F452899

General Info

Members Datasets Scaffolds Average Seq Length
484 241 472 232

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100096651|Ga0068854_1000966512
Length 261
Sequence MGPVGGVDGAACAEATPAIDRRTTRNDLSMNMTKNDEIVIRADKVSKSVDGPDGRLTILDDVGFTLARGDSLAIVGASGSGKTTLLGLLAGLDRPSSGEITLAGERLDVLDEEARARLRRRRVGFVFQNFHLLPALNAEENVMLPLELEGGADARTRAGEALARVGLAGRKHHYPAQLSGGEQQRVALARAFVHAPEILFADEPTGNLDRRTGTAIGDLLFALNREHGTTLVLVTHDTVLAERCARRLALDGGRIVDAAAA

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2734482264 Dyella sp. AD052 Isolate Unclassified
4 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
5 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
6 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
7 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
8 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
9 2919085039 Luteibacter sp. 1214 Isolate Unclassified
10 2919404418 Luteibacter sp. 3190 Isolate Unclassified
11 2941471342 Luteibacter sp. 621 Isolate Unclassified
12 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
235 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0.41
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 0
Rhizoplane 2.69
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000453 3300001904 Bacteria 7688
2 Ga0006562J51391_1029719 3300003578 Bacteria 7370
3 Ga0006562J51391_1029721 3300003578 Bacteria 2440
4 Ga0055543_1011650 3300004625 Bacteria 1792
5 Ga0065165_1000700 3300005262 Bacteria 47662
6 Ga0070658_10000030 3300005327 Bacteria 153608
7 Ga0070658_10016979 3300005327 Bacteria 5825
8 Ga0070658_10017986 3300005327 Bacteria 5653
9 Ga0070690_100040039 3300005330 Bacteria 2963
10 Ga0070690_100068676 3300005330 Bacteria 2299
11 Ga0070670_100016193 3300005331 Bacteria 6400
12 Ga0070670_100268021 3300005331 Bacteria 1489
13 Ga0070670_100554078 3300005331 Bacteria 1026
14 Ga0068869_100004014 3300005334 Bacteria 9101
15 Ga0068869_100147545 3300005334 Bacteria 1822
16 Ga0070666_10000013 3300005335 Bacteria 230442
17 Ga0070666_10000388 3300005335 Bacteria 27657
18 Ga0070666_10029472 3300005335 Bacteria 3608
19 Ga0070666_10143803 3300005335 Bacteria 1662
20 Ga0070666_10158635 3300005335 Bacteria 1581
21 Ga0068868_100006334 3300005338 Bacteria 8366
22 Ga0070668_100159482 3300005347 Bacteria 1830
23 Ga0070668_100448930 3300005347 Bacteria 1108
24 Ga0070669_100018696 3300005353 Bacteria 4953
25 Ga0070675_100028948 3300005354 Bacteria 4463
26 Ga0070673_100052657 3300005364 Bacteria 3194
27 Ga0070673_100059292 3300005364 Bacteria 3029
28 Ga0070667_100000065 3300005367 Bacteria 135172
29 Ga0070667_100024620 3300005367 Bacteria 5000
30 Ga0070667_100046354 3300005367 Bacteria 3657
31 Ga0070667_100120737 3300005367 Bacteria 2279
32 Ga0070711_100398892 3300005439 Bacteria 1116
33 Ga0070663_100000317 3300005455 Bacteria 24999
34 Ga0070663_100129402 3300005455 Bacteria 1915
35 Ga0070663_100170008 3300005455 Bacteria 1684
36 Ga0070663_100293097 3300005455 Bacteria 1300
37 Ga0070678_100662130 3300005456 Bacteria 937
38 Ga0070662_100275150 3300005457 Bacteria 1361
39 Ga0068867_100054593 3300005459 Bacteria 2951
40 Ga0070685_10001421 3300005466 Bacteria 12566
41 Ga0068853_100001386 3300005539 Bacteria 17508
42 Ga0068853_100008885 3300005539 Bacteria 8084
43 Ga0068853_100014323 3300005539 Bacteria 6490
44 Ga0068853_100015974 3300005539 Bacteria 6172
45 Ga0068853_100021188 3300005539 Bacteria 5414
46 Ga0068853_100060062 3300005539 Bacteria 3284
47 Ga0068853_100087598 3300005539 Bacteria 2732
48 Ga0068853_100100308 3300005539 Bacteria 2559
49 Ga0068853_100102310 3300005539 Bacteria 2535
50 Ga0068853_100849248 3300005539 Bacteria 876
51 Ga0070672_100024063 3300005543 Bacteria 4494
52 Ga0070693_100133740 3300005547 Bacteria 1553
53 Ga0070665_100000211 3300005548 Bacteria 100358
54 Ga0070665_100003692 3300005548 Bacteria 16210
55 Ga0070665_100009766 3300005548 Bacteria 9706
56 Ga0070665_100015547 3300005548 Bacteria 7644
57 Ga0070665_100024119 3300005548 Bacteria 6126
58 Ga0070665_100027016 3300005548 Bacteria 5779
59 Ga0070665_100086019 3300005548 Bacteria 3150
60 Ga0070665_100170654 3300005548 Bacteria 2176
61 Ga0068855_100006125 3300005563 Bacteria 14671
62 Ga0068855_100045303 3300005563 Bacteria 5202
63 Ga0068855_100205833 3300005563 Bacteria 2214
64 Ga0068855_100896479 3300005563 Bacteria 937
65 Ga0068857_100062054 3300005577 Bacteria 3322
66 Ga0068857_100085866 3300005577 Bacteria 2813
67 Ga0068854_100079193 3300005578 Bacteria 2422
68 Ga0068854_100096651 3300005578 Bacteria 2207
69 Ga0068856_100017618 3300005614 Bacteria 6922
70 Ga0068852_100037755 3300005616 Bacteria 4053
71 Ga0068859_100095929 3300005617 Bacteria 3018
72 Ga0068859_100373281 3300005617 Bacteria 1522
73 Ga0068861_100018011 3300005719 Bacteria 5023
74 Ga0068861_100521932 3300005719 Bacteria 1077
75 Ga0068870_10003680 3300005840 Bacteria 6514
76 Ga0068863_100124098 3300005841 Bacteria 2463
77 Ga0068858_100008109 3300005842 Bacteria 10106
78 Ga0068858_100102276 3300005842 Bacteria 2673
79 Ga0068858_100806365 3300005842 Bacteria 916
80 Ga0075369_10015312 3300006186 Bacteria 3076
81 Ga0068871_100031951 3300006358 Bacteria 4153
82 Ga0068871_100067585 3300006358 Bacteria 2933
83 Ga0075430_100803708 3300006846 Bacteria 775
84 Ga0075434_100287852 3300006871 Bacteria 1663
85 Ga0075429_100467430 3300006880 Bacteria 1105
86 Ga0068865_100003536 3300006881 Bacteria 9371
87 Ga0068865_100011005 3300006881 Bacteria 5646
88 Ga0068865_100045770 3300006881 Bacteria 3000
89 Ga0097620_100095931 3300006931 Bacteria 3018
90 Ga0097620_100373273 3300006931 Bacteria 1522
91 Ga0105240_10000026 3300009093 Bacteria 355569
92 Ga0105240_10000685 3300009093 Bacteria 62397
93 Ga0105240_10018536 3300009093 Bacteria 9343
94 Ga0105240_10051039 3300009093 Bacteria 5208
95 Ga0105240_10693671 3300009093 Bacteria 1112
96 Ga0111539_10042207 3300009094 Bacteria 5480
97 Ga0105245_10369991 3300009098 Bacteria 1425
98 Ga0105247_10004486 3300009101 Bacteria 8902
99 Ga0114129_10489881 3300009147 Bacteria 1607
100 Ga0105241_10002302 3300009174 Bacteria 14344
101 Ga0105242_10002451 3300009176 Bacteria 14549
102 Ga0105248_10005666 3300009177 Bacteria 13721
103 Ga0105237_10004639 3300009545 Bacteria 15836
104 Ga0105237_10012010 3300009545 Bacteria 9149
105 Ga0105237_10013243 3300009545 Bacteria 8654
106 Ga0105237_10193615 3300009545 Bacteria 2033
107 Ga0105237_10278720 3300009545 Bacteria 1674
108 Ga0105238_10000477 3300009551 Bacteria 42013
109 Ga0105238_10000928 3300009551 Bacteria 30018
110 Ga0105238_10035800 3300009551 Bacteria 5046
111 Ga0105238_10050628 3300009551 Bacteria 4181
112 Ga0105238_10051952 3300009551 Bacteria 4121
113 Ga0105238_10060532 3300009551 Bacteria 3791
114 Ga0105238_10388029 3300009551 Bacteria 1388
115 Ga0105249_10000367 3300009553 Bacteria 44838
116 Ga0105249_10035185 3300009553 Bacteria 4541
117 Ga0105239_10015277 3300010375 Bacteria 8507
118 Ga0105239_10107457 3300010375 Bacteria 3091
119 Ga0105239_10230640 3300010375 Bacteria 2077
120 Ga0105239_10369404 3300010375 Bacteria 1621
121 Ga0105239_10580125 3300010375 Bacteria 1278
122 Ga0105246_10291030 3300011119 Bacteria 1314
123 Ga0157373_10367864 3300013100 Bacteria 1027
124 Ga0157370_10003809 3300013104 Bacteria 17595
125 Ga0157370_10008099 3300013104 Bacteria 11376
126 Ga0157370_10223213 3300013104 Bacteria 1745
127 Ga0157369_10000011 3300013105 Bacteria 271560
128 Ga0157369_10000529 3300013105 Bacteria 50408
129 Ga0157369_10095262 3300013105 Bacteria 3177
130 Ga0157374_10013357 3300013296 Bacteria 7167
131 Ga0157374_10129747 3300013296 Bacteria 2439
132 Ga0157378_10000018 3300013297 Bacteria 134075
133 Ga0163162_10000061 3300013306 Bacteria 106351
134 Ga0163162_10000508 3300013306 Bacteria 36193
135 Ga0163162_10210798 3300013306 Bacteria 2073
136 Ga0163162_10255162 3300013306 Bacteria 1885
137 Ga0163162_10620860 3300013306 Bacteria 1206
138 Ga0163162_10733689 3300013306 Bacteria 1108
139 Ga0157372_10048685 3300013307 Bacteria 4711
140 Ga0157375_10000144 3300013308 Bacteria 70151
141 Ga0157375_10002238 3300013308 Bacteria 16732
142 Ga0182008_10138327 3300014497 Bacteria 1217
143 Ga0157379_10091642 3300014968 Bacteria 2726
144 Ga0157376_10004137 3300014969 Bacteria 10053
145 Ga0157376_10022486 3300014969 Bacteria 4918
146 Ga0157376_10459529 3300014969 Bacteria 1244
147 Ga0182006_1000093 3300015261 Bacteria 106185
148 Ga0182006_1000416 3300015261 Bacteria 34218
149 Ga0182007_10002081 3300015262 Bacteria 10274
150 Ga0182005_1000536 3300015265 Bacteria 19181
151 Ga0182005_1001172 3300015265 Bacteria 10832
152 Ga0182005_1022246 3300015265 Bacteria 1737
153 Ga0163161_10052230 3300017792 Bacteria 2962
154 Ga0213876_10002499 3300021384 Bacteria 10793
155 Ga0209674_100642 3300025226 Bacteria 12654
156 Ga0209437_100605 3300025233 Bacteria 22268
157 Ga0209148_1003616 3300025254 Bacteria 4149
158 Ga0209129_1000439 3300025258 Bacteria 31012
159 Ga0209758_1009460 3300025297 Bacteria 6054
160 Ga0209256_1003092 3300025299 Bacteria 12197
161 Ga0207426_1035747 3300025302 Bacteria 1584
162 Ga0209051_1016130 3300025303 Bacteria 3403
163 Ga0209051_1032712 3300025303 Bacteria 1979
164 Ga0207710_10025248 3300025900 Bacteria 2564
165 Ga0207680_10000001 3300025903 Bacteria 1091453
166 Ga0207680_10000227 3300025903 Bacteria 27167
167 Ga0207680_10020123 3300025903 Bacteria 3584
168 Ga0207680_10099671 3300025903 Bacteria 1864
169 Ga0207680_10250703 3300025903 Bacteria 1223
170 Ga0207680_10305551 3300025903 Bacteria 1109
171 Ga0207680_10318011 3300025903 Bacteria 1088
172 Ga0207647_10000277 3300025904 Bacteria 41661
173 Ga0207647_10001812 3300025904 Bacteria 16389
174 Ga0207645_10014002 3300025907 Bacteria 5380
175 Ga0207645_10063518 3300025907 Bacteria 2359
176 Ga0207705_10001065 3300025909 Bacteria 22324
177 Ga0207705_10013746 3300025909 Bacteria 5839
178 Ga0207705_10035889 3300025909 Bacteria 3548
179 Ga0207705_10048171 3300025909 Bacteria 3065
180 Ga0207654_10003118 3300025911 Bacteria 8397
181 Ga0207654_10169230 3300025911 Bacteria 1418
182 Ga0207695_10000007 3300025913 Bacteria 1092551
183 Ga0207695_10000246 3300025913 Bacteria 140972
184 Ga0207695_10000809 3300025913 Bacteria 58219
185 Ga0207695_10001826 3300025913 Bacteria 33473
186 Ga0207695_10058579 3300025913 Bacteria 3997
187 Ga0207695_10803297 3300025913 Bacteria 821
188 Ga0207671_10001898 3300025914 Bacteria 23242
189 Ga0207671_10004252 3300025914 Bacteria 13784
190 Ga0207671_10008015 3300025914 Bacteria 9040
191 Ga0207671_10162401 3300025914 Bacteria 1731
192 Ga0207663_10307565 3300025916 Bacteria 1187
193 Ga0207663_10423630 3300025916 Bacteria 1022
194 Ga0207649_10036484 3300025920 Bacteria 2961
195 Ga0207649_10069415 3300025920 Bacteria 2244
196 Ga0207649_10083179 3300025920 Bacteria 2077
197 Ga0207649_10096913 3300025920 Bacteria 1944
198 Ga0207681_10021076 3300025923 Bacteria 4138
199 Ga0207694_10000168 3300025924 Bacteria 67647
200 Ga0207694_10004923 3300025924 Bacteria 10361
201 Ga0207694_10013947 3300025924 Bacteria 6059
202 Ga0207694_10085039 3300025924 Bacteria 2489
203 Ga0207694_10184229 3300025924 Bacteria 1694
204 Ga0207650_10005452 3300025925 Bacteria 8685
205 Ga0207650_10129103 3300025925 Bacteria 1976
206 Ga0207650_10306131 3300025925 Bacteria 1299
207 Ga0207650_10533802 3300025925 Bacteria 983
208 Ga0207659_10029802 3300025926 Bacteria 3722
209 Ga0207687_10339801 3300025927 Bacteria 1220
210 Ga0207706_10090769 3300025933 Bacteria 2686
211 Ga0207704_10003301 3300025938 Bacteria 7328
212 Ga0207704_10041613 3300025938 Bacteria 2696
213 Ga0207704_10059539 3300025938 Bacteria 2358
214 Ga0207691_10004583 3300025940 Bacteria 13385
215 Ga0207689_10013703 3300025942 Bacteria 6912
216 Ga0207689_10025606 3300025942 Bacteria 4943
217 Ga0207667_10355794 3300025949 Bacteria 1493
218 Ga0207667_10509101 3300025949 Bacteria 1220
219 Ga0207667_10768453 3300025949 Bacteria 962
220 Ga0207651_10103465 3300025960 Bacteria 2119
221 Ga0207712_10000107 3300025961 Bacteria 94254
222 Ga0207712_10000168 3300025961 Bacteria 67505
223 Ga0207712_10150019 3300025961 Bacteria 1800
224 Ga0207668_10232882 3300025972 Bacteria 1486
225 Ga0207640_10098380 3300025981 Bacteria 2045
226 Ga0207658_10000420 3300025986 Bacteria 40191
227 Ga0207658_10033504 3300025986 Bacteria 3665
228 Ga0207658_10034639 3300025986 Bacteria 3610
229 Ga0207658_10269166 3300025986 Bacteria 1455
230 Ga0207677_10285675 3300026023 Bacteria 1356
231 Ga0207677_10303783 3300026023 Bacteria 1319
232 Ga0207703_10001197 3300026035 Bacteria 24365
233 Ga0207703_10080812 3300026035 Bacteria 2708
234 Ga0207703_10291862 3300026035 Bacteria 1484
235 Ga0207639_10000066 3300026041 Bacteria 98237
236 Ga0207639_10002444 3300026041 Bacteria 12465
237 Ga0207639_10003762 3300026041 Bacteria 10210
238 Ga0207639_10004612 3300026041 Bacteria 9271
239 Ga0207639_10041871 3300026041 Bacteria 3430
240 Ga0207639_10196436 3300026041 Bacteria 1727
241 Ga0207639_10314643 3300026041 Bacteria 1388
242 Ga0207678_10000509 3300026067 Bacteria 35261
243 Ga0207678_10010598 3300026067 Bacteria 8099
244 Ga0207678_10191404 3300026067 Bacteria 1748
245 Ga0207678_10314530 3300026067 Bacteria 1347
246 Ga0207678_10750597 3300026067 Bacteria 860
247 Ga0207702_10103022 3300026078 Bacteria 2524
248 Ga0207641_10031489 3300026088 Bacteria 4399
249 Ga0207641_10053178 3300026088 Bacteria 3432
250 Ga0207641_10150920 3300026088 Bacteria 2104
251 Ga0207641_10339495 3300026088 Bacteria 1429
252 Ga0207648_10009809 3300026089 Bacteria 9146
253 Ga0207674_10016250 3300026116 Bacteria 8152
254 Ga0207674_10232446 3300026116 Bacteria 1791
255 Ga0207675_100026635 3300026118 Bacteria 5382
256 Ga0207683_10007139 3300026121 Bacteria 9575
257 Ga0207683_10234367 3300026121 Bacteria 1674
258 Ga0207698_10008130 3300026142 Bacteria 6612
259 Ga0207698_10080547 3300026142 Bacteria 2624
260 Ga0207698_10158727 3300026142 Bacteria 1975
261 Ga0268266_10000001 3300028379 Bacteria 4040580
262 Ga0268266_10000007 3300028379 Bacteria 1372921
263 Ga0268266_10000059 3300028379 Bacteria 269485
264 Ga0268266_10028032 3300028379 Bacteria 4788
265 Ga0268266_10603823 3300028379 Bacteria 1054
266 Ga0268265_10317407 3300028380 Bacteria 1410
267 Ga0268265_10540315 3300028380 Bacteria 1105
268 Ga0307509_10257733 3300031507 Bacteria 1522
269 Ga0307508_10004577 3300031616 Bacteria 13461
270 Ga0307412_10001041 3300031911 Bacteria 15843
271 Ga0307507_10132756 3300033179 Bacteria 1941
272 Ga0307510_10000112 3300033180 Bacteria 64759
273 Ga0373944_0059092 3300035089 Bacteria 1226
274 Ga0373937_0014408 3300036401 Bacteria 6981
275 Ga0436365_0055304 3300039437 Bacteria 3613
276 Ga0436365_1603528 3300039437 Bacteria 18850
277 Ga0439436_0000016 3300041404 Bacteria 80941
278 Ga0439465_0005618 3300041413 Bacteria 3994
279 Ga0451791_1693520 3300041451 Bacteria 865
280 Ga0451793_1385900 3300041452 Bacteria 752
281 Ga0451793_1427782 3300041452 Bacteria 2196
282 Ga0451807_0786114 3300041486 Bacteria 821
283 Ga0451843_0456557 3300041509 Bacteria 998
284 Ga0450908_000014 3300042184 Bacteria 41620
285 Ga0466972_0000803 3300044658 Bacteria 14935
286 Ga0466982_0000063 3300044672 Bacteria 29669
287 Ga0466970_0001477 3300044765 Bacteria 11357
288 Ga0466959_0100111 3300045049 Bacteria 2075
289 Ga0495617_000750 3300046452 Bacteria 15942
290 Ga0495638_0000078 3300046460 Bacteria 157545
291 Ga0495651_0243943 3300046462 Bacteria 1231
292 Ga0495650_0002172 3300046471 Bacteria 16594
293 Ga0495650_0032317 3300046471 Bacteria 2341
294 Ga0495584_0020240 3300046491 Bacteria 3382
295 Ga0495585_0000366 3300046492 Bacteria 43799
296 Ga0495585_0005846 3300046492 Bacteria 7714
297 Ga0495607_0000040 3300046501 Bacteria 133419
298 Ga0495607_0000140 3300046501 Bacteria 76410
299 Ga0495607_0004707 3300046501 Bacteria 9987
300 Ga0495583_0233076 3300046506 Bacteria 741
301 Ga0495606_0000479 3300046507 Bacteria 65601
302 Ga0495606_0001160 3300046507 Bacteria 37244
303 Ga0495606_0002054 3300046507 Bacteria 24650
304 Ga0495606_0013687 3300046507 Bacteria 6391
305 Ga0495606_0133536 3300046507 Bacteria 1473
306 Ga0495606_0237350 3300046507 Bacteria 1018
307 Ga0495610_0003265 3300046512 Bacteria 12790
308 Ga0495610_0016262 3300046512 Bacteria 4291
309 Ga0495616_0000045 3300046513 Bacteria 113226
310 Ga0495616_0002958 3300046513 Bacteria 11034
311 Ga0495620_0000141 3300046515 Bacteria 58744
312 Ga0495620_0033873 3300046515 Bacteria 2313
313 Ga0495630_0642237 3300046517 Bacteria 813
314 Ga0495631_0000025 3300046518 Bacteria 89262
315 Ga0495631_0000610 3300046518 Bacteria 23558
316 Ga0495632_0000016 3300046519 Bacteria 232022
317 Ga0495632_0020332 3300046519 Bacteria 3595
318 Ga0495632_0048020 3300046519 Bacteria 2115
319 Ga0495637_0007133 3300046520 Bacteria 5563
320 Ga0495648_0000508 3300046524 Bacteria 41940
321 Ga0495648_0010386 3300046524 Bacteria 7094
322 Ga0495665_0086751 3300046531 Bacteria 1645
323 Ga0495609_0038503 3300046538 Bacteria 2155
324 Ga0495668_0001459 3300046616 Bacteria 22747
325 Ga0495611_0000001 3300046648 Bacteria 2628469
326 Ga0495611_0000073 3300046648 Bacteria 70704
327 Ga0495611_0273092 3300046648 Bacteria 781
328 Ga0495625_0000041 3300046660 Bacteria 206598
329 Ga0495625_0044064 3300046660 Bacteria 3232
330 Ga0495625_0053333 3300046660 Bacteria 2892
331 Ga0495661_0003999 3300046665 Bacteria 10750
332 Ga0495661_0070294 3300046665 Bacteria 2049
333 Ga0495657_0096849 3300046675 Bacteria 1885
334 Ga0495623_0291386 3300046679 Bacteria 905
335 Ga0495647_0009554 3300046681 Bacteria 3288
336 Ga0495658_0009835 3300046683 Bacteria 4769
337 Ga0495670_0012908 3300046691 Bacteria 4106
338 Ga0495671_0000182 3300046692 Bacteria 55867
339 Ga0495649_0071236 3300046694 Bacteria 1863
340 Ga0495589_0000008 3300046794 Bacteria 266071
341 Ga0495660_0000149 3300046810 Bacteria 76124
342 Ga0495660_0000169 3300046810 Bacteria 70663
343 Ga0495604_0130984 3300047317 Bacteria 1803
344 Ga0495683_0004682 3300047323 Bacteria 7707
345 Ga0495679_000004 3300047446 Bacteria 748056
346 Ga0495673_0000004 3300047469 Bacteria 1354526
347 Ga0495673_0000278 3300047469 Bacteria 69367
348 Ga0495673_0001102 3300047469 Bacteria 23237
349 Ga0495686_0000017 3300047472 Bacteria 435554
350 Ga0495686_0001145 3300047472 Bacteria 31190
351 Ga0495686_0006922 3300047472 Bacteria 8576
352 Ga0495686_0067779 3300047472 Bacteria 2202
353 Ga0496100_0000429 3300048903 Bacteria 20428
354 Ga0496101_0104797 3300048904 Bacteria 2121
355 Ga0496102_0832589 3300048905 Bacteria 845
356 Ga0496104_0000005 3300048907 Bacteria 620360
357 Ga0496105_0000018 3300048908 Bacteria 197208
358 Ga0496106_0012978 3300048909 Bacteria 6147
359 Ga0496107_0113629 3300048910 Bacteria 1992
360 Ga0496107_0117999 3300048910 Bacteria 1954
361 Ga0496115_0000077 3300048918 Bacteria 89885
362 Ga0496116_0112929 3300048919 Bacteria 1591
363 Ga0496117_0070715 3300048920 Bacteria 2342
364 Ga0496117_0164409 3300048920 Bacteria 1296
365 Ga0496118_0000101 3300048921 Bacteria 159577
366 Ga0496118_0000968 3300048921 Bacteria 44862
367 Ga0496118_0001481 3300048921 Bacteria 35145
368 Ga0496118_0005672 3300048921 Bacteria 14071
369 Ga0496118_0008000 3300048921 Bacteria 11049
370 Ga0496118_0013028 3300048921 Bacteria 7910
371 Ga0496119_0016143 3300048922 Bacteria 5703
372 Ga0496119_0202641 3300048922 Bacteria 1026
373 Ga0496121_0000399 3300048924 Bacteria 86768
374 Ga0496121_0001549 3300048924 Bacteria 38481
375 Ga0496121_0003203 3300048924 Bacteria 23561
376 Ga0496121_0091462 3300048924 Bacteria 2375
377 Ga0496122_0000212 3300048925 Bacteria 129245
378 Ga0496122_0015259 3300048925 Bacteria 7351
379 Ga0496122_0016943 3300048925 Bacteria 6847
380 Ga0496122_0027254 3300048925 Bacteria 4890
381 Ga0496123_0001661 3300048926 Bacteria 29841
382 Ga0496123_0007351 3300048926 Bacteria 10427
383 Ga0496123_0011594 3300048926 Bacteria 7620
384 Ga0496123_0064734 3300048926 Bacteria 2328
385 Ga0496124_0000333 3300048927 Bacteria 87394
386 Ga0496124_0000364 3300048927 Bacteria 82831
387 Ga0496125_0019349 3300048928 Bacteria 6426
388 Ga0496125_0071239 3300048928 Bacteria 2717
389 Ga0496126_0000047 3300048929 Bacteria 322212
390 Ga0496126_0026665 3300048929 Bacteria 5537
391 Ga0495678_000612 3300049459 Bacteria 33460
392 Ga0495682_0002092 3300049460 Bacteria 9734
393 Ga0495682_0010132 3300049460 Bacteria 3659
394 Ga0501031_0005792 3300049568 Bacteria 8053
395 Ga0501032_0001989 3300049569 Bacteria 16094
396 Ga0501032_0002181 3300049569 Bacteria 15414
397 Ga0501032_0031454 3300049569 Bacteria 3639
398 Ga0501033_0000726 3300049570 Bacteria 30269
399 Ga0501033_0076403 3300049570 Bacteria 2458
400 Ga0501033_0368605 3300049570 Bacteria 1004
401 Ga0501034_0002127 3300049571 Bacteria 24610
402 Ga0501034_0005967 3300049571 Bacteria 13182
403 Ga0501034_0011585 3300049571 Bacteria 9131
404 Ga0501034_0153420 3300049571 Bacteria 2278
405 Ga0501034_0309300 3300049571 Bacteria 1515
406 Ga0501036_0001181 3300049572 Bacteria 19879
407 Ga0501036_0044373 3300049572 Bacteria 3765
408 Ga0501036_0081057 3300049572 Bacteria 2743
409 Ga0501037_0002533 3300049573 Bacteria 13200
410 Ga0501037_0004913 3300049573 Bacteria 9730
411 Ga0501037_0016570 3300049573 Bacteria 5423
412 Ga0501037_0201916 3300049573 Bacteria 1404
413 Ga0501038_0000880 3300049574 Bacteria 26600
414 Ga0501038_0003700 3300049574 Bacteria 14249
415 Ga0501038_0666225 3300049574 Bacteria 782
416 Ga0501039_0000356 3300049575 Bacteria 32594
417 Ga0501039_0010888 3300049575 Bacteria 6933
418 Ga0501039_0053413 3300049575 Bacteria 3126
419 Ga0501043_0011840 3300049579 Bacteria 6833
420 Ga0501043_0053042 3300049579 Bacteria 3184
421 Ga0501043_0167664 3300049579 Bacteria 1714
422 Ga0501046_0005829 3300049580 Bacteria 10986
423 Ga0501046_0013949 3300049580 Bacteria 6788
424 Ga0501047_0001556 3300049581 Bacteria 22458
425 Ga0501047_0013608 3300049581 Bacteria 7717
426 Ga0501047_0018052 3300049581 Bacteria 6760
427 Ga0501047_0103721 3300049581 Bacteria 2724
428 Ga0501048_0004330 3300049582 Bacteria 10813
429 Ga0501068_0042566 3300049584 Bacteria 2731
430 Ga0501069_0002373 3300049585 Bacteria 9550
431 Ga0501070_0003423 3300049586 Bacteria 13763
432 Ga0501070_0026241 3300049586 Bacteria 4890
433 Ga0501070_0096158 3300049586 Bacteria 2450
434 Ga0501070_0486284 3300049586 Bacteria 992
435 Ga0501070_0642911 3300049586 Bacteria 843
436 Ga0501071_0009387 3300049587 Bacteria 6514
437 Ga0501071_0017978 3300049587 Bacteria 4889
438 Ga0501073_0010612 3300049589 Bacteria 6740
439 Ga0501073_0197707 3300049589 Bacteria 1390
440 Ga0501074_0008743 3300049590 Bacteria 7341
441 Ga0501074_0066791 3300049590 Bacteria 2586
442 Ga0501079_0027128 3300049741 Bacteria 4390
443 Ga0501080_0003950 3300049742 Bacteria 13129
444 Ga0501080_0005250 3300049742 Bacteria 11540
445 Ga0501080_0046765 3300049742 Bacteria 4028
446 Ga0501083_0006387 3300049744 Bacteria 8355
447 Ga0501035_0000788 3300049822 Bacteria 33923
448 Ga0501035_0005913 3300049822 Bacteria 11519
449 Ga0501035_0008269 3300049822 Bacteria 9695
450 Ga0501035_0009770 3300049822 Bacteria 8914
451 Ga0501044_0001348 3300049823 Bacteria 28861
452 Ga0501044_0002789 3300049823 Bacteria 19900
453 Ga0501044_0004889 3300049823 Bacteria 14973
454 Ga0501044_0017117 3300049823 Bacteria 7779
455 Ga0501044_0018306 3300049823 Bacteria 7506
456 Ga0501044_0052543 3300049823 Bacteria 4198
457 nmdc:mga09592_699002_c1 3300050508 Bacteria 863
458 nmdc:mga0n895_273998_c1 3300050512 Bacteria 1711
459 Ga0500643_000020 3300053087 Bacteria 290328
460 Ga0500643_001707 3300053087 Bacteria 12199
461 Ga0500651_0000367 3300053093 Bacteria 24844
462 Ga0500651_0001150 3300053093 Bacteria 13107
463 Ga0500555_001654 3300053103 Bacteria 6734
464 Ga0500597_000041 3300053120 Bacteria 25106
465 Ga0500628_000128 3300053129 Bacteria 15297
466 Ga0500568_0002290 3300053139 Bacteria 11396
467 Ga0500616_0028816 3300053153 Bacteria 3058
468 Ga0500645_000617 3300053730 Bacteria 22792
469 Ga0500661_002705 3300055283 Bacteria 3351
470 Ga0501082_0001878 3300060353 Bacteria 18489
471 Ga0501082_0188085 3300060353 Bacteria 1796
472 Ga0530510_0343599 3300061734 Bacteria 1120

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10013703 Ga0207689_100137037 204
2 3300005548 Ga0070665_100027016 Ga0070665_1000270162 206
3 3300005327 Ga0070658_10016979 Ga0070658_100169797 209
4 3300005335 Ga0070666_10000013 Ga0070666_10000013150 209
5 3300005347 Ga0070668_100448930 Ga0070668_1004489301 209
6 3300005547 Ga0070693_100133740 Ga0070693_1001337402 209
7 3300005548 Ga0070665_100024119 Ga0070665_1000241195 209
8 3300009551 Ga0105238_10000477 Ga0105238_1000047719 209
9 3300013306 Ga0163162_10000508 Ga0163162_1000050819 209
10 3300025903 Ga0207680_10000001 Ga0207680_10000001233 209
11 3300025909 Ga0207705_10013746 Ga0207705_100137462 209
12 3300025920 Ga0207649_10069415 Ga0207649_100694153 209
13 3300025924 Ga0207694_10000168 Ga0207694_1000016854 209
14 3300028379 Ga0268266_10000059 Ga0268266_1000005927 209
15 3300048922 Ga0496119_0202641 Ga0496119_0202641_300_983 209
16 3300048928 Ga0496125_0071239 Ga0496125_0071239_1736_2419 209
17 3300048929 Ga0496126_0026665 Ga0496126_0026665_4018_4701 209
18 3300005330 Ga0070690_100040039 Ga0070690_1000400393 210
19 3300005331 Ga0070670_100554078 Ga0070670_1005540782 210
20 3300005334 Ga0068869_100147545 Ga0068869_1001475452 210
21 3300005335 Ga0070666_10143803 Ga0070666_101438032 210
22 3300005539 Ga0068853_100102310 Ga0068853_1001023102 210
23 3300006358 Ga0068871_100031951 Ga0068871_1000319513 210
24 3300006871 Ga0075434_100287852 Ga0075434_1002878522 210
25 3300006881 Ga0068865_100003536 Ga0068865_1000035362 210
26 3300013296 Ga0157374_10129747 Ga0157374_101297472 210
27 3300013306 Ga0163162_10255162 Ga0163162_102551622 210
28 3300013308 Ga0157375_10002238 Ga0157375_100022386 210
29 3300025903 Ga0207680_10305551 Ga0207680_103055512 210
30 3300025925 Ga0207650_10306131 Ga0207650_103061312 210
31 3300025938 Ga0207704_10003301 Ga0207704_100033015 210
32 3300025949 Ga0207667_10509101 Ga0207667_105091012 210
33 3300026088 Ga0207641_10031489 Ga0207641_100314894 210
34 3300026121 Ga0207683_10234367 Ga0207683_102343671 210
35 3300028379 Ga0268266_10603823 Ga0268266_106038231 210
36 3300046462 Ga0495651_0243943 Ga0495651_0243943_335_1024 210
37 3300046675 Ga0495657_0096849 Ga0495657_0096849_608_1297 210
38 3300050512 nmdc:mga0n895_273998_c1 nmdc:mga0n895_273998_c1_747_1433 210
39 3300025916 Ga0207663_10307565 Ga0207663_103075652 211
40 3300025903 Ga0207680_10020123 Ga0207680_100201232 212
41 3300025933 Ga0207706_10090769 Ga0207706_100907692 212
42 3300026041 Ga0207639_10196436 Ga0207639_101964363 212
43 3300026089 Ga0207648_10009809 Ga0207648_100098096 212
44 3300014497 Ga0182008_10138327 Ga0182008_101383272 213
45 3300048927 Ga0496124_0000364 Ga0496124_0000364_37894_38580 214
46 iso_pu_bacteria 2593339238 2595446980 214
47 iso_pu_bacteria 2593339239 2595449738 214
48 iso_pu_bacteria 2734482264 2735833670 214
49 3300048927 Ga0496124_0000333 Ga0496124_0000333_44685_45371 215
50 3300003578 Ga0006562J51391_1029719 Ga0006562J51391_10297192 218
51 3300003578 Ga0006562J51391_1029721 Ga0006562J51391_10297213 218
52 3300004625 Ga0055543_1011650 Ga0055543_10116502 218
53 3300005262 Ga0065165_1000700 Ga0065165_100070023 218
54 3300006186 Ga0075369_10015312 Ga0075369_100153122 218
55 3300017792 Ga0163161_10052230 Ga0163161_100522302 218
56 3300025226 Ga0209674_100642 Ga0209674_1006427 218
57 3300025233 Ga0209437_100605 Ga0209437_10060518 218
58 3300025254 Ga0209148_1003616 Ga0209148_10036163 218
59 3300025299 Ga0209256_1003092 Ga0209256_100309214 218
60 3300025302 Ga0207426_1035747 Ga0207426_10357472 218
61 3300025303 Ga0209051_1032712 Ga0209051_10327123 218
62 3300025900 Ga0207710_10025248 Ga0207710_100252483 218
63 3300025904 Ga0207647_10001812 Ga0207647_100018127 218
64 3300046506 Ga0495583_0233076 Ga0495583_0233076_24_680 218
65 3300046507 Ga0495606_0133536 Ga0495606_0133536_34_690 218
66 3300046616 Ga0495668_0001459 Ga0495668_0001459_10623_11279 218
67 3300046665 Ga0495661_0070294 Ga0495661_0070294_60_716 218
68 3300046810 Ga0495660_0000169 Ga0495660_0000169_30374_31030 218
69 3300047469 Ga0495673_0000004 Ga0495673_0000004_308235_308891 218
70 3300047469 Ga0495673_0001102 Ga0495673_0001102_14871_15527 218
71 3300048910 Ga0496107_0113629 Ga0496107_0113629_404_1060 218
72 3300048924 Ga0496121_0001549 Ga0496121_0001549_30385_31041 218
73 3300005842 Ga0068858_100806365 Ga0068858_1008063652 219
74 3300025907 Ga0207645_10063518 Ga0207645_100635182 219
75 3300026023 Ga0207677_10285675 Ga0207677_102856752 219
76 3300005539 Ga0068853_100015974 Ga0068853_1000159743 220
77 3300005577 Ga0068857_100062054 Ga0068857_1000620542 220
78 3300005617 Ga0068859_100373281 Ga0068859_1003732812 220
79 3300005719 Ga0068861_100521932 Ga0068861_1005219322 220
80 3300005842 Ga0068858_100102276 Ga0068858_1001022763 220
81 3300006846 Ga0075430_100803708 Ga0075430_1008037081 220
82 3300006880 Ga0075429_100467430 Ga0075429_1004674302 220
83 3300006931 Ga0097620_100373273 Ga0097620_1003732732 220
84 3300009094 Ga0111539_10042207 Ga0111539_100422076 220
85 3300014969 Ga0157376_10022486 Ga0157376_100224862 220
86 3300025303 Ga0209051_1016130 Ga0209051_10161302 220
87 3300025920 Ga0207649_10083179 Ga0207649_100831792 220
88 3300026035 Ga0207703_10080812 Ga0207703_100808123 220
89 3300026041 Ga0207639_10041871 Ga0207639_100418713 220
90 3300026116 Ga0207674_10016250 Ga0207674_100162503 220
91 3300048918 Ga0496115_0000077 Ga0496115_0000077_5359_6096 220
92 3300048929 Ga0496126_0000047 Ga0496126_0000047_288486_289223 220
93 3300050508 nmdc:mga09592_699002_c1 nmdc:mga09592_699002_c1_107_814 220
94 3300053153 Ga0500616_0028816 Ga0500616_0028816_481_1143 220
95 3300005331 Ga0070670_100268021 Ga0070670_1002680212 221
96 3300005335 Ga0070666_10158635 Ga0070666_101586352 221
97 3300005719 Ga0068861_100018011 Ga0068861_1000180115 221
98 3300009093 Ga0105240_10693671 Ga0105240_106936712 221
99 3300026118 Ga0207675_100026635 Ga0207675_1000266352 221
100 3300049569 Ga0501032_0031454 Ga0501032_0031454_1275_1952 221
101 3300049571 Ga0501034_0153420 Ga0501034_0153420_573_1247 221
102 3300049571 Ga0501034_0309300 Ga0501034_0309300_225_902 221
103 3300049573 Ga0501037_0016570 Ga0501037_0016570_3844_4518 221
104 3300049579 Ga0501043_0167664 Ga0501043_0167664_399_1073 221
105 3300049581 Ga0501047_0001556 Ga0501047_0001556_1772_2449 221
106 3300049581 Ga0501047_0103721 Ga0501047_0103721_1743_2417 221
107 3300049822 Ga0501035_0000788 Ga0501035_0000788_20444_21121 221
108 3300049823 Ga0501044_0001348 Ga0501044_0001348_10080_10757 221
109 3300049823 Ga0501044_0052543 Ga0501044_0052543_3497_4171 221
110 3300053129 Ga0500628_000128 Ga0500628_000128_14486_15166 221
111 3300005330 Ga0070690_100068676 Ga0070690_1000686762 224
112 3300049742 Ga0501080_0003950 Ga0501080_0003950_8308_9003 224
113 iso_pu_bacteria 2818991440 2819564119 224
114 iso_pu_bacteria 2842914999 2842917672 224
115 iso_pu_bacteria 2842918807 2842920046 224
116 iso_pu_bacteria 2884338543 2884341658 224
117 iso_pu_bacteria 2904463128 2904464755 224
118 iso_pu_bacteria 2919085039 2919088157 224
119 iso_pu_bacteria 2919404418 2919406269 224
120 iso_pu_bacteria 2941471342 2941473068 224
121 iso_pu_bacteria 2953994433 2953995335 224
122 3300009147 Ga0114129_10489881 Ga0114129_104898812 225
123 3300026067 Ga0207678_10750597 Ga0207678_107505971 225
124 3300005539 Ga0068853_100021188 Ga0068853_1000211887 226
125 3300005539 Ga0068853_100849248 Ga0068853_1008492481 226
126 3300005577 Ga0068857_100085866 Ga0068857_1000858662 226
127 3300009093 Ga0105240_10000026 Ga0105240_10000026121 226
128 3300013100 Ga0157373_10367864 Ga0157373_103678642 226
129 3300013306 Ga0163162_10620860 Ga0163162_106208602 226
130 3300013307 Ga0157372_10048685 Ga0157372_100486854 226
131 3300025913 Ga0207695_10000246 Ga0207695_1000024611 226
132 3300025916 Ga0207663_10423630 Ga0207663_104236302 226
133 3300026041 Ga0207639_10314643 Ga0207639_103146431 226
134 3300049574 Ga0501038_0666225 Ga0501038_0666225_50_733 226
135 3300049586 Ga0501070_0003423 Ga0501070_0003423_849_1529 226
136 3300049586 Ga0501070_0096158 Ga0501070_0096158_366_1046 226
137 3300049742 Ga0501080_0046765 Ga0501080_0046765_764_1444 226
138 3300049823 Ga0501044_0017117 Ga0501044_0017117_5217_5981 226
139 3300005327 Ga0070658_10000030 Ga0070658_100000308 227
140 3300005327 Ga0070658_10017986 Ga0070658_100179862 227
141 3300005331 Ga0070670_100016193 Ga0070670_1000161935 227
142 3300005335 Ga0070666_10029472 Ga0070666_100294726 227
143 3300005367 Ga0070667_100024620 Ga0070667_1000246204 227
144 3300005455 Ga0070663_100129402 Ga0070663_1001294022 227
145 3300005539 Ga0068853_100060062 Ga0068853_1000600622 227
146 3300005548 Ga0070665_100015547 Ga0070665_1000155472 227
147 3300005578 Ga0068854_100096651 Ga0068854_1000966512 227
148 3300005842 Ga0068858_100008109 Ga0068858_1000081094 227
149 3300009093 Ga0105240_10018536 Ga0105240_100185365 227
150 3300009545 Ga0105237_10278720 Ga0105237_102787201 227
151 3300009551 Ga0105238_10050628 Ga0105238_100506282 227
152 3300013105 Ga0157369_10095262 Ga0157369_100952622 227
153 3300025903 Ga0207680_10099671 Ga0207680_100996712 227
154 3300025904 Ga0207647_10000277 Ga0207647_100002778 227
155 3300025909 Ga0207705_10048171 Ga0207705_100481712 227
156 3300025913 Ga0207695_10058579 Ga0207695_100585795 227
157 3300025914 Ga0207671_10162401 Ga0207671_101624012 227
158 3300025924 Ga0207694_10013947 Ga0207694_100139473 227
159 3300025925 Ga0207650_10005452 Ga0207650_100054523 227
160 3300025961 Ga0207712_10000168 Ga0207712_1000016812 227
161 3300026035 Ga0207703_10001197 Ga0207703_100011974 227
162 3300026041 Ga0207639_10000066 Ga0207639_1000006662 227
163 3300026067 Ga0207678_10010598 Ga0207678_100105986 227
164 3300026088 Ga0207641_10339495 Ga0207641_103394952 227
165 3300026142 Ga0207698_10158727 Ga0207698_101587272 227
166 3300028379 Ga0268266_10000007 Ga0268266_10000007232 227
167 3300033180 Ga0307510_10000112 Ga0307510_1000011219 227
168 3300046471 Ga0495650_0002172 Ga0495650_0002172_2314_2997 227
169 3300046660 Ga0495625_0044064 Ga0495625_0044064_1161_1844 227
170 3300048921 Ga0496118_0008000 Ga0496118_0008000_10202_10915 227
171 3300001904 JGI24736J21556_1000453 JGI24736J21556_10004538 228
172 3300005334 Ga0068869_100004014 Ga0068869_1000040142 228
173 3300005335 Ga0070666_10000388 Ga0070666_1000038833 228
174 3300005338 Ga0068868_100006334 Ga0068868_1000063342 228
175 3300005347 Ga0070668_100159482 Ga0070668_1001594822 228
176 3300005353 Ga0070669_100018696 Ga0070669_1000186962 228
177 3300005354 Ga0070675_100028948 Ga0070675_1000289483 228
178 3300005364 Ga0070673_100052657 Ga0070673_1000526572 228
179 3300005364 Ga0070673_100059292 Ga0070673_1000592921 228
180 3300005367 Ga0070667_100000065 Ga0070667_10000006524 228
181 3300005367 Ga0070667_100046354 Ga0070667_1000463542 228
182 3300005367 Ga0070667_100120737 Ga0070667_1001207372 228
183 3300005439 Ga0070711_100398892 Ga0070711_1003988922 228
184 3300005455 Ga0070663_100000317 Ga0070663_1000003173 228
185 3300005455 Ga0070663_100170008 Ga0070663_1001700083 228
186 3300005455 Ga0070663_100293097 Ga0070663_1002930972 228
187 3300005456 Ga0070678_100662130 Ga0070678_1006621301 228
188 3300005457 Ga0070662_100275150 Ga0070662_1002751502 228
189 3300005459 Ga0068867_100054593 Ga0068867_1000545932 228
190 3300005466 Ga0070685_10001421 Ga0070685_100014212 228
191 3300005539 Ga0068853_100001386 Ga0068853_1000013869 228
192 3300005539 Ga0068853_100008885 Ga0068853_1000088852 228
193 3300005539 Ga0068853_100014323 Ga0068853_1000143233 228
194 3300005539 Ga0068853_100087598 Ga0068853_1000875982 228
195 3300005539 Ga0068853_100100308 Ga0068853_1001003082 228
196 3300005543 Ga0070672_100024063 Ga0070672_1000240633 228
197 3300005548 Ga0070665_100000211 Ga0070665_1000002117 228
198 3300005548 Ga0070665_100003692 Ga0070665_10000369212 228
199 3300005548 Ga0070665_100009766 Ga0070665_1000097662 228
200 3300005548 Ga0070665_100086019 Ga0070665_1000860192 228
201 3300005548 Ga0070665_100170654 Ga0070665_1001706543 228
202 3300005563 Ga0068855_100006125 Ga0068855_1000061258 228
203 3300005563 Ga0068855_100045303 Ga0068855_1000453032 228
204 3300005563 Ga0068855_100205833 Ga0068855_1002058332 228
205 3300005563 Ga0068855_100896479 Ga0068855_1008964791 228
206 3300005578 Ga0068854_100079193 Ga0068854_1000791932 228
207 3300005614 Ga0068856_100017618 Ga0068856_1000176182 228
208 3300005616 Ga0068852_100037755 Ga0068852_1000377552 228
209 3300005617 Ga0068859_100095929 Ga0068859_1000959293 228
210 3300005840 Ga0068870_10003680 Ga0068870_100036802 228
211 3300005841 Ga0068863_100124098 Ga0068863_1001240983 228
212 3300006358 Ga0068871_100067585 Ga0068871_1000675852 228
213 3300006881 Ga0068865_100011005 Ga0068865_1000110052 228
214 3300006881 Ga0068865_100045770 Ga0068865_1000457702 228
215 3300006931 Ga0097620_100095931 Ga0097620_1000959313 228
216 3300009093 Ga0105240_10000685 Ga0105240_1000068519 228
217 3300009093 Ga0105240_10051039 Ga0105240_100510394 228
218 3300009098 Ga0105245_10369991 Ga0105245_103699912 228
219 3300009101 Ga0105247_10004486 Ga0105247_100044868 228
220 3300009174 Ga0105241_10002302 Ga0105241_100023028 228
221 3300009176 Ga0105242_10002451 Ga0105242_100024512 228
222 3300009177 Ga0105248_10005666 Ga0105248_1000566613 228
223 3300009545 Ga0105237_10004639 Ga0105237_1000463910 228
224 3300009545 Ga0105237_10012010 Ga0105237_100120102 228
225 3300009545 Ga0105237_10013243 Ga0105237_100132434 228
226 3300009545 Ga0105237_10193615 Ga0105237_101936154 228
227 3300009551 Ga0105238_10000928 Ga0105238_1000092817 228
228 3300009551 Ga0105238_10035800 Ga0105238_100358004 228
229 3300009551 Ga0105238_10051952 Ga0105238_100519525 228
230 3300009551 Ga0105238_10060532 Ga0105238_100605322 228
231 3300009551 Ga0105238_10388029 Ga0105238_103880292 228
232 3300009553 Ga0105249_10000367 Ga0105249_1000036710 228
233 3300009553 Ga0105249_10035185 Ga0105249_100351853 228
234 3300010375 Ga0105239_10015277 Ga0105239_100152773 228
235 3300010375 Ga0105239_10107457 Ga0105239_101074573 228
236 3300010375 Ga0105239_10230640 Ga0105239_102306403 228
237 3300010375 Ga0105239_10369404 Ga0105239_103694042 228
238 3300010375 Ga0105239_10580125 Ga0105239_105801252 228
239 3300011119 Ga0105246_10291030 Ga0105246_102910302 228
240 3300013104 Ga0157370_10003809 Ga0157370_1000380910 228
241 3300013104 Ga0157370_10008099 Ga0157370_100080999 228
242 3300013104 Ga0157370_10223213 Ga0157370_102232132 228
243 3300013105 Ga0157369_10000011 Ga0157369_1000001121 228
244 3300013105 Ga0157369_10000529 Ga0157369_1000052918 228
245 3300013296 Ga0157374_10013357 Ga0157374_100133573 228
246 3300013297 Ga0157378_10000018 Ga0157378_1000001846 228
247 3300013306 Ga0163162_10000061 Ga0163162_1000006174 228
248 3300013306 Ga0163162_10210798 Ga0163162_102107982 228
249 3300013306 Ga0163162_10733689 Ga0163162_107336892 228
250 3300013308 Ga0157375_10000144 Ga0157375_1000014423 228
251 3300014968 Ga0157379_10091642 Ga0157379_100916422 228
252 3300014969 Ga0157376_10004137 Ga0157376_100041373 228
253 3300014969 Ga0157376_10459529 Ga0157376_104595292 228
254 3300015261 Ga0182006_1000093 Ga0182006_100009340 228
255 3300015261 Ga0182006_1000416 Ga0182006_100041621 228
256 3300015262 Ga0182007_10002081 Ga0182007_1000208110 228
257 3300015265 Ga0182005_1000536 Ga0182005_100053610 228
258 3300015265 Ga0182005_1001172 Ga0182005_100117212 228
259 3300015265 Ga0182005_1022246 Ga0182005_10222462 228
260 3300021384 Ga0213876_10002499 Ga0213876_100024992 228
261 3300025258 Ga0209129_1000439 Ga0209129_100043927 228
262 3300025297 Ga0209758_1009460 Ga0209758_10094602 228
263 3300025903 Ga0207680_10000227 Ga0207680_100002277 228
264 3300025903 Ga0207680_10250703 Ga0207680_102507032 228
265 3300025903 Ga0207680_10318011 Ga0207680_103180112 228
266 3300025907 Ga0207645_10014002 Ga0207645_100140022 228
267 3300025909 Ga0207705_10001065 Ga0207705_1000106515 228
268 3300025909 Ga0207705_10035889 Ga0207705_100358892 228
269 3300025911 Ga0207654_10003118 Ga0207654_100031182 228
270 3300025911 Ga0207654_10169230 Ga0207654_101692301 228
271 3300025913 Ga0207695_10000007 Ga0207695_10000007401 228
272 3300025913 Ga0207695_10000809 Ga0207695_100008098 228
273 3300025913 Ga0207695_10001826 Ga0207695_1000182628 228
274 3300025913 Ga0207695_10803297 Ga0207695_108032971 228
275 3300025914 Ga0207671_10001898 Ga0207671_1000189812 228
276 3300025914 Ga0207671_10004252 Ga0207671_100042527 228
277 3300025914 Ga0207671_10008015 Ga0207671_100080152 228
278 3300025920 Ga0207649_10036484 Ga0207649_100364842 228
279 3300025920 Ga0207649_10096913 Ga0207649_100969132 228
280 3300025923 Ga0207681_10021076 Ga0207681_100210762 228
281 3300025924 Ga0207694_10004923 Ga0207694_100049232 228
282 3300025924 Ga0207694_10085039 Ga0207694_100850393 228
283 3300025924 Ga0207694_10184229 Ga0207694_101842292 228
284 3300025925 Ga0207650_10129103 Ga0207650_101291033 228
285 3300025925 Ga0207650_10533802 Ga0207650_105338022 228
286 3300025926 Ga0207659_10029802 Ga0207659_100298023 228
287 3300025927 Ga0207687_10339801 Ga0207687_103398012 228
288 3300025938 Ga0207704_10041613 Ga0207704_100416132 228
289 3300025938 Ga0207704_10059539 Ga0207704_100595392 228
290 3300025940 Ga0207691_10004583 Ga0207691_100045833 228
291 3300025942 Ga0207689_10025606 Ga0207689_100256063 228
292 3300025949 Ga0207667_10355794 Ga0207667_103557942 228
293 3300025949 Ga0207667_10768453 Ga0207667_107684531 228
294 3300025960 Ga0207651_10103465 Ga0207651_101034652 228
295 3300025961 Ga0207712_10000107 Ga0207712_1000010781 228
296 3300025961 Ga0207712_10150019 Ga0207712_101500192 228
297 3300025972 Ga0207668_10232882 Ga0207668_102328822 228
298 3300025981 Ga0207640_10098380 Ga0207640_100983802 228
299 3300025986 Ga0207658_10000420 Ga0207658_1000042021 228
300 3300025986 Ga0207658_10033504 Ga0207658_100335044 228
301 3300025986 Ga0207658_10034639 Ga0207658_100346392 228
302 3300025986 Ga0207658_10269166 Ga0207658_102691662 228
303 3300026023 Ga0207677_10303783 Ga0207677_103037832 228
304 3300026035 Ga0207703_10291862 Ga0207703_102918622 228
305 3300026041 Ga0207639_10002444 Ga0207639_100024446 228
306 3300026041 Ga0207639_10003762 Ga0207639_100037623 228
307 3300026041 Ga0207639_10004612 Ga0207639_100046122 228
308 3300026067 Ga0207678_10000509 Ga0207678_1000050921 228
309 3300026067 Ga0207678_10191404 Ga0207678_101914043 228
310 3300026067 Ga0207678_10314530 Ga0207678_103145302 228
311 3300026078 Ga0207702_10103022 Ga0207702_101030222 228
312 3300026088 Ga0207641_10053178 Ga0207641_100531782 228
313 3300026088 Ga0207641_10150920 Ga0207641_101509202 228
314 3300026116 Ga0207674_10232446 Ga0207674_102324462 228
315 3300026121 Ga0207683_10007139 Ga0207683_100071392 228
316 3300026142 Ga0207698_10008130 Ga0207698_100081303 228
317 3300026142 Ga0207698_10080547 Ga0207698_100805473 228
318 3300028379 Ga0268266_10000001 Ga0268266_100000012039 228
319 3300028379 Ga0268266_10028032 Ga0268266_100280322 228
320 3300028380 Ga0268265_10317407 Ga0268265_103174072 228
321 3300028380 Ga0268265_10540315 Ga0268265_105403152 228
322 3300031507 Ga0307509_10257733 Ga0307509_102577332 228
323 3300031616 Ga0307508_10004577 Ga0307508_100045774 228
324 3300031911 Ga0307412_10001041 Ga0307412_1000104114 228
325 3300033179 Ga0307507_10132756 Ga0307507_101327563 228
326 3300035089 Ga0373944_0059092 Ga0373944_0059092_291_995 228
327 3300036401 Ga0373937_0014408 Ga0373937_0014408_1181_1873 228
328 3300039437 Ga0436365_0055304 Ga0436365_0055304_2158_2880 228
329 3300039437 Ga0436365_1603528 Ga0436365_1603528_8644_9399 228
330 3300041404 Ga0439436_0000016 Ga0439436_0000016_42765_43451 228
331 3300041413 Ga0439465_0005618 Ga0439465_0005618_2584_3270 228
332 3300041451 Ga0451791_1693520 Ga0451791_1693520_22_711 228
333 3300041452 Ga0451793_1385900 Ga0451793_1385900_17_706 228
334 3300041452 Ga0451793_1427782 Ga0451793_1427782_1320_2009 228
335 3300041486 Ga0451807_0786114 Ga0451807_0786114_18_710 228
336 3300041509 Ga0451843_0456557 Ga0451843_0456557_146_835 228
337 3300042184 Ga0450908_000014 Ga0450908_000014_21642_22328 228
338 3300044658 Ga0466972_0000803 Ga0466972_0000803_10488_11177 228
339 3300044672 Ga0466982_0000063 Ga0466982_0000063_9002_9688 228
340 3300044765 Ga0466970_0001477 Ga0466970_0001477_117_806 228
341 3300045049 Ga0466959_0100111 Ga0466959_0100111_746_1435 228
342 3300046452 Ga0495617_000750 Ga0495617_000750_2405_3091 228
343 3300046460 Ga0495638_0000078 Ga0495638_0000078_39634_40320 228
344 3300046471 Ga0495650_0032317 Ga0495650_0032317_1618_2304 228
345 3300046491 Ga0495584_0020240 Ga0495584_0020240_2308_2994 228
346 3300046492 Ga0495585_0000366 Ga0495585_0000366_31703_32389 228
347 3300046492 Ga0495585_0005846 Ga0495585_0005846_6509_7195 228
348 3300046501 Ga0495607_0000040 Ga0495607_0000040_41046_41732 228
349 3300046501 Ga0495607_0000140 Ga0495607_0000140_31547_32233 228
350 3300046501 Ga0495607_0004707 Ga0495607_0004707_5895_6581 228
351 3300046507 Ga0495606_0000479 Ga0495606_0000479_31280_31966 228
352 3300046507 Ga0495606_0001160 Ga0495606_0001160_33483_34169 228
353 3300046507 Ga0495606_0002054 Ga0495606_0002054_18710_19396 228
354 3300046507 Ga0495606_0013687 Ga0495606_0013687_5384_6070 228
355 3300046507 Ga0495606_0237350 Ga0495606_0237350_75_761 228
356 3300046512 Ga0495610_0003265 Ga0495610_0003265_6879_7565 228
357 3300046512 Ga0495610_0016262 Ga0495610_0016262_3054_3740 228
358 3300046513 Ga0495616_0000045 Ga0495616_0000045_104950_105636 228
359 3300046513 Ga0495616_0002958 Ga0495616_0002958_2979_3665 228
360 3300046515 Ga0495620_0000141 Ga0495620_0000141_26266_26952 228
361 3300046515 Ga0495620_0033873 Ga0495620_0033873_1204_1890 228
362 3300046517 Ga0495630_0642237 Ga0495630_0642237_35_739 228
363 3300046518 Ga0495631_0000025 Ga0495631_0000025_83631_84317 228
364 3300046518 Ga0495631_0000610 Ga0495631_0000610_4431_5117 228
365 3300046519 Ga0495632_0000016 Ga0495632_0000016_46547_47233 228
366 3300046519 Ga0495632_0020332 Ga0495632_0020332_1730_2416 228
367 3300046519 Ga0495632_0048020 Ga0495632_0048020_1092_1778 228
368 3300046520 Ga0495637_0007133 Ga0495637_0007133_1281_1967 228
369 3300046524 Ga0495648_0000508 Ga0495648_0000508_11633_12319 228
370 3300046524 Ga0495648_0010386 Ga0495648_0010386_2902_3588 228
371 3300046531 Ga0495665_0086751 Ga0495665_0086751_711_1415 228
372 3300046538 Ga0495609_0038503 Ga0495609_0038503_922_1608 228
373 3300046648 Ga0495611_0000001 Ga0495611_0000001_2366176_2366862 228
374 3300046648 Ga0495611_0000073 Ga0495611_0000073_30156_30842 228
375 3300046648 Ga0495611_0273092 Ga0495611_0273092_58_744 228
376 3300046660 Ga0495625_0000041 Ga0495625_0000041_46724_47410 228
377 3300046660 Ga0495625_0053333 Ga0495625_0053333_189_875 228
378 3300046665 Ga0495661_0003999 Ga0495661_0003999_9636_10322 228
379 3300046679 Ga0495623_0291386 Ga0495623_0291386_31_723 228
380 3300046681 Ga0495647_0009554 Ga0495647_0009554_363_1067 228
381 3300046683 Ga0495658_0009835 Ga0495658_0009835_2814_3518 228
382 3300046691 Ga0495670_0012908 Ga0495670_0012908_2217_2903 228
383 3300046692 Ga0495671_0000182 Ga0495671_0000182_15590_16276 228
384 3300046694 Ga0495649_0071236 Ga0495649_0071236_578_1264 228
385 3300046794 Ga0495589_0000008 Ga0495589_0000008_255174_255860 228
386 3300046810 Ga0495660_0000149 Ga0495660_0000149_29622_30308 228
387 3300047317 Ga0495604_0130984 Ga0495604_0130984_823_1515 228
388 3300047323 Ga0495683_0004682 Ga0495683_0004682_5350_6036 228
389 3300047446 Ga0495679_000004 Ga0495679_000004_476948_477634 228
390 3300047469 Ga0495673_0000278 Ga0495673_0000278_31799_32485 228
391 3300047472 Ga0495686_0000017 Ga0495686_0000017_391802_392488 228
392 3300047472 Ga0495686_0001145 Ga0495686_0001145_29726_30412 228
393 3300047472 Ga0495686_0006922 Ga0495686_0006922_7434_8120 228
394 3300047472 Ga0495686_0067779 Ga0495686_0067779_1196_1882 228
395 3300048903 Ga0496100_0000429 Ga0496100_0000429_9981_10667 228
396 3300048904 Ga0496101_0104797 Ga0496101_0104797_1185_1871 228
397 3300048905 Ga0496102_0832589 Ga0496102_0832589_79_765 228
398 3300048907 Ga0496104_0000005 Ga0496104_0000005_530660_531364 228
399 3300048908 Ga0496105_0000018 Ga0496105_0000018_85061_85765 228
400 3300048909 Ga0496106_0012978 Ga0496106_0012978_203_889 228
401 3300048910 Ga0496107_0117999 Ga0496107_0117999_592_1281 228
402 3300048919 Ga0496116_0112929 Ga0496116_0112929_289_975 228
403 3300048920 Ga0496117_0070715 Ga0496117_0070715_657_1343 228
404 3300048920 Ga0496117_0164409 Ga0496117_0164409_35_727 228
405 3300048921 Ga0496118_0000101 Ga0496118_0000101_29844_30533 228
406 3300048921 Ga0496118_0000968 Ga0496118_0000968_43169_43855 228
407 3300048921 Ga0496118_0001481 Ga0496118_0001481_6960_7646 228
408 3300048921 Ga0496118_0005672 Ga0496118_0005672_10693_11382 228
409 3300048921 Ga0496118_0013028 Ga0496118_0013028_1158_1850 228
410 3300048922 Ga0496119_0016143 Ga0496119_0016143_2941_3627 228
411 3300048924 Ga0496121_0000399 Ga0496121_0000399_79191_79877 228
412 3300048924 Ga0496121_0003203 Ga0496121_0003203_13087_13773 228
413 3300048924 Ga0496121_0091462 Ga0496121_0091462_436_1122 228
414 3300048925 Ga0496122_0000212 Ga0496122_0000212_91567_92256 228
415 3300048925 Ga0496122_0015259 Ga0496122_0015259_2338_3024 228
416 3300048925 Ga0496122_0016943 Ga0496122_0016943_1815_2501 228
417 3300048925 Ga0496122_0027254 Ga0496122_0027254_4179_4865 228
418 3300048926 Ga0496123_0001661 Ga0496123_0001661_18236_18925 228
419 3300048926 Ga0496123_0007351 Ga0496123_0007351_9163_9849 228
420 3300048926 Ga0496123_0011594 Ga0496123_0011594_1587_2273 228
421 3300048926 Ga0496123_0064734 Ga0496123_0064734_944_1630 228
422 3300048928 Ga0496125_0019349 Ga0496125_0019349_540_1226 228
423 3300049459 Ga0495678_000612 Ga0495678_000612_18561_19247 228
424 3300049460 Ga0495682_0002092 Ga0495682_0002092_4031_4717 228
425 3300049460 Ga0495682_0010132 Ga0495682_0010132_2343_3029 228
426 3300049568 Ga0501031_0005792 Ga0501031_0005792_1834_2595 228
427 3300049569 Ga0501032_0001989 Ga0501032_0001989_6324_7094 228
428 3300049569 Ga0501032_0002181 Ga0501032_0002181_9189_9950 228
429 3300049570 Ga0501033_0000726 Ga0501033_0000726_9001_9771 228
430 3300049570 Ga0501033_0076403 Ga0501033_0076403_187_930 228
431 3300049570 Ga0501033_0368605 Ga0501033_0368605_91_780 228
432 3300049571 Ga0501034_0002127 Ga0501034_0002127_18259_19029 228
433 3300049571 Ga0501034_0005967 Ga0501034_0005967_8667_9410 228
434 3300049571 Ga0501034_0011585 Ga0501034_0011585_6733_7494 228
435 3300049572 Ga0501036_0001181 Ga0501036_0001181_11260_12030 228
436 3300049572 Ga0501036_0044373 Ga0501036_0044373_1943_2686 228
437 3300049572 Ga0501036_0081057 Ga0501036_0081057_1306_2067 228
438 3300049573 Ga0501037_0002533 Ga0501037_0002533_4388_5158 228
439 3300049573 Ga0501037_0004913 Ga0501037_0004913_3543_4304 228
440 3300049573 Ga0501037_0201916 Ga0501037_0201916_541_1284 228
441 3300049574 Ga0501038_0000880 Ga0501038_0000880_244_1005 228
442 3300049574 Ga0501038_0003700 Ga0501038_0003700_6829_7599 228
443 3300049575 Ga0501039_0000356 Ga0501039_0000356_18077_18847 228
444 3300049575 Ga0501039_0010888 Ga0501039_0010888_4346_5107 228
445 3300049575 Ga0501039_0053413 Ga0501039_0053413_1324_2067 228
446 3300049579 Ga0501043_0011840 Ga0501043_0011840_3577_4338 228
447 3300049579 Ga0501043_0053042 Ga0501043_0053042_573_1343 228
448 3300049580 Ga0501046_0005829 Ga0501046_0005829_7880_8623 228
449 3300049580 Ga0501046_0013949 Ga0501046_0013949_1170_1931 228
450 3300049581 Ga0501047_0013608 Ga0501047_0013608_2835_3605 228
451 3300049581 Ga0501047_0018052 Ga0501047_0018052_4834_5595 228
452 3300049582 Ga0501048_0004330 Ga0501048_0004330_6247_6990 228
453 3300049584 Ga0501068_0042566 Ga0501068_0042566_1536_2306 228
454 3300049585 Ga0501069_0002373 Ga0501069_0002373_8465_9208 228
455 3300049586 Ga0501070_0026241 Ga0501070_0026241_1285_2055 228
456 3300049586 Ga0501070_0486284 Ga0501070_0486284_63_806 228
457 3300049586 Ga0501070_0642911 Ga0501070_0642911_48_809 228
458 3300049587 Ga0501071_0009387 Ga0501071_0009387_5748_6491 228
459 3300049587 Ga0501071_0017978 Ga0501071_0017978_1517_2287 228
460 3300049589 Ga0501073_0010612 Ga0501073_0010612_2077_2847 228
461 3300049589 Ga0501073_0197707 Ga0501073_0197707_493_1236 228
462 3300049590 Ga0501074_0008743 Ga0501074_0008743_1572_2342 228
463 3300049590 Ga0501074_0066791 Ga0501074_0066791_1657_2400 228
464 3300049741 Ga0501079_0027128 Ga0501079_0027128_2588_3331 228
465 3300049742 Ga0501080_0005250 Ga0501080_0005250_9682_10452 228
466 3300049744 Ga0501083_0006387 Ga0501083_0006387_1388_2131 228
467 3300049822 Ga0501035_0005913 Ga0501035_0005913_6651_7421 228
468 3300049822 Ga0501035_0008269 Ga0501035_0008269_8857_9600 228
469 3300049822 Ga0501035_0009770 Ga0501035_0009770_5407_6168 228
470 3300049823 Ga0501044_0002789 Ga0501044_0002789_1531_2274 228
471 3300049823 Ga0501044_0004889 Ga0501044_0004889_12378_13139 228
472 3300049823 Ga0501044_0018306 Ga0501044_0018306_4443_5213 228
473 3300053087 Ga0500643_000020 Ga0500643_000020_249915_250601 228
474 3300053087 Ga0500643_001707 Ga0500643_001707_4644_5333 228
475 3300053093 Ga0500651_0000367 Ga0500651_0000367_13192_13881 228
476 3300053093 Ga0500651_0001150 Ga0500651_0001150_9067_9756 228
477 3300053103 Ga0500555_001654 Ga0500555_001654_2527_3213 228
478 3300053120 Ga0500597_000041 Ga0500597_000041_22122_22811 228
479 3300053139 Ga0500568_0002290 Ga0500568_0002290_5036_5809 228
480 3300053730 Ga0500645_000617 Ga0500645_000617_21413_22099 228
481 3300055283 Ga0500661_002705 Ga0500661_002705_2005_2694 228
482 3300060353 Ga0501082_0001878 Ga0501082_0001878_1382_2170 228
483 3300060353 Ga0501082_0188085 Ga0501082_0188085_269_1012 228
484 3300061734 Ga0530510_0343599 Ga0530510_0343599_152_895 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

206

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.962 9 224
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9609 7 225
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9593 7 225
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9567 8 225
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9521 8 223
ID Description Score Start End Superfamily
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9806 7 228 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9762 35 225 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9746 7 224 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9688 7 225 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 7 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A316F6D1-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9941 9 225 GO:0005524
GO:0016887
AF-A0A2D5TSH3-F1-model_v4 ABC transporter 0.9895 7 224 GO:0005524
GO:0016887
AF-R6CP31-F1-model_v4 deleted 0.9836 7 225
AF-A9KJN2-F1-model_v4 ABC transporter related 0.9818 2 224 GO:0005524
GO:0016887
AF-A0A351NPA2-F1-model_v4 deleted 0.9808 7 228

Feature Viewer

pLDDT pTM Quality
93.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map