222 | Ga0207712_10000168 | 3300025961 | Bacteria | 67505 |
| 223 | Ga0207712_10150019 | 3300025961 | Bacteria | 1800 |
| 224 | Ga0207668_10232882 | 3300025972 | Bacteria | 1486 |
| 225 | Ga0207640_10098380 | 3300025981 | Bacteria | 2045 |
| 226 | Ga0207658_10000420 | 3300025986 | Bacteria | 40191 |
| 227 | Ga0207658_10033504 | 3300025986 | Bacteria | 3665 |
| 228 | Ga0207658_10034639 | 3300025986 | Bacteria | 3610 |
| 229 | Ga0207658_10269166 | 3300025986 | Bacteria | 1455 |
| 230 | Ga0207677_10285675 | 3300026023 | Bacteria | 1356 |
| 231 | Ga0207677_10303783 | 3300026023 | Bacteria | 1319 |
| 232 | Ga0207703_10001197 | 3300026035 | Bacteria | 24365 |
| 233 | Ga0207703_10080812 | 3300026035 | Bacteria | 2708 |
| 234 | Ga0207703_10291862 | 3300026035 | Bacteria | 1484 |
| 235 | Ga0207639_10000066 | 3300026041 | Bacteria | 98237 |
| 236 | Ga0207639_10002444 | 3300026041 | Bacteria | 12465 |
| 237 | Ga0207639_10003762 | 3300026041 | Bacteria | 10210 |
| 238 | Ga0207639_10004612 | 3300026041 | Bacteria | 9271 |
| 239 | Ga0207639_10041871 | 3300026041 | Bacteria | 3430 |
| 240 | Ga0207639_10196436 | 3300026041 | Bacteria | 1727 |
| 241 | Ga0207639_10314643 | 3300026041 | Bacteria | 1388 |
| 242 | Ga0207678_10000509 | 3300026067 | Bacteria | 35261 |
| 243 | Ga0207678_10010598 | 3300026067 | Bacteria | 8099 |
| 244 | Ga0207678_10191404 | 3300026067 | Bacteria | 1748 |
| 245 | Ga0207678_10314530 | 3300026067 | Bacteria | 1347 |
| 246 | Ga0207678_10750597 | 3300026067 | Bacteria | 860 |
| 247 | Ga0207702_10103022 | 3300026078 | Bacteria | 2524 |
| 248 | Ga0207641_10031489 | 3300026088 | Bacteria | 4399 |
| 249 | Ga0207641_10053178 | 3300026088 | Bacteria | 3432 |
| 250 | Ga0207641_10150920 | 3300026088 | Bacteria | 2104 |
| 251 | Ga0207641_10339495 | 3300026088 | Bacteria | 1429 |
| 252 | Ga0207648_10009809 | 3300026089 | Bacteria | 9146 |
| 253 | Ga0207674_10016250 | 3300026116 | Bacteria | 8152 |
| 254 | Ga0207674_10232446 | 3300026116 | Bacteria | 1791 |
| 255 | Ga0207675_100026635 | 3300026118 | Bacteria | 5382 |
| 256 | Ga0207683_10007139 | 3300026121 | Bacteria | 9575 |
| 257 | Ga0207683_10234367 | 3300026121 | Bacteria | 1674 |
| 258 | Ga0207698_10008130 | 3300026142 | Bacteria | 6612 |
| 259 | Ga0207698_10080547 | 3300026142 | Bacteria | 2624 |
| 260 | Ga0207698_10158727 | 3300026142 | Bacteria | 1975 |
| 261 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 262 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 263 | Ga0268266_10000059 | 3300028379 | Bacteria | 269485 |
| 264 | Ga0268266_10028032 | 3300028379 | Bacteria | 4788 |
| 265 | Ga0268266_10603823 | 3300028379 | Bacteria | 1054 |
| 266 | Ga0268265_10317407 | 3300028380 | Bacteria | 1410 |
| 267 | Ga0268265_10540315 | 3300028380 | Bacteria | 1105 |
| 268 | Ga0307509_10257733 | 3300031507 | Bacteria | 1522 |
| 269 | Ga0307508_10004577 | 3300031616 | Bacteria | 13461 |
| 270 | Ga0307412_10001041 | 3300031911 | Bacteria | 15843 |
| 271 | Ga0307507_10132756 | 3300033179 | Bacteria | 1941 |
| 272 | Ga0307510_10000112 | 3300033180 | Bacteria | 64759 |
| 273 | Ga0373944_0059092 | 3300035089 | Bacteria | 1226 |
| 274 | Ga0373937_0014408 | 3300036401 | Bacteria | 6981 |
| 275 | Ga0436365_0055304 | 3300039437 | Bacteria | 3613 |
| 276 | Ga0436365_1603528 | 3300039437 | Bacteria | 18850 |
| 277 | Ga0439436_0000016 | 3300041404 | Bacteria | 80941 |
| 278 | Ga0439465_0005618 | 3300041413 | Bacteria | 3994 |
| 279 | Ga0451791_1693520 | 3300041451 | Bacteria | 865 |
| 280 | Ga0451793_1385900 | 3300041452 | Bacteria | 752 |
| 281 | Ga0451793_1427782 | 3300041452 | Bacteria | 2196 |
| 282 | Ga0451807_0786114 | 3300041486 | Bacteria | 821 |
| 283 | Ga0451843_0456557 | 3300041509 | Bacteria | 998 |
| 284 | Ga0450908_000014 | 3300042184 | Bacteria | 41620 |
| 285 | Ga0466972_0000803 | 3300044658 | Bacteria | 14935 |
| 286 | Ga0466982_0000063 | 3300044672 | Bacteria | 29669 |
| 287 | Ga0466970_0001477 | 3300044765 | Bacteria | 11357 |
| 288 | Ga0466959_0100111 | 3300045049 | Bacteria | 2075 |
| 289 | Ga0495617_000750 | 3300046452 | Bacteria | 15942 |
| 290 | Ga0495638_0000078 | 3300046460 | Bacteria | 157545 |
| 291 | Ga0495651_0243943 | 3300046462 | Bacteria | 1231 |
| 292 | Ga0495650_0002172 | 3300046471 | Bacteria | 16594 |
| 293 | Ga0495650_0032317 | 3300046471 | Bacteria | 2341 |
| 294 | Ga0495584_0020240 | 3300046491 | Bacteria | 3382 |
| 295 | Ga0495585_0000366 | 3300046492 | Bacteria | 43799 |
| 296 | Ga0495585_0005846 | 3300046492 | Bacteria | 7714 |
| 297 | Ga0495607_0000040 | 3300046501 | Bacteria | 133419 |
| 298 | Ga0495607_0000140 | 3300046501 | Bacteria | 76410 |
| 299 | Ga0495607_0004707 | 3300046501 | Bacteria | 9987 |
| 300 | Ga0495583_0233076 | 3300046506 | Bacteria | 741 |
| 301 | Ga0495606_0000479 | 3300046507 | Bacteria | 65601 |
| 302 | Ga0495606_0001160 | 3300046507 | Bacteria | 37244 |
| 303 | Ga0495606_0002054 | 3300046507 | Bacteria | 24650 |
| 304 | Ga0495606_0013687 | 3300046507 | Bacteria | 6391 |
| 305 | Ga0495606_0133536 | 3300046507 | Bacteria | 1473 |
| 306 | Ga0495606_0237350 | 3300046507 | Bacteria | 1018 |
| 307 | Ga0495610_0003265 | 3300046512 | Bacteria | 12790 |
| 308 | Ga0495610_0016262 | 3300046512 | Bacteria | 4291 |
| 309 | Ga0495616_0000045 | 3300046513 | Bacteria | 113226 |
| 310 | Ga0495616_0002958 | 3300046513 | Bacteria | 11034 |
| 311 | Ga0495620_0000141 | 3300046515 | Bacteria | 58744 |
| 312 | Ga0495620_0033873 | 3300046515 | Bacteria | 2313 |
| 313 | Ga0495630_0642237 | 3300046517 | Bacteria | 813 |
| 314 | Ga0495631_0000025 | 3300046518 | Bacteria | 89262 |
| 315 | Ga0495631_0000610 | 3300046518 | Bacteria | 23558 |
| 316 | Ga0495632_0000016 | 3300046519 | Bacteria | 232022 |
| 317 | Ga0495632_0020332 | 3300046519 | Bacteria | 3595 |
| 318 | Ga0495632_0048020 | 3300046519 | Bacteria | 2115 |
| 319 | Ga0495637_0007133 | 3300046520 | Bacteria | 5563 |
| 320 | Ga0495648_0000508 | 3300046524 | Bacteria | 41940 |
| 321 | Ga0495648_0010386 | 3300046524 | Bacteria | 7094 |
| 322 | Ga0495665_0086751 | 3300046531 | Bacteria | 1645 |
| 323 | Ga0495609_0038503 | 3300046538 | Bacteria | 2155 |
| 324 | Ga0495668_0001459 | 3300046616 | Bacteria | 22747 |
| 325 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 326 | Ga0495611_0000073 | 3300046648 | Bacteria | 70704 |
| 327 | Ga0495611_0273092 | 3300046648 | Bacteria | 781 |
| 328 | Ga0495625_0000041 | 3300046660 | Bacteria | 206598 |
| 329 | Ga0495625_0044064 | 3300046660 | Bacteria | 3232 |
| 330 | Ga0495625_0053333 | 3300046660 | Bacteria | 2892 |
| 331 | Ga0495661_0003999 | 3300046665 | Bacteria | 10750 |
| 332 | Ga0495661_0070294 | 3300046665 | Bacteria | 2049 |
| 333 | Ga0495657_0096849 | 3300046675 | Bacteria | 1885 |
| 334 | Ga0495623_0291386 | 3300046679 | Bacteria | 905 |
| 335 | Ga0495647_0009554 | 3300046681 | Bacteria | 3288 |
| 336 | Ga0495658_0009835 | 3300046683 | Bacteria | 4769 |
| 337 | Ga0495670_0012908 | 3300046691 | Bacteria | 4106 |
| 338 | Ga0495671_0000182 | 3300046692 | Bacteria | 55867 |
| 339 | Ga0495649_0071236 | 3300046694 | Bacteria | 1863 |
| 340 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 341 | Ga0495660_0000149 | 3300046810 | Bacteria | 76124 |
| 342 | Ga0495660_0000169 | 3300046810 | Bacteria | 70663 |
| 343 | Ga0495604_0130984 | 3300047317 | Bacteria | 1803 |
| 344 | Ga0495683_0004682 | 3300047323 | Bacteria | 7707 |
| 345 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 346 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 347 | Ga0495673_0000278 | 3300047469 | Bacteria | 69367 |
| 348 | Ga0495673_0001102 | 3300047469 | Bacteria | 23237 |
| 349 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 350 | Ga0495686_0001145 | 3300047472 | Bacteria | 31190 |
| 351 | Ga0495686_0006922 | 3300047472 | Bacteria | 8576 |
| 352 | Ga0495686_0067779 | 3300047472 | Bacteria | 2202 |
| 353 | Ga0496100_0000429 | 3300048903 | Bacteria | 20428 |
| 354 | Ga0496101_0104797 | 3300048904 | Bacteria | 2121 |
| 355 | Ga0496102_0832589 | 3300048905 | Bacteria | 845 |
| 356 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 357 | Ga0496105_0000018 | 3300048908 | Bacteria | 197208 |
| 358 | Ga0496106_0012978 | 3300048909 | Bacteria | 6147 |
| 359 | Ga0496107_0113629 | 3300048910 | Bacteria | 1992 |
| 360 | Ga0496107_0117999 | 3300048910 | Bacteria | 1954 |
| 361 | Ga0496115_0000077 | 3300048918 | Bacteria | 89885 |
| 362 | Ga0496116_0112929 | 3300048919 | Bacteria | 1591 |
| 363 | Ga0496117_0070715 | 3300048920 | Bacteria | 2342 |
| 364 | Ga0496117_0164409 | 3300048920 | Bacteria | 1296 |
| 365 | Ga0496118_0000101 | 3300048921 | Bacteria | 159577 |
| 366 | Ga0496118_0000968 | 3300048921 | Bacteria | 44862 |
| 367 | Ga0496118_0001481 | 3300048921 | Bacteria | 35145 |
| 368 | Ga0496118_0005672 | 3300048921 | Bacteria | 14071 |
| 369 | Ga0496118_0008000 | 3300048921 | Bacteria | 11049 |
| 370 | Ga0496118_0013028 | 3300048921 | Bacteria | 7910 |
| 371 | Ga0496119_0016143 | 3300048922 | Bacteria | 5703 |
| 372 | Ga0496119_0202641 | 3300048922 | Bacteria | 1026 |
| 373 | Ga0496121_0000399 | 3300048924 | Bacteria | 86768 |
| 374 | Ga0496121_0001549 | 3300048924 | Bacteria | 38481 |
| 375 | Ga0496121_0003203 | 3300048924 | Bacteria | 23561 |
| 376 | Ga0496121_0091462 | 3300048924 | Bacteria | 2375 |
| 377 | Ga0496122_0000212 | 3300048925 | Bacteria | 129245 |
| 378 | Ga0496122_0015259 | 3300048925 | Bacteria | 7351 |
| 379 | Ga0496122_0016943 | 3300048925 | Bacteria | 6847 |
| 380 | Ga0496122_0027254 | 3300048925 | Bacteria | 4890 |
| 381 | Ga0496123_0001661 | 3300048926 | Bacteria | 29841 |
| 382 | Ga0496123_0007351 | 3300048926 | Bacteria | 10427 |
| 383 | Ga0496123_0011594 | 3300048926 | Bacteria | 7620 |
| 384 | Ga0496123_0064734 | 3300048926 | Bacteria | 2328 |
| 385 | Ga0496124_0000333 | 3300048927 | Bacteria | 87394 |
| 386 | Ga0496124_0000364 | 3300048927 | Bacteria | 82831 |
| 387 | Ga0496125_0019349 | 3300048928 | Bacteria | 6426 |
| 388 | Ga0496125_0071239 | 3300048928 | Bacteria | 2717 |
| 389 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 390 | Ga0496126_0026665 | 3300048929 | Bacteria | 5537 |
| 391 | Ga0495678_000612 | 3300049459 | Bacteria | 33460 |
| 392 | Ga0495682_0002092 | 3300049460 | Bacteria | 9734 |
| 393 | Ga0495682_0010132 | 3300049460 | Bacteria | 3659 |
| 394 | Ga0501031_0005792 | 3300049568 | Bacteria | 8053 |
| 395 | Ga0501032_0001989 | 3300049569 | Bacteria | 16094 |
| 396 | Ga0501032_0002181 | 3300049569 | Bacteria | 15414 |
| 397 | Ga0501032_0031454 | 3300049569 | Bacteria | 3639 |
| 398 | Ga0501033_0000726 | 3300049570 | Bacteria | 30269 |
| 399 | Ga0501033_0076403 | 3300049570 | Bacteria | 2458 |
| 400 | Ga0501033_0368605 | 3300049570 | Bacteria | 1004 |
| 401 | Ga0501034_0002127 | 3300049571 | Bacteria | 24610 |
| 402 | Ga0501034_0005967 | 3300049571 | Bacteria | 13182 |
| 403 | Ga0501034_0011585 | 3300049571 | Bacteria | 9131 |
| 404 | Ga0501034_0153420 | 3300049571 | Bacteria | 2278 |
| 405 | Ga0501034_0309300 | 3300049571 | Bacteria | 1515 |
| 406 | Ga0501036_0001181 | 3300049572 | Bacteria | 19879 |
| 407 | Ga0501036_0044373 | 3300049572 | Bacteria | 3765 |
| 408 | Ga0501036_0081057 | 3300049572 | Bacteria | 2743 |
| 409 | Ga0501037_0002533 | 3300049573 | Bacteria | 13200 |
| 410 | Ga0501037_0004913 | 3300049573 | Bacteria | 9730 |
| 411 | Ga0501037_0016570 | 3300049573 | Bacteria | 5423 |
| 412 | Ga0501037_0201916 | 3300049573 | Bacteria | 1404 |
| 413 | Ga0501038_0000880 | 3300049574 | Bacteria | 26600 |
| 414 | Ga0501038_0003700 | 3300049574 | Bacteria | 14249 |
| 415 | Ga0501038_0666225 | 3300049574 | Bacteria | 782 |
| 416 | Ga0501039_0000356 | 3300049575 | Bacteria | 32594 |
| 417 | Ga0501039_0010888 | 3300049575 | Bacteria | 6933 |
| 418 | Ga0501039_0053413 | 3300049575 | Bacteria | 3126 |
| 419 | Ga0501043_0011840 | 3300049579 | Bacteria | 6833 |
| 420 | Ga0501043_0053042 | 3300049579 | Bacteria | 3184 |
| 421 | Ga0501043_0167664 | 3300049579 | Bacteria | 1714 |
| 422 | Ga0501046_0005829 | 3300049580 | Bacteria | 10986 |
| 423 | Ga0501046_0013949 | 3300049580 | Bacteria | 6788 |
| 424 | Ga0501047_0001556 | 3300049581 | Bacteria | 22458 |
| 425 | Ga0501047_0013608 | 3300049581 | Bacteria | 7717 |
| 426 | Ga0501047_0018052 | 3300049581 | Bacteria | 6760 |
| 427 | Ga0501047_0103721 | 3300049581 | Bacteria | 2724 |
| 428 | Ga0501048_0004330 | 3300049582 | Bacteria | 10813 |
| 429 | Ga0501068_0042566 | 3300049584 | Bacteria | 2731 |
| 430 | Ga0501069_0002373 | 3300049585 | Bacteria | 9550 |
| 431 | Ga0501070_0003423 | 3300049586 | Bacteria | 13763 |
| 432 | Ga0501070_0026241 | 3300049586 | Bacteria | 4890 |
| 433 | Ga0501070_0096158 | 3300049586 | Bacteria | 2450 |
| 434 | Ga0501070_0486284 | 3300049586 | Bacteria | 992 |
| 435 | Ga0501070_0642911 | 3300049586 | Bacteria | 843 |
| 436 | Ga0501071_0009387 | 3300049587 | Bacteria | 6514 |
| 437 | Ga0501071_0017978 | 3300049587 | Bacteria | 4889 |
| 438 | Ga0501073_0010612 | 3300049589 | Bacteria | 6740 |
| 439 | Ga0501073_0197707 | 3300049589 | Bacteria | 1390 |
| 440 | Ga0501074_0008743 | 3300049590 | Bacteria | 7341 |
| 441 | Ga0501074_0066791 | 3300049590 | Bacteria | 2586 |
| 442 | Ga0501079_0027128 | 3300049741 | Bacteria | 4390 |
| 443 | Ga0501080_0003950 | 3300049742 | Bacteria | 13129 |
| 444 | Ga0501080_0005250 | 3300049742 | Bacteria | 11540 |
| 445 | Ga0501080_0046765 | 3300049742 | Bacteria | 4028 |
| 446 | Ga0501083_0006387 | 3300049744 | Bacteria | 8355 |
| 447 | Ga0501035_0000788 | 3300049822 | Bacteria | 33923 |
| 448 | Ga0501035_0005913 | 3300049822 | Bacteria | 11519 |
| 449 | Ga0501035_0008269 | 3300049822 | Bacteria | 9695 |
| 450 | Ga0501035_0009770 | 3300049822 | Bacteria | 8914 |
| 451 | Ga0501044_0001348 | 3300049823 | Bacteria | 28861 |
| 452 | Ga0501044_0002789 | 3300049823 | Bacteria | 19900 |
| 453 | Ga0501044_0004889 | 3300049823 | Bacteria | 14973 |
| 454 | Ga0501044_0017117 | 3300049823 | Bacteria | 7779 |
| 455 | Ga0501044_0018306 | 3300049823 | Bacteria | 7506 |
| 456 | Ga0501044_0052543 | 3300049823 | Bacteria | 4198 |
| 457 | nmdc:mga09592_699002_c1 | 3300050508 | Bacteria | 863 |
| 458 | nmdc:mga0n895_273998_c1 | 3300050512 | Bacteria | 1711 |
| 459 | Ga0500643_000020 | 3300053087 | Bacteria | 290328 |
| 460 | Ga0500643_001707 | 3300053087 | Bacteria | 12199 |
| 461 | Ga0500651_0000367 | 3300053093 | Bacteria | 24844 |
| 462 | Ga0500651_0001150 | 3300053093 | Bacteria | 13107 |
| 463 | Ga0500555_001654 | 3300053103 | Bacteria | 6734 |
| 464 | Ga0500597_000041 | 3300053120 | Bacteria | 25106 |
| 465 | Ga0500628_000128 | 3300053129 | Bacteria | 15297 |
| 466 | Ga0500568_0002290 | 3300053139 | Bacteria | 11396 |
| 467 | Ga0500616_0028816 | 3300053153 | Bacteria | 3058 |
| 468 | Ga0500645_000617 | 3300053730 | Bacteria | 22792 |
| 469 | Ga0500661_002705 | 3300055283 | Bacteria | 3351 |
| 470 | Ga0501082_0001878 | 3300060353 | Bacteria | 18489 |
| 471 | Ga0501082_0188085 | 3300060353 | Bacteria | 1796 |
| 472 | Ga0530510_0343599 | 3300061734 | Bacteria | 1120 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025942 | Ga0207689_10013703 | Ga0207689_100137037 | 204 |
| 2 | 3300005548 | Ga0070665_100027016 | Ga0070665_1000270162 | 206 |
| 3 | 3300005327 | Ga0070658_10016979 | Ga0070658_100169797 | 209 |
| 4 | 3300005335 | Ga0070666_10000013 | Ga0070666_10000013150 | 209 |
| 5 | 3300005347 | Ga0070668_100448930 | Ga0070668_1004489301 | 209 |
| 6 | 3300005547 | Ga0070693_100133740 | Ga0070693_1001337402 | 209 |
| 7 | 3300005548 | Ga0070665_100024119 | Ga0070665_1000241195 | 209 |
| 8 | 3300009551 | Ga0105238_10000477 | Ga0105238_1000047719 | 209 |
| 9 | 3300013306 | Ga0163162_10000508 | Ga0163162_1000050819 | 209 |
| 10 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001233 | 209 |
| 11 | 3300025909 | Ga0207705_10013746 | Ga0207705_100137462 | 209 |
| 12 | 3300025920 | Ga0207649_10069415 | Ga0207649_100694153 | 209 |
| 13 | 3300025924 | Ga0207694_10000168 | Ga0207694_1000016854 | 209 |
| 14 | 3300028379 | Ga0268266_10000059 | Ga0268266_1000005927 | 209 |
| 15 | 3300048922 | Ga0496119_0202641 | Ga0496119_0202641_300_983 | 209 |
| 16 | 3300048928 | Ga0496125_0071239 | Ga0496125_0071239_1736_2419 | 209 |
| 17 | 3300048929 | Ga0496126_0026665 | Ga0496126_0026665_4018_4701 | 209 |
| 18 | 3300005330 | Ga0070690_100040039 | Ga0070690_1000400393 | 210 |
| 19 | 3300005331 | Ga0070670_100554078 | Ga0070670_1005540782 | 210 |
| 20 | 3300005334 | Ga0068869_100147545 | Ga0068869_1001475452 | 210 |
| 21 | 3300005335 | Ga0070666_10143803 | Ga0070666_101438032 | 210 |
| 22 | 3300005539 | Ga0068853_100102310 | Ga0068853_1001023102 | 210 |
| 23 | 3300006358 | Ga0068871_100031951 | Ga0068871_1000319513 | 210 |
| 24 | 3300006871 | Ga0075434_100287852 | Ga0075434_1002878522 | 210 |
| 25 | 3300006881 | Ga0068865_100003536 | Ga0068865_1000035362 | 210 |
| 26 | 3300013296 | Ga0157374_10129747 | Ga0157374_101297472 | 210 |
| 27 | 3300013306 | Ga0163162_10255162 | Ga0163162_102551622 | 210 |
| 28 | 3300013308 | Ga0157375_10002238 | Ga0157375_100022386 | 210 |
| 29 | 3300025903 | Ga0207680_10305551 | Ga0207680_103055512 | 210 |
| 30 | 3300025925 | Ga0207650_10306131 | Ga0207650_103061312 | 210 |
| 31 | 3300025938 | Ga0207704_10003301 | Ga0207704_100033015 | 210 |
| 32 | 3300025949 | Ga0207667_10509101 | Ga0207667_105091012 | 210 |
| 33 | 3300026088 | Ga0207641_10031489 | Ga0207641_100314894 | 210 |
| 34 | 3300026121 | Ga0207683_10234367 | Ga0207683_102343671 | 210 |
| 35 | 3300028379 | Ga0268266_10603823 | Ga0268266_106038231 | 210 |
| 36 | 3300046462 | Ga0495651_0243943 | Ga0495651_0243943_335_1024 | 210 |
| 37 | 3300046675 | Ga0495657_0096849 | Ga0495657_0096849_608_1297 | 210 |
| 38 | 3300050512 | nmdc:mga0n895_273998_c1 | nmdc:mga0n895_273998_c1_747_1433 | 210 |
| 39 | 3300025916 | Ga0207663_10307565 | Ga0207663_103075652 | 211 |
| 40 | 3300025903 | Ga0207680_10020123 | Ga0207680_100201232 | 212 |
| 41 | 3300025933 | Ga0207706_10090769 | Ga0207706_100907692 | 212 |
| 42 | 3300026041 | Ga0207639_10196436 | Ga0207639_101964363 | 212 |
| 43 | 3300026089 | Ga0207648_10009809 | Ga0207648_100098096 | 212 |
| 44 | 3300014497 | Ga0182008_10138327 | Ga0182008_101383272 | 213 |
| 45 | 3300048927 | Ga0496124_0000364 | Ga0496124_0000364_37894_38580 | 214 |
| 46 | iso_pu_bacteria | 2593339238 | 2595446980 | 214 |
| 47 | iso_pu_bacteria | 2593339239 | 2595449738 | 214 |
| 48 | iso_pu_bacteria | 2734482264 | 2735833670 | 214 |
| 49 | 3300048927 | Ga0496124_0000333 | Ga0496124_0000333_44685_45371 | 215 |
| 50 | 3300003578 | Ga0006562J51391_1029719 | Ga0006562J51391_10297192 | 218 |
| 51 | 3300003578 | Ga0006562J51391_1029721 | Ga0006562J51391_10297213 | 218 |
| 52 | 3300004625 | Ga0055543_1011650 | Ga0055543_10116502 | 218 |
| 53 | 3300005262 | Ga0065165_1000700 | Ga0065165_100070023 | 218 |
| 54 | 3300006186 | Ga0075369_10015312 | Ga0075369_100153122 | 218 |
| 55 | 3300017792 | Ga0163161_10052230 | Ga0163161_100522302 | 218 |
| 56 | 3300025226 | Ga0209674_100642 | Ga0209674_1006427 | 218 |
| 57 | 3300025233 | Ga0209437_100605 | Ga0209437_10060518 | 218 |
| 58 | 3300025254 | Ga0209148_1003616 | Ga0209148_10036163 | 218 |
| 59 | 3300025299 | Ga0209256_1003092 | Ga0209256_100309214 | 218 |
| 60 | 3300025302 | Ga0207426_1035747 | Ga0207426_10357472 | 218 |
| 61 | 3300025303 | Ga0209051_1032712 | Ga0209051_10327123 | 218 |
| 62 | 3300025900 | Ga0207710_10025248 | Ga0207710_100252483 | 218 |
| 63 | 3300025904 | Ga0207647_10001812 | Ga0207647_100018127 | 218 |
| 64 | 3300046506 | Ga0495583_0233076 | Ga0495583_0233076_24_680 | 218 |
| 65 | 3300046507 | Ga0495606_0133536 | Ga0495606_0133536_34_690 | 218 |
| 66 | 3300046616 | Ga0495668_0001459 | Ga0495668_0001459_10623_11279 | 218 |
| 67 | 3300046665 | Ga0495661_0070294 | Ga0495661_0070294_60_716 | 218 |
| 68 | 3300046810 | Ga0495660_0000169 | Ga0495660_0000169_30374_31030 | 218 |
| 69 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_308235_308891 | 218 |
| 70 | 3300047469 | Ga0495673_0001102 | Ga0495673_0001102_14871_15527 | 218 |
| 71 | 3300048910 | Ga0496107_0113629 | Ga0496107_0113629_404_1060 | 218 |
| 72 | 3300048924 | Ga0496121_0001549 | Ga0496121_0001549_30385_31041 | 218 |
| 73 | 3300005842 | Ga0068858_100806365 | Ga0068858_1008063652 | 219 |
| 74 | 3300025907 | Ga0207645_10063518 | Ga0207645_100635182 | 219 |
| 75 | 3300026023 | Ga0207677_10285675 | Ga0207677_102856752 | 219 |
| 76 | 3300005539 | Ga0068853_100015974 | Ga0068853_1000159743 | 220 |
| 77 | 3300005577 | Ga0068857_100062054 | Ga0068857_1000620542 | 220 |
| 78 | 3300005617 | Ga0068859_100373281 | Ga0068859_1003732812 | 220 |
| 79 | 3300005719 | Ga0068861_100521932 | Ga0068861_1005219322 | 220 |
| 80 | 3300005842 | Ga0068858_100102276 | Ga0068858_1001022763 | 220 |
| 81 | 3300006846 | Ga0075430_100803708 | Ga0075430_1008037081 | 220 |
| 82 | 3300006880 | Ga0075429_100467430 | Ga0075429_1004674302 | 220 |
| 83 | 3300006931 | Ga0097620_100373273 | Ga0097620_1003732732 | 220 |
| 84 | 3300009094 | Ga0111539_10042207 | Ga0111539_100422076 | 220 |
| 85 | 3300014969 | Ga0157376_10022486 | Ga0157376_100224862 | 220 |
| 86 | 3300025303 | Ga0209051_1016130 | Ga0209051_10161302 | 220 |
| 87 | 3300025920 | Ga0207649_10083179 | Ga0207649_100831792 | 220 |
| 88 | 3300026035 | Ga0207703_10080812 | Ga0207703_100808123 | 220 |
| 89 | 3300026041 | Ga0207639_10041871 | Ga0207639_100418713 | 220 |
| 90 | 3300026116 | Ga0207674_10016250 | Ga0207674_100162503 | 220 |
| 91 | 3300048918 | Ga0496115_0000077 | Ga0496115_0000077_5359_6096 | 220 |
| 92 | 3300048929 | Ga0496126_0000047 | Ga0496126_0000047_288486_289223 | 220 |
| 93 | 3300050508 | nmdc:mga09592_699002_c1 | nmdc:mga09592_699002_c1_107_814 | 220 |
| 94 | 3300053153 | Ga0500616_0028816 | Ga0500616_0028816_481_1143 | 220 |
| 95 | 3300005331 | Ga0070670_100268021 | Ga0070670_1002680212 | 221 |
| 96 | 3300005335 | Ga0070666_10158635 | Ga0070666_101586352 | 221 |
| 97 | 3300005719 | Ga0068861_100018011 | Ga0068861_1000180115 | 221 |
| 98 | 3300009093 | Ga0105240_10693671 | Ga0105240_106936712 | 221 |
| 99 | 3300026118 | Ga0207675_100026635 | Ga0207675_1000266352 | 221 |
| 100 | 3300049569 | Ga0501032_0031454 | Ga0501032_0031454_1275_1952 | 221 |
| 101 | 3300049571 | Ga0501034_0153420 | Ga0501034_0153420_573_1247 | 221 |
| 102 | 3300049571 | Ga0501034_0309300 | Ga0501034_0309300_225_902 | 221 |
| 103 | 3300049573 | Ga0501037_0016570 | Ga0501037_0016570_3844_4518 | 221 |
| 104 | 3300049579 | Ga0501043_0167664 | Ga0501043_0167664_399_1073 | 221 |
| 105 | 3300049581 | Ga0501047_0001556 | Ga0501047_0001556_1772_2449 | 221 |
| 106 | 3300049581 | Ga0501047_0103721 | Ga0501047_0103721_1743_2417 | 221 |
| 107 | 3300049822 | Ga0501035_0000788 | Ga0501035_0000788_20444_21121 | 221 |
| 108 | 3300049823 | Ga0501044_0001348 | Ga0501044_0001348_10080_10757 | 221 |
| 109 | 3300049823 | Ga0501044_0052543 | Ga0501044_0052543_3497_4171 | 221 |
| 110 | 3300053129 | Ga0500628_000128 | Ga0500628_000128_14486_15166 | 221 |
| 111 | 3300005330 | Ga0070690_100068676 | Ga0070690_1000686762 | 224 |
| 112 | 3300049742 | Ga0501080_0003950 | Ga0501080_0003950_8308_9003 | 224 |
| 113 | iso_pu_bacteria | 2818991440 | 2819564119 | 224 |
| 114 | iso_pu_bacteria | 2842914999 | 2842917672 | 224 |
| 115 | iso_pu_bacteria | 2842918807 | 2842920046 | 224 |
| 116 | iso_pu_bacteria | 2884338543 | 2884341658 | 224 |
| 117 | iso_pu_bacteria | 2904463128 | 2904464755 | 224 |
| 118 | iso_pu_bacteria | 2919085039 | 2919088157 | 224 |
| 119 | iso_pu_bacteria | 2919404418 | 2919406269 | 224 |
| 120 | iso_pu_bacteria | 2941471342 | 2941473068 | 224 |
| 121 | iso_pu_bacteria | 2953994433 | 2953995335 | 224 |
| 122 | 3300009147 | Ga0114129_10489881 | Ga0114129_104898812 | 225 |
| 123 | 3300026067 | Ga0207678_10750597 | Ga0207678_107505971 | 225 |
| 124 | 3300005539 | Ga0068853_100021188 | Ga0068853_1000211887 | 226 |
| 125 | 3300005539 | Ga0068853_100849248 | Ga0068853_1008492481 | 226 |
| 126 | 3300005577 | Ga0068857_100085866 | Ga0068857_1000858662 | 226 |
| 127 | 3300009093 | Ga0105240_10000026 | Ga0105240_10000026121 | 226 |
| 128 | 3300013100 | Ga0157373_10367864 | Ga0157373_103678642 | 226 |
| 129 | 3300013306 | Ga0163162_10620860 | Ga0163162_106208602 | 226 |
| 130 | 3300013307 | Ga0157372_10048685 | Ga0157372_100486854 | 226 |
| 131 | 3300025913 | Ga0207695_10000246 | Ga0207695_1000024611 | 226 |
| 132 | 3300025916 | Ga0207663_10423630 | Ga0207663_104236302 | 226 |
| 133 | 3300026041 | Ga0207639_10314643 | Ga0207639_103146431 | 226 |
| 134 | 3300049574 | Ga0501038_0666225 | Ga0501038_0666225_50_733 | 226 |
| 135 | 3300049586 | Ga0501070_0003423 | Ga0501070_0003423_849_1529 | 226 |
| 136 | 3300049586 | Ga0501070_0096158 | Ga0501070_0096158_366_1046 | 226 |
| 137 | 3300049742 | Ga0501080_0046765 | Ga0501080_0046765_764_1444 | 226 |
| 138 | 3300049823 | Ga0501044_0017117 | Ga0501044_0017117_5217_5981 | 226 |
| 139 | 3300005327 | Ga0070658_10000030 | Ga0070658_100000308 | 227 |
| 140 | 3300005327 | Ga0070658_10017986 | Ga0070658_100179862 | 227 |
| 141 | 3300005331 | Ga0070670_100016193 | Ga0070670_1000161935 | 227 |
| 142 | 3300005335 | Ga0070666_10029472 | Ga0070666_100294726 | 227 |
| 143 | 3300005367 | Ga0070667_100024620 | Ga0070667_1000246204 | 227 |
| 144 | 3300005455 | Ga0070663_100129402 | Ga0070663_1001294022 | 227 |
| 145 | 3300005539 | Ga0068853_100060062 | Ga0068853_1000600622 | 227 |
| 146 | 3300005548 | Ga0070665_100015547 | Ga0070665_1000155472 | 227 |
| 147 | 3300005578 | Ga0068854_100096651 | Ga0068854_1000966512 | 227 |
| 148 | 3300005842 | Ga0068858_100008109 | Ga0068858_1000081094 | 227 |
| 149 | 3300009093 | Ga0105240_10018536 | Ga0105240_100185365 | 227 |
| 150 | 3300009545 | Ga0105237_10278720 | Ga0105237_102787201 | 227 |
| 151 | 3300009551 | Ga0105238_10050628 | Ga0105238_100506282 | 227 |
| 152 | 3300013105 | Ga0157369_10095262 | Ga0157369_100952622 | 227 |
| 153 | 3300025903 | Ga0207680_10099671 | Ga0207680_100996712 | 227 |
| 154 | 3300025904 | Ga0207647_10000277 | Ga0207647_100002778 | 227 |
| 155 | 3300025909 | Ga0207705_10048171 | Ga0207705_100481712 | 227 |
| 156 | 3300025913 | Ga0207695_10058579 | Ga0207695_100585795 | 227 |
| 157 | 3300025914 | Ga0207671_10162401 | Ga0207671_101624012 | 227 |
| 158 | 3300025924 | Ga0207694_10013947 | Ga0207694_100139473 | 227 |
| 159 | 3300025925 | Ga0207650_10005452 | Ga0207650_100054523 | 227 |
| 160 | 3300025961 | Ga0207712_10000168 | Ga0207712_1000016812 | 227 |
| 161 | 3300026035 | Ga0207703_10001197 | Ga0207703_100011974 | 227 |
| 162 | 3300026041 | Ga0207639_10000066 | Ga0207639_1000006662 | 227 |
| 163 | 3300026067 | Ga0207678_10010598 | Ga0207678_100105986 | 227 |
| 164 | 3300026088 | Ga0207641_10339495 | Ga0207641_103394952 | 227 |
| 165 | 3300026142 | Ga0207698_10158727 | Ga0207698_101587272 | 227 |
| 166 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007232 | 227 |
| 167 | 3300033180 | Ga0307510_10000112 | Ga0307510_1000011219 | 227 |
| 168 | 3300046471 | Ga0495650_0002172 | Ga0495650_0002172_2314_2997 | 227 |
| 169 | 3300046660 | Ga0495625_0044064 | Ga0495625_0044064_1161_1844 | 227 |
| 170 | 3300048921 | Ga0496118_0008000 | Ga0496118_0008000_10202_10915 | 227 |
| 171 | 3300001904 | JGI24736J21556_1000453 | JGI24736J21556_10004538 | 228 |
| 172 | 3300005334 | Ga0068869_100004014 | Ga0068869_1000040142 | 228 |
| 173 | 3300005335 | Ga0070666_10000388 | Ga0070666_1000038833 | 228 |
| 174 | 3300005338 | Ga0068868_100006334 | Ga0068868_1000063342 | 228 |
| 175 | 3300005347 | Ga0070668_100159482 | Ga0070668_1001594822 | 228 |
| 176 | 3300005353 | Ga0070669_100018696 | Ga0070669_1000186962 | 228 |
| 177 | 3300005354 | Ga0070675_100028948 | Ga0070675_1000289483 | 228 |
| 178 | 3300005364 | Ga0070673_100052657 | Ga0070673_1000526572 | 228 |
| 179 | 3300005364 | Ga0070673_100059292 | Ga0070673_1000592921 | 228 |
| 180 | 3300005367 | Ga0070667_100000065 | Ga0070667_10000006524 | 228 |
| 181 | 3300005367 | Ga0070667_100046354 | Ga0070667_1000463542 | 228 |
| 182 | 3300005367 | Ga0070667_100120737 | Ga0070667_1001207372 | 228 |
| 183 | 3300005439 | Ga0070711_100398892 | Ga0070711_1003988922 | 228 |
| 184 | 3300005455 | Ga0070663_100000317 | Ga0070663_1000003173 | 228 |
| 185 | 3300005455 | Ga0070663_100170008 | Ga0070663_1001700083 | 228 |
| 186 | 3300005455 | Ga0070663_100293097 | Ga0070663_1002930972 | 228 |
| 187 | 3300005456 | Ga0070678_100662130 | Ga0070678_1006621301 | 228 |
| 188 | 3300005457 | Ga0070662_100275150 | Ga0070662_1002751502 | 228 |
| 189 | 3300005459 | Ga0068867_100054593 | Ga0068867_1000545932 | 228 |
| 190 | 3300005466 | Ga0070685_10001421 | Ga0070685_100014212 | 228 |
| 191 | 3300005539 | Ga0068853_100001386 | Ga0068853_1000013869 | 228 |
| 192 | 3300005539 | Ga0068853_100008885 | Ga0068853_1000088852 | 228 |
| 193 | 3300005539 | Ga0068853_100014323 | Ga0068853_1000143233 | 228 |
| 194 | 3300005539 | Ga0068853_100087598 | Ga0068853_1000875982 | 228 |
| 195 | 3300005539 | Ga0068853_100100308 | Ga0068853_1001003082 | 228 |
| 196 | 3300005543 | Ga0070672_100024063 | Ga0070672_1000240633 | 228 |
| 197 | 3300005548 | Ga0070665_100000211 | Ga0070665_1000002117 | 228 |
| 198 | 3300005548 | Ga0070665_100003692 | Ga0070665_10000369212 | 228 |
| 199 | 3300005548 | Ga0070665_100009766 | Ga0070665_1000097662 | 228 |
| 200 | 3300005548 | Ga0070665_100086019 | Ga0070665_1000860192 | 228 |
| 201 | 3300005548 | Ga0070665_100170654 | Ga0070665_1001706543 | 228 |
| 202 | 3300005563 | Ga0068855_100006125 | Ga0068855_1000061258 | 228 |
| 203 | 3300005563 | Ga0068855_100045303 | Ga0068855_1000453032 | 228 |
| 204 | 3300005563 | Ga0068855_100205833 | Ga0068855_1002058332 | 228 |
| 205 | 3300005563 | Ga0068855_100896479 | Ga0068855_1008964791 | 228 |
| 206 | 3300005578 | Ga0068854_100079193 | Ga0068854_1000791932 | 228 |
| 207 | 3300005614 | Ga0068856_100017618 | Ga0068856_1000176182 | 228 |
| 208 | 3300005616 | Ga0068852_100037755 | Ga0068852_1000377552 | 228 |
| 209 | 3300005617 | Ga0068859_100095929 | Ga0068859_1000959293 | 228 |
| 210 | 3300005840 | Ga0068870_10003680 | Ga0068870_100036802 | 228 |
| 211 | 3300005841 | Ga0068863_100124098 | Ga0068863_1001240983 | 228 |
| 212 | 3300006358 | Ga0068871_100067585 | Ga0068871_1000675852 | 228 |
| 213 | 3300006881 | Ga0068865_100011005 | Ga0068865_1000110052 | 228 |
| 214 | 3300006881 | Ga0068865_100045770 | Ga0068865_1000457702 | 228 |
| 215 | 3300006931 | Ga0097620_100095931 | Ga0097620_1000959313 | 228 |
| 216 | 3300009093 | Ga0105240_10000685 | Ga0105240_1000068519 | 228 |
| 217 | 3300009093 | Ga0105240_10051039 | Ga0105240_100510394 | 228 |
| 218 | 3300009098 | Ga0105245_10369991 | Ga0105245_103699912 | 228 |
| 219 | 3300009101 | Ga0105247_10004486 | Ga0105247_100044868 | 228 |
| 220 | 3300009174 | Ga0105241_10002302 | Ga0105241_100023028 | 228 |
| 221 | 3300009176 | Ga0105242_10002451 | Ga0105242_100024512 | 228 |
| 222 | 3300009177 | Ga0105248_10005666 | Ga0105248_1000566613 | 228 |
| 223 | 3300009545 | Ga0105237_10004639 | Ga0105237_1000463910 | 228 |
| 224 | 3300009545 | Ga0105237_10012010 | Ga0105237_100120102 | 228 |
| 225 | 3300009545 | Ga0105237_10013243 | Ga0105237_100132434 | 228 |
| 226 | 3300009545 | Ga0105237_10193615 | Ga0105237_101936154 | 228 |
| 227 | 3300009551 | Ga0105238_10000928 | Ga0105238_1000092817 | 228 |
| 228 | 3300009551 | Ga0105238_10035800 | Ga0105238_100358004 | 228 |
| 229 | 3300009551 | Ga0105238_10051952 | Ga0105238_100519525 | 228 |
| 230 | 3300009551 | Ga0105238_10060532 | Ga0105238_100605322 | 228 |
| 231 | 3300009551 | Ga0105238_10388029 | Ga0105238_103880292 | 228 |
| 232 | 3300009553 | Ga0105249_10000367 | Ga0105249_1000036710 | 228 |
| 233 | 3300009553 | Ga0105249_10035185 | Ga0105249_100351853 | 228 |
| 234 | 3300010375 | Ga0105239_10015277 | Ga0105239_100152773 | 228 |
| 235 | 3300010375 | Ga0105239_10107457 | Ga0105239_101074573 | 228 |
| 236 | 3300010375 | Ga0105239_10230640 | Ga0105239_102306403 | 228 |
| 237 | 3300010375 | Ga0105239_10369404 | Ga0105239_103694042 | 228 |
| 238 | 3300010375 | Ga0105239_10580125 | Ga0105239_105801252 | 228 |
| 239 | 3300011119 | Ga0105246_10291030 | Ga0105246_102910302 | 228 |
| 240 | 3300013104 | Ga0157370_10003809 | Ga0157370_1000380910 | 228 |
| 241 | 3300013104 | Ga0157370_10008099 | Ga0157370_100080999 | 228 |
| 242 | 3300013104 | Ga0157370_10223213 | Ga0157370_102232132 | 228 |
| 243 | 3300013105 | Ga0157369_10000011 | Ga0157369_1000001121 | 228 |
| 244 | 3300013105 | Ga0157369_10000529 | Ga0157369_1000052918 | 228 |
| 245 | 3300013296 | Ga0157374_10013357 | Ga0157374_100133573 | 228 |
| 246 | 3300013297 | Ga0157378_10000018 | Ga0157378_1000001846 | 228 |
| 247 | 3300013306 | Ga0163162_10000061 | Ga0163162_1000006174 | 228 |
| 248 | 3300013306 | Ga0163162_10210798 | Ga0163162_102107982 | 228 |
| 249 | 3300013306 | Ga0163162_10733689 | Ga0163162_107336892 | 228 |
| 250 | 3300013308 | Ga0157375_10000144 | Ga0157375_1000014423 | 228 |
| 251 | 3300014968 | Ga0157379_10091642 | Ga0157379_100916422 | 228 |
| 252 | 3300014969 | Ga0157376_10004137 | Ga0157376_100041373 | 228 |
| 253 | 3300014969 | Ga0157376_10459529 | Ga0157376_104595292 | 228 |
| 254 | 3300015261 | Ga0182006_1000093 | Ga0182006_100009340 | 228 |
| 255 | 3300015261 | Ga0182006_1000416 | Ga0182006_100041621 | 228 |
| 256 | 3300015262 | Ga0182007_10002081 | Ga0182007_1000208110 | 228 |
| 257 | 3300015265 | Ga0182005_1000536 | Ga0182005_100053610 | 228 |
| 258 | 3300015265 | Ga0182005_1001172 | Ga0182005_100117212 | 228 |
| 259 | 3300015265 | Ga0182005_1022246 | Ga0182005_10222462 | 228 |
| 260 | 3300021384 | Ga0213876_10002499 | Ga0213876_100024992 | 228 |
| 261 | 3300025258 | Ga0209129_1000439 | Ga0209129_100043927 | 228 |
| 262 | 3300025297 | Ga0209758_1009460 | Ga0209758_10094602 | 228 |
| 263 | 3300025903 | Ga0207680_10000227 | Ga0207680_100002277 | 228 |
| 264 | 3300025903 | Ga0207680_10250703 | Ga0207680_102507032 | 228 |
| 265 | 3300025903 | Ga0207680_10318011 | Ga0207680_103180112 | 228 |
| 266 | 3300025907 | Ga0207645_10014002 | Ga0207645_100140022 | 228 |
| 267 | 3300025909 | Ga0207705_10001065 | Ga0207705_1000106515 | 228 |
| 268 | 3300025909 | Ga0207705_10035889 | Ga0207705_100358892 | 228 |
| 269 | 3300025911 | Ga0207654_10003118 | Ga0207654_100031182 | 228 |
| 270 | 3300025911 | Ga0207654_10169230 | Ga0207654_101692301 | 228 |
| 271 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007401 | 228 |
| 272 | 3300025913 | Ga0207695_10000809 | Ga0207695_100008098 | 228 |
| 273 | 3300025913 | Ga0207695_10001826 | Ga0207695_1000182628 | 228 |
| 274 | 3300025913 | Ga0207695_10803297 | Ga0207695_108032971 | 228 |
| 275 | 3300025914 | Ga0207671_10001898 | Ga0207671_1000189812 | 228 |
| 276 | 3300025914 | Ga0207671_10004252 | Ga0207671_100042527 | 228 |
| 277 | 3300025914 | Ga0207671_10008015 | Ga0207671_100080152 | 228 |
| 278 | 3300025920 | Ga0207649_10036484 | Ga0207649_100364842 | 228 |
| 279 | 3300025920 | Ga0207649_10096913 | Ga0207649_100969132 | 228 |
| 280 | 3300025923 | Ga0207681_10021076 | Ga0207681_100210762 | 228 |
| 281 | 3300025924 | Ga0207694_10004923 | Ga0207694_100049232 | 228 |
| 282 | 3300025924 | Ga0207694_10085039 | Ga0207694_100850393 | 228 |
| 283 | 3300025924 | Ga0207694_10184229 | Ga0207694_101842292 | 228 |
| 284 | 3300025925 | Ga0207650_10129103 | Ga0207650_101291033 | 228 |
| 285 | 3300025925 | Ga0207650_10533802 | Ga0207650_105338022 | 228 |
| 286 | 3300025926 | Ga0207659_10029802 | Ga0207659_100298023 | 228 |
| 287 | 3300025927 | Ga0207687_10339801 | Ga0207687_103398012 | 228 |
| 288 | 3300025938 | Ga0207704_10041613 | Ga0207704_100416132 | 228 |
| 289 | 3300025938 | Ga0207704_10059539 | Ga0207704_100595392 | 228 |
| 290 | 3300025940 | Ga0207691_10004583 | Ga0207691_100045833 | 228 |
| 291 | 3300025942 | Ga0207689_10025606 | Ga0207689_100256063 | 228 |
| 292 | 3300025949 | Ga0207667_10355794 | Ga0207667_103557942 | 228 |
| 293 | 3300025949 | Ga0207667_10768453 | Ga0207667_107684531 | 228 |
| 294 | 3300025960 | Ga0207651_10103465 | Ga0207651_101034652 | 228 |
| 295 | 3300025961 | Ga0207712_10000107 | Ga0207712_1000010781 | 228 |
| 296 | 3300025961 | Ga0207712_10150019 | Ga0207712_101500192 | 228 |
| 297 | 3300025972 | Ga0207668_10232882 | Ga0207668_102328822 | 228 |
| 298 | 3300025981 | Ga0207640_10098380 | Ga0207640_100983802 | 228 |
| 299 | 3300025986 | Ga0207658_10000420 | Ga0207658_1000042021 | 228 |
| 300 | 3300025986 | Ga0207658_10033504 | Ga0207658_100335044 | 228 |
| 301 | 3300025986 | Ga0207658_10034639 | Ga0207658_100346392 | 228 |
| 302 | 3300025986 | Ga0207658_10269166 | Ga0207658_102691662 | 228 |
| 303 | 3300026023 | Ga0207677_10303783 | Ga0207677_103037832 | 228 |
| 304 | 3300026035 | Ga0207703_10291862 | Ga0207703_102918622 | 228 |
| 305 | 3300026041 | Ga0207639_10002444 | Ga0207639_100024446 | 228 |
| 306 | 3300026041 | Ga0207639_10003762 | Ga0207639_100037623 | 228 |
| 307 | 3300026041 | Ga0207639_10004612 | Ga0207639_100046122 | 228 |
| 308 | 3300026067 | Ga0207678_10000509 | Ga0207678_1000050921 | 228 |
| 309 | 3300026067 | Ga0207678_10191404 | Ga0207678_101914043 | 228 |
| 310 | 3300026067 | Ga0207678_10314530 | Ga0207678_103145302 | 228 |
| 311 | 3300026078 | Ga0207702_10103022 | Ga0207702_101030222 | 228 |
| 312 | 3300026088 | Ga0207641_10053178 | Ga0207641_100531782 | 228 |
| 313 | 3300026088 | Ga0207641_10150920 | Ga0207641_101509202 | 228 |
| 314 | 3300026116 | Ga0207674_10232446 | Ga0207674_102324462 | 228 |
| 315 | 3300026121 | Ga0207683_10007139 | Ga0207683_100071392 | 228 |
| 316 | 3300026142 | Ga0207698_10008130 | Ga0207698_100081303 | 228 |
| 317 | 3300026142 | Ga0207698_10080547 | Ga0207698_100805473 | 228 |
| 318 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012039 | 228 |
| 319 | 3300028379 | Ga0268266_10028032 | Ga0268266_100280322 | 228 |
| 320 | 3300028380 | Ga0268265_10317407 | Ga0268265_103174072 | 228 |
| 321 | 3300028380 | Ga0268265_10540315 | Ga0268265_105403152 | 228 |
| 322 | 3300031507 | Ga0307509_10257733 | Ga0307509_102577332 | 228 |
| 323 | 3300031616 | Ga0307508_10004577 | Ga0307508_100045774 | 228 |
| 324 | 3300031911 | Ga0307412_10001041 | Ga0307412_1000104114 | 228 |
| 325 | 3300033179 | Ga0307507_10132756 | Ga0307507_101327563 | 228 |
| 326 | 3300035089 | Ga0373944_0059092 | Ga0373944_0059092_291_995 | 228 |
| 327 | 3300036401 | Ga0373937_0014408 | Ga0373937_0014408_1181_1873 | 228 |
| 328 | 3300039437 | Ga0436365_0055304 | Ga0436365_0055304_2158_2880 | 228 |
| 329 | 3300039437 | Ga0436365_1603528 | Ga0436365_1603528_8644_9399 | 228 |
| 330 | 3300041404 | Ga0439436_0000016 | Ga0439436_0000016_42765_43451 | 228 |
| 331 | 3300041413 | Ga0439465_0005618 | Ga0439465_0005618_2584_3270 | 228 |
| 332 | 3300041451 | Ga0451791_1693520 | Ga0451791_1693520_22_711 | 228 |
| 333 | 3300041452 | Ga0451793_1385900 | Ga0451793_1385900_17_706 | 228 |
| 334 | 3300041452 | Ga0451793_1427782 | Ga0451793_1427782_1320_2009 | 228 |
| 335 | 3300041486 | Ga0451807_0786114 | Ga0451807_0786114_18_710 | 228 |
| 336 | 3300041509 | Ga0451843_0456557 | Ga0451843_0456557_146_835 | 228 |
| 337 | 3300042184 | Ga0450908_000014 | Ga0450908_000014_21642_22328 | 228 |
| 338 | 3300044658 | Ga0466972_0000803 | Ga0466972_0000803_10488_11177 | 228 |
| 339 | 3300044672 | Ga0466982_0000063 | Ga0466982_0000063_9002_9688 | 228 |
| 340 | 3300044765 | Ga0466970_0001477 | Ga0466970_0001477_117_806 | 228 |
| 341 | 3300045049 | Ga0466959_0100111 | Ga0466959_0100111_746_1435 | 228 |
| 342 | 3300046452 | Ga0495617_000750 | Ga0495617_000750_2405_3091 | 228 |
| 343 | 3300046460 | Ga0495638_0000078 | Ga0495638_0000078_39634_40320 | 228 |
| 344 | 3300046471 | Ga0495650_0032317 | Ga0495650_0032317_1618_2304 | 228 |
| 345 | 3300046491 | Ga0495584_0020240 | Ga0495584_0020240_2308_2994 | 228 |
| 346 | 3300046492 | Ga0495585_0000366 | Ga0495585_0000366_31703_32389 | 228 |
| 347 | 3300046492 | Ga0495585_0005846 | Ga0495585_0005846_6509_7195 | 228 |
| 348 | 3300046501 | Ga0495607_0000040 | Ga0495607_0000040_41046_41732 | 228 |
| 349 | 3300046501 | Ga0495607_0000140 | Ga0495607_0000140_31547_32233 | 228 |
| 350 | 3300046501 | Ga0495607_0004707 | Ga0495607_0004707_5895_6581 | 228 |
| 351 | 3300046507 | Ga0495606_0000479 | Ga0495606_0000479_31280_31966 | 228 |
| 352 | 3300046507 | Ga0495606_0001160 | Ga0495606_0001160_33483_34169 | 228 |
| 353 | 3300046507 | Ga0495606_0002054 | Ga0495606_0002054_18710_19396 | 228 |
| 354 | 3300046507 | Ga0495606_0013687 | Ga0495606_0013687_5384_6070 | 228 |
| 355 | 3300046507 | Ga0495606_0237350 | Ga0495606_0237350_75_761 | 228 |
| 356 | 3300046512 | Ga0495610_0003265 | Ga0495610_0003265_6879_7565 | 228 |
| 357 | 3300046512 | Ga0495610_0016262 | Ga0495610_0016262_3054_3740 | 228 |
| 358 | 3300046513 | Ga0495616_0000045 | Ga0495616_0000045_104950_105636 | 228 |
| 359 | 3300046513 | Ga0495616_0002958 | Ga0495616_0002958_2979_3665 | 228 |
| 360 | 3300046515 | Ga0495620_0000141 | Ga0495620_0000141_26266_26952 | 228 |
| 361 | 3300046515 | Ga0495620_0033873 | Ga0495620_0033873_1204_1890 | 228 |
| 362 | 3300046517 | Ga0495630_0642237 | Ga0495630_0642237_35_739 | 228 |
| 363 | 3300046518 | Ga0495631_0000025 | Ga0495631_0000025_83631_84317 | 228 |
| 364 | 3300046518 | Ga0495631_0000610 | Ga0495631_0000610_4431_5117 | 228 |
| 365 | 3300046519 | Ga0495632_0000016 | Ga0495632_0000016_46547_47233 | 228 |
| 366 | 3300046519 | Ga0495632_0020332 | Ga0495632_0020332_1730_2416 | 228 |
| 367 | 3300046519 | Ga0495632_0048020 | Ga0495632_0048020_1092_1778 | 228 |
| 368 | 3300046520 | Ga0495637_0007133 | Ga0495637_0007133_1281_1967 | 228 |
| 369 | 3300046524 | Ga0495648_0000508 | Ga0495648_0000508_11633_12319 | 228 |
| 370 | 3300046524 | Ga0495648_0010386 | Ga0495648_0010386_2902_3588 | 228 |
| 371 | 3300046531 | Ga0495665_0086751 | Ga0495665_0086751_711_1415 | 228 |
| 372 | 3300046538 | Ga0495609_0038503 | Ga0495609_0038503_922_1608 | 228 |
| 373 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2366176_2366862 | 228 |
| 374 | 3300046648 | Ga0495611_0000073 | Ga0495611_0000073_30156_30842 | 228 |
| 375 | 3300046648 | Ga0495611_0273092 | Ga0495611_0273092_58_744 | 228 |
| 376 | 3300046660 | Ga0495625_0000041 | Ga0495625_0000041_46724_47410 | 228 |
| 377 | 3300046660 | Ga0495625_0053333 | Ga0495625_0053333_189_875 | 228 |
| 378 | 3300046665 | Ga0495661_0003999 | Ga0495661_0003999_9636_10322 | 228 |
| 379 | 3300046679 | Ga0495623_0291386 | Ga0495623_0291386_31_723 | 228 |
| 380 | 3300046681 | Ga0495647_0009554 | Ga0495647_0009554_363_1067 | 228 |
| 381 | 3300046683 | Ga0495658_0009835 | Ga0495658_0009835_2814_3518 | 228 |
| 382 | 3300046691 | Ga0495670_0012908 | Ga0495670_0012908_2217_2903 | 228 |
| 383 | 3300046692 | Ga0495671_0000182 | Ga0495671_0000182_15590_16276 | 228 |
| 384 | 3300046694 | Ga0495649_0071236 | Ga0495649_0071236_578_1264 | 228 |
| 385 | 3300046794 | Ga0495589_0000008 | Ga0495589_0000008_255174_255860 | 228 |
| 386 | 3300046810 | Ga0495660_0000149 | Ga0495660_0000149_29622_30308 | 228 |
| 387 | 3300047317 | Ga0495604_0130984 | Ga0495604_0130984_823_1515 | 228 |
| 388 | 3300047323 | Ga0495683_0004682 | Ga0495683_0004682_5350_6036 | 228 |
| 389 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_476948_477634 | 228 |
| 390 | 3300047469 | Ga0495673_0000278 | Ga0495673_0000278_31799_32485 | 228 |
| 391 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_391802_392488 | 228 |
| 392 | 3300047472 | Ga0495686_0001145 | Ga0495686_0001145_29726_30412 | 228 |
| 393 | 3300047472 | Ga0495686_0006922 | Ga0495686_0006922_7434_8120 | 228 |
| 394 | 3300047472 | Ga0495686_0067779 | Ga0495686_0067779_1196_1882 | 228 |
| 395 | 3300048903 | Ga0496100_0000429 | Ga0496100_0000429_9981_10667 | 228 |
| 396 | 3300048904 | Ga0496101_0104797 | Ga0496101_0104797_1185_1871 | 228 |
| 397 | 3300048905 | Ga0496102_0832589 | Ga0496102_0832589_79_765 | 228 |
| 398 | 3300048907 | Ga0496104_0000005 | Ga0496104_0000005_530660_531364 | 228 |
| 399 | 3300048908 | Ga0496105_0000018 | Ga0496105_0000018_85061_85765 | 228 |
| 400 | 3300048909 | Ga0496106_0012978 | Ga0496106_0012978_203_889 | 228 |
| 401 | 3300048910 | Ga0496107_0117999 | Ga0496107_0117999_592_1281 | 228 |
| 402 | 3300048919 | Ga0496116_0112929 | Ga0496116_0112929_289_975 | 228 |
| 403 | 3300048920 | Ga0496117_0070715 | Ga0496117_0070715_657_1343 | 228 |
| 404 | 3300048920 | Ga0496117_0164409 | Ga0496117_0164409_35_727 | 228 |
| 405 | 3300048921 | Ga0496118_0000101 | Ga0496118_0000101_29844_30533 | 228 |
| 406 | 3300048921 | Ga0496118_0000968 | Ga0496118_0000968_43169_43855 | 228 |
| 407 | 3300048921 | Ga0496118_0001481 | Ga0496118_0001481_6960_7646 | 228 |
| 408 | 3300048921 | Ga0496118_0005672 | Ga0496118_0005672_10693_11382 | 228 |
| 409 | 3300048921 | Ga0496118_0013028 | Ga0496118_0013028_1158_1850 | 228 |
| 410 | 3300048922 | Ga0496119_0016143 | Ga0496119_0016143_2941_3627 | 228 |
| 411 | 3300048924 | Ga0496121_0000399 | Ga0496121_0000399_79191_79877 | 228 |
| 412 | 3300048924 | Ga0496121_0003203 | Ga0496121_0003203_13087_13773 | 228 |
| 413 | 3300048924 | Ga0496121_0091462 | Ga0496121_0091462_436_1122 | 228 |
| 414 | 3300048925 | Ga0496122_0000212 | Ga0496122_0000212_91567_92256 | 228 |
| 415 | 3300048925 | Ga0496122_0015259 | Ga0496122_0015259_2338_3024 | 228 |
| 416 | 3300048925 | Ga0496122_0016943 | Ga0496122_0016943_1815_2501 | 228 |
| 417 | 3300048925 | Ga0496122_0027254 | Ga0496122_0027254_4179_4865 | 228 |
| 418 | 3300048926 | Ga0496123_0001661 | Ga0496123_0001661_18236_18925 | 228 |
| 419 | 3300048926 | Ga0496123_0007351 | Ga0496123_0007351_9163_9849 | 228 |
| 420 | 3300048926 | Ga0496123_0011594 | Ga0496123_0011594_1587_2273 | 228 |
| 421 | 3300048926 | Ga0496123_0064734 | Ga0496123_0064734_944_1630 | 228 |
| 422 | 3300048928 | Ga0496125_0019349 | Ga0496125_0019349_540_1226 | 228 |
| 423 | 3300049459 | Ga0495678_000612 | Ga0495678_000612_18561_19247 | 228 |
| 424 | 3300049460 | Ga0495682_0002092 | Ga0495682_0002092_4031_4717 | 228 |
| 425 | 3300049460 | Ga0495682_0010132 | Ga0495682_0010132_2343_3029 | 228 |
| 426 | 3300049568 | Ga0501031_0005792 | Ga0501031_0005792_1834_2595 | 228 |
| 427 | 3300049569 | Ga0501032_0001989 | Ga0501032_0001989_6324_7094 | 228 |
| 428 | 3300049569 | Ga0501032_0002181 | Ga0501032_0002181_9189_9950 | 228 |
| 429 | 3300049570 | Ga0501033_0000726 | Ga0501033_0000726_9001_9771 | 228 |
| 430 | 3300049570 | Ga0501033_0076403 | Ga0501033_0076403_187_930 | 228 |
| 431 | 3300049570 | Ga0501033_0368605 | Ga0501033_0368605_91_780 | 228 |
| 432 | 3300049571 | Ga0501034_0002127 | Ga0501034_0002127_18259_19029 | 228 |
| 433 | 3300049571 | Ga0501034_0005967 | Ga0501034_0005967_8667_9410 | 228 |
| 434 | 3300049571 | Ga0501034_0011585 | Ga0501034_0011585_6733_7494 | 228 |
| 435 | 3300049572 | Ga0501036_0001181 | Ga0501036_0001181_11260_12030 | 228 |
| 436 | 3300049572 | Ga0501036_0044373 | Ga0501036_0044373_1943_2686 | 228 |
| 437 | 3300049572 | Ga0501036_0081057 | Ga0501036_0081057_1306_2067 | 228 |
| 438 | 3300049573 | Ga0501037_0002533 | Ga0501037_0002533_4388_5158 | 228 |
| 439 | 3300049573 | Ga0501037_0004913 | Ga0501037_0004913_3543_4304 | 228 |
| 440 | 3300049573 | Ga0501037_0201916 | Ga0501037_0201916_541_1284 | 228 |
| 441 | 3300049574 | Ga0501038_0000880 | Ga0501038_0000880_244_1005 | 228 |
| 442 | 3300049574 | Ga0501038_0003700 | Ga0501038_0003700_6829_7599 | 228 |
| 443 | 3300049575 | Ga0501039_0000356 | Ga0501039_0000356_18077_18847 | 228 |
| 444 | 3300049575 | Ga0501039_0010888 | Ga0501039_0010888_4346_5107 | 228 |
| 445 | 3300049575 | Ga0501039_0053413 | Ga0501039_0053413_1324_2067 | 228 |
| 446 | 3300049579 | Ga0501043_0011840 | Ga0501043_0011840_3577_4338 | 228 |
| 447 | 3300049579 | Ga0501043_0053042 | Ga0501043_0053042_573_1343 | 228 |
| 448 | 3300049580 | Ga0501046_0005829 | Ga0501046_0005829_7880_8623 | 228 |
| 449 | 3300049580 | Ga0501046_0013949 | Ga0501046_0013949_1170_1931 | 228 |
| 450 | 3300049581 | Ga0501047_0013608 | Ga0501047_0013608_2835_3605 | 228 |
| 451 | 3300049581 | Ga0501047_0018052 | Ga0501047_0018052_4834_5595 | 228 |
| 452 | 3300049582 | Ga0501048_0004330 | Ga0501048_0004330_6247_6990 | 228 |
| 453 | 3300049584 | Ga0501068_0042566 | Ga0501068_0042566_1536_2306 | 228 |
| 454 | 3300049585 | Ga0501069_0002373 | Ga0501069_0002373_8465_9208 | 228 |
| 455 | 3300049586 | Ga0501070_0026241 | Ga0501070_0026241_1285_2055 | 228 |
| 456 | 3300049586 | Ga0501070_0486284 | Ga0501070_0486284_63_806 | 228 |
| 457 | 3300049586 | Ga0501070_0642911 | Ga0501070_0642911_48_809 | 228 |
| 458 | 3300049587 | Ga0501071_0009387 | Ga0501071_0009387_5748_6491 | 228 |
| 459 | 3300049587 | Ga0501071_0017978 | Ga0501071_0017978_1517_2287 | 228 |
| 460 | 3300049589 | Ga0501073_0010612 | Ga0501073_0010612_2077_2847 | 228 |
| 461 | 3300049589 | Ga0501073_0197707 | Ga0501073_0197707_493_1236 | 228 |
| 462 | 3300049590 | Ga0501074_0008743 | Ga0501074_0008743_1572_2342 | 228 |
| 463 | 3300049590 | Ga0501074_0066791 | Ga0501074_0066791_1657_2400 | 228 |
| 464 | 3300049741 | Ga0501079_0027128 | Ga0501079_0027128_2588_3331 | 228 |
| 465 | 3300049742 | Ga0501080_0005250 | Ga0501080_0005250_9682_10452 | 228 |
| 466 | 3300049744 | Ga0501083_0006387 | Ga0501083_0006387_1388_2131 | 228 |
| 467 | 3300049822 | Ga0501035_0005913 | Ga0501035_0005913_6651_7421 | 228 |
| 468 | 3300049822 | Ga0501035_0008269 | Ga0501035_0008269_8857_9600 | 228 |
| 469 | 3300049822 | Ga0501035_0009770 | Ga0501035_0009770_5407_6168 | 228 |
| 470 | 3300049823 | Ga0501044_0002789 | Ga0501044_0002789_1531_2274 | 228 |
| 471 | 3300049823 | Ga0501044_0004889 | Ga0501044_0004889_12378_13139 | 228 |
| 472 | 3300049823 | Ga0501044_0018306 | Ga0501044_0018306_4443_5213 | 228 |
| 473 | 3300053087 | Ga0500643_000020 | Ga0500643_000020_249915_250601 | 228 |
| 474 | 3300053087 | Ga0500643_001707 | Ga0500643_001707_4644_5333 | 228 |
| 475 | 3300053093 | Ga0500651_0000367 | Ga0500651_0000367_13192_13881 | 228 |
| 476 | 3300053093 | Ga0500651_0001150 | Ga0500651_0001150_9067_9756 | 228 |
| 477 | 3300053103 | Ga0500555_001654 | Ga0500555_001654_2527_3213 | 228 |
| 478 | 3300053120 | Ga0500597_000041 | Ga0500597_000041_22122_22811 | 228 |
| 479 | 3300053139 | Ga0500568_0002290 | Ga0500568_0002290_5036_5809 | 228 |
| 480 | 3300053730 | Ga0500645_000617 | Ga0500645_000617_21413_22099 | 228 |
| 481 | 3300055283 | Ga0500661_002705 | Ga0500661_002705_2005_2694 | 228 |
| 482 | 3300060353 | Ga0501082_0001878 | Ga0501082_0001878_1382_2170 | 228 |
| 483 | 3300060353 | Ga0501082_0188085 | Ga0501082_0188085_269_1012 | 228 |
| 484 | 3300061734 | Ga0530510_0343599 | Ga0530510_0343599_152_895 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.962 | 9 | 224 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9609 | 7 | 225 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9593 | 7 | 225 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9567 | 8 | 225 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9521 | 8 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9T8_2_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9806 | 7 | 228 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9762 | 35 | 225 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9746 | 7 | 224 | 3.40.50.300 |
| af_Q4DP20_46_317_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9688 | 7 | 225 | 3.40.50.300 |
| af_Q8T665_1_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.962 | 7 | 224 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A316F6D1-F1-model_v4 | Putative ABC transport system ATP-binding protein | 0.9941 | 9 | 225 |
GO:0005524
GO:0016887 |
| AF-A0A2D5TSH3-F1-model_v4 | ABC transporter | 0.9895 | 7 | 224 |
GO:0005524
GO:0016887 |
| AF-R6CP31-F1-model_v4 | deleted | 0.9836 | 7 | 225 |
|
| AF-A9KJN2-F1-model_v4 | ABC transporter related | 0.9818 | 2 | 224 |
GO:0005524
GO:0016887 |
| AF-A0A351NPA2-F1-model_v4 | deleted | 0.9808 | 7 | 228 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar