F452796

General Info

Members Datasets Scaffolds Average Seq Length
483 246 966 206

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100356427|Ga0307408_1003564272
Length 255
Sequence VSDEVQGYGASAGRDGGDHGRADPDEQGKRRRVQTDAPEQSPADDPHARLDVAVNSPGREGLTGTTPSNIYKPLPDREQVTIPPDGRPLHYQPQWRKDFPIDWPQDHYVTRRDFTKFLTLTSFAFVVGQLWIGAQNLWRRGRGKPPLRKIASLAALPVGGIVQFDYPGEHDSCILVRLGPGPDDVVAYGQKCTHLSCAVIPQFDKGRIHCPCHEGHFHLATGEVLAGPPPRPLPRILLERRGDDIYATGIEWRTV

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
176 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 2.07
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 13.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100356427 3300031548 Bacteria 1243
2 Ga0065712_10081967 3300005290 Bacteria 2959
3 Ga0065712_10365430 3300005290 Unclassified 770
4 Ga0065715_10095063 3300005293 Bacteria 4176
5 Ga0070676_10020433 3300005328 Bacteria 3696
6 Ga0070676_10028078 3300005328 Bacteria 3195
7 Ga0070690_100017159 3300005330 Bacteria 4348
8 Ga0070690_100413006 3300005330 Unclassified 993
9 Ga0070670_100048541 3300005331 Bacteria 3653
10 Ga0070670_100129959 3300005331 Bacteria 2175
11 Ga0070670_100230423 3300005331 Bacteria 1612
12 Ga0070670_100441771 3300005331 Bacteria 1152
13 Ga0070677_10096110 3300005333 Bacteria 1297
14 Ga0068869_101049686 3300005334 Unclassified 711
15 Ga0070682_100068558 3300005337 Bacteria 2263
16 Ga0068868_100486694 3300005338 Unclassified 1079
17 Ga0068868_101016352 3300005338 Bacteria 759
18 Ga0070660_100191928 3300005339 Bacteria 1655
19 Ga0070689_100015138 3300005340 Bacteria 5619
20 Ga0070689_100269747 3300005340 Bacteria 1409
21 Ga0070689_100397536 3300005340 Bacteria 1164
22 Ga0070689_100424819 3300005340 Unclassified 1127
23 Ga0070689_100563450 3300005340 Bacteria 983
24 Ga0070691_10001764 3300005341 Bacteria 9412
25 Ga0070691_10031943 3300005341 Bacteria 2471
26 Ga0070687_100157151 3300005343 Bacteria 1340
27 Ga0070687_100287408 3300005343 Bacteria 1038
28 Ga0070661_100000811 3300005344 Bacteria 22454
29 Ga0070661_100180439 3300005344 Bacteria 1606
30 Ga0070669_100082767 3300005353 Bacteria 2393
31 Ga0070669_100429382 3300005353 Unclassified 1086
32 Ga0070675_100000389 3300005354 Bacteria 29768
33 Ga0070675_100139050 3300005354 Bacteria 2075
34 Ga0070675_100272722 3300005354 Bacteria 1485
35 Ga0070675_100810955 3300005354 Bacteria 856
36 Ga0070671_100010640 3300005355 Bacteria 7383
37 Ga0070671_100068315 3300005355 Bacteria 2964
38 Ga0070674_100130733 3300005356 Bacteria 1871
39 Ga0070673_100000749 3300005364 Bacteria 18022
40 Ga0070673_100131582 3300005364 Bacteria 2100
41 Ga0070673_100164624 3300005364 Bacteria 1888
42 Ga0070688_100006574 3300005365 Bacteria 6221
43 Ga0070688_100116383 3300005365 Bacteria 1785
44 Ga0070688_100349609 3300005365 Bacteria 1082
45 Ga0070688_100723552 3300005365 Unclassified 773
46 Ga0070659_100107164 3300005366 Bacteria 2253
47 Ga0070667_100173051 3300005367 Bacteria 1907
48 Ga0070667_100302778 3300005367 Bacteria 1440
49 Ga0070667_100711079 3300005367 Unclassified 930
50 Ga0070703_10000339 3300005406 Bacteria 20813
51 Ga0070714_100005531 3300005435 Bacteria 9649
52 Ga0070714_100209508 3300005435 Unclassified 1786
53 Ga0070705_100028130 3300005440 Bacteria 3076
54 Ga0070705_100055886 3300005440 Bacteria 2322
55 Ga0070705_100460003 3300005440 Unclassified 957
56 Ga0070700_100008636 3300005441 Bacteria 5553
57 Ga0070700_100010235 3300005441 Bacteria 5174
58 Ga0070700_101030836 3300005441 Bacteria 678
59 Ga0070694_100000585 3300005444 Bacteria 20123
60 Ga0070694_100099854 3300005444 Bacteria 2052
61 Ga0070708_100000508 3300005445 Bacteria 29318
62 Ga0070678_100166440 3300005456 Bacteria 1791
63 Ga0070662_100242731 3300005457 Bacteria 1445
64 Ga0070681_10482134 3300005458 Bacteria 1153
65 Ga0068867_100014650 3300005459 Bacteria 5557
66 Ga0068867_100103135 3300005459 Bacteria 2181
67 Ga0068867_100254628 3300005459 Bacteria 1429
68 Ga0070685_10226653 3300005466 Bacteria 1227
69 Ga0070685_10384236 3300005466 Unclassified 968
70 Ga0070706_100004927 3300005467 Bacteria 12777
71 Ga0070706_101134606 3300005467 Unclassified 719
72 Ga0070707_100607673 3300005468 Bacteria 1056
73 Ga0070698_100012336 3300005471 Bacteria 9049
74 Ga0070698_100627878 3300005471 Bacteria 1015
75 Ga0070699_100001427 3300005518 Bacteria 21970
76 Ga0070679_100115205 3300005530 Bacteria 2673
77 Ga0070679_100885821 3300005530 Bacteria 836
78 Ga0070697_100032588 3300005536 Bacteria 4194
79 Ga0068853_100763931 3300005539 Bacteria 924
80 Ga0070672_100075300 3300005543 Bacteria 2694
81 Ga0070672_100192159 3300005543 Bacteria 1705
82 Ga0070672_100603670 3300005543 Unclassified 956
83 Ga0070686_100027149 3300005544 Bacteria 3463
84 Ga0070686_100196893 3300005544 Bacteria 1442
85 Ga0070686_100245238 3300005544 Bacteria 1306
86 Ga0070686_100487121 3300005544 Unclassified 955
87 Ga0070695_100201203 3300005545 Bacteria 1424
88 Ga0070695_100348907 3300005545 Unclassified 1108
89 Ga0070696_100057800 3300005546 Bacteria 2707
90 Ga0070696_100312672 3300005546 Bacteria 1206
91 Ga0070693_100009557 3300005547 Bacteria 4823
92 Ga0070665_100010950 3300005548 Bacteria 9172
93 Ga0070704_100009220 3300005549 Bacteria 5952
94 Ga0070704_100341386 3300005549 Bacteria 1261
95 Ga0068855_100034080 3300005563 Bacteria 6075
96 Ga0068855_100312688 3300005563 Bacteria 1738
97 Ga0068855_100472171 3300005563 Bacteria 1366
98 Ga0068855_100479867 3300005563 Unclassified 1353
99 Ga0068855_100719476 3300005563 Unclassified 1067
100 Ga0070664_100002095 3300005564 Bacteria 15937
101 Ga0070664_100089314 3300005564 Bacteria 2666
102 Ga0068857_100169430 3300005577 Bacteria 1984
103 Ga0068857_100270718 3300005577 Bacteria 1561
104 Ga0068857_100318437 3300005577 Bacteria 1436
105 Ga0068857_100433770 3300005577 Unclassified 1227
106 Ga0068854_100028438 3300005578 Bacteria 3863
107 Ga0068854_100120814 3300005578 Bacteria 1989
108 Ga0068854_100177142 3300005578 Bacteria 1663
109 Ga0068856_100336965 3300005614 Unclassified 1526
110 Ga0070702_100019667 3300005615 Bacteria 3527
111 Ga0068852_100029482 3300005616 Bacteria 4509
112 Ga0068852_100110217 3300005616 Bacteria 2501
113 Ga0068852_100647327 3300005616 Bacteria 1064
114 Ga0068859_100004031 3300005617 Bacteria 14977
115 Ga0068859_100095744 3300005617 Bacteria 3021
116 Ga0068859_100280079 3300005617 Bacteria 1760
117 Ga0068859_100936648 3300005617 Bacteria 950
118 Ga0068859_101021336 3300005617 Unclassified 908
119 Ga0068864_100506148 3300005618 Bacteria 1163
120 Ga0068864_101232700 3300005618 Unclassified 747
121 Ga0068866_10013391 3300005718 Bacteria 3598
122 Ga0068866_10245501 3300005718 Unclassified 1093
123 Ga0068861_100010652 3300005719 Bacteria 6385
124 Ga0068861_100549194 3300005719 Bacteria 1052
125 Ga0068861_100569995 3300005719 Bacteria 1035
126 Ga0068861_100789061 3300005719 Unclassified 890
127 Ga0068870_10222047 3300005840 Bacteria 1157
128 Ga0068863_100064197 3300005841 Bacteria 3473
129 Ga0068863_100271839 3300005841 Bacteria 1641
130 Ga0068858_100088009 3300005842 Bacteria 2889
131 Ga0068860_100029980 3300005843 Bacteria 5232
132 Ga0068860_100307052 3300005843 Bacteria 1555
133 Ga0068860_100383367 3300005843 Bacteria 1388
134 Ga0068860_100460339 3300005843 Bacteria 1265
135 Ga0068862_100024038 3300005844 Bacteria 5109
136 Ga0068862_100213300 3300005844 Bacteria 1745
137 Ga0068862_100238207 3300005844 Bacteria 1653
138 Ga0081538_10012338 3300005981 Bacteria 6852
139 Ga0075368_10104942 3300006042 Bacteria 1162
140 Ga0075363_100260510 3300006048 Unclassified 1000
141 Ga0075364_10064337 3300006051 Bacteria 2407
142 Ga0075362_10001619 3300006177 Bacteria 7297
143 Ga0075367_10010192 3300006178 Bacteria 4927
144 Ga0075366_10000100 3300006195 Bacteria 34958
145 Ga0097621_100011130 3300006237 Bacteria 6618
146 Ga0075370_10009355 3300006353 Bacteria 5085
147 Ga0075428_100016776 3300006844 Bacteria 8087
148 Ga0075428_100122047 3300006844 Bacteria 2837
149 Ga0075428_100232664 3300006844 Bacteria 1989
150 Ga0075428_100256045 3300006844 Bacteria 1885
151 Ga0075428_100280631 3300006844 Bacteria 1792
152 Ga0075428_100614952 3300006844 Bacteria 1160
153 Ga0075430_100020048 3300006846 Bacteria 5692
154 Ga0075430_100035132 3300006846 Bacteria 4254
155 Ga0075430_100246537 3300006846 Bacteria 1480
156 Ga0075431_100070494 3300006847 Bacteria 3607
157 Ga0075431_100136056 3300006847 Bacteria 2533
158 Ga0075431_100566068 3300006847 Bacteria 1123
159 Ga0075433_10023993 3300006852 Bacteria 5142
160 Ga0075434_100062375 3300006871 Bacteria 3710
161 Ga0075434_100064690 3300006871 Bacteria 3642
162 Ga0075434_100162228 3300006871 Bacteria 2255
163 Ga0075429_100036403 3300006880 Bacteria 4281
164 Ga0075429_100066680 3300006880 Bacteria 3134
165 Ga0075429_100074842 3300006880 Bacteria 2950
166 Ga0075429_100242918 3300006880 Bacteria 1577
167 Ga0075429_100413147 3300006880 Bacteria 1182
168 Ga0068865_100269344 3300006881 Unclassified 1352
169 Ga0097620_100004031 3300006931 Bacteria 14977
170 Ga0097620_100095746 3300006931 Bacteria 3021
171 Ga0097620_100280077 3300006931 Bacteria 1760
172 Ga0097620_100936641 3300006931 Bacteria 950
173 Ga0097620_101021503 3300006931 Unclassified 908
174 Ga0075435_100006983 3300007076 Bacteria 8016
175 Ga0075435_100014420 3300007076 Bacteria 5906
176 Ga0075435_100079465 3300007076 Bacteria 2692
177 Ga0075435_100107132 3300007076 Bacteria 2321
178 Ga0105240_10176216 3300009093 Bacteria 2528
179 Ga0105240_10219420 3300009093 Bacteria 2216
180 Ga0111539_10000732 3300009094 Bacteria 42670
181 Ga0111539_10018934 3300009094 Bacteria 8514
182 Ga0111539_10022531 3300009094 Bacteria 7737
183 Ga0111539_10143646 3300009094 Bacteria 2793
184 Ga0111539_10212649 3300009094 Bacteria 2253
185 Ga0111539_11466047 3300009094 Unclassified 791
186 Ga0105245_10044318 3300009098 Bacteria 3970
187 Ga0105245_10983985 3300009098 Unclassified 887
188 Ga0114129_10147659 3300009147 Unclassified 3220
189 Ga0105243_10000629 3300009148 Bacteria 35046
190 Ga0105243_10277391 3300009148 Bacteria 1508
191 Ga0105242_10000849 3300009176 Bacteria 23661
192 Ga0105248_10011673 3300009177 Bacteria 9680
193 Ga0105248_10119321 3300009177 Bacteria 2975
194 Ga0105248_10341786 3300009177 Bacteria 1685
195 Ga0105248_10514327 3300009177 Bacteria 1350
196 Ga0105248_10859863 3300009177 Unclassified 1024
197 Ga0105237_10000919 3300009545 Bacteria 39583
198 Ga0105249_10055707 3300009553 Bacteria 3618
199 Ga0105249_10127420 3300009553 Bacteria 2426
200 Ga0105249_10979740 3300009553 Unclassified 914
201 Ga0105239_10210855 3300010375 Bacteria 2177
202 Ga0105246_10681295 3300011119 Unclassified 899
203 Ga0157370_10026930 3300013104 Bacteria 5670
204 Ga0157370_10105679 3300013104 Bacteria 2635
205 Ga0157370_10282005 3300013104 Bacteria 1535
206 Ga0157369_10300130 3300013105 Bacteria 1671
207 Ga0157369_10349668 3300013105 Bacteria 1535
208 Ga0157369_10454463 3300013105 Bacteria 1326
209 Ga0157369_10507383 3300013105 Bacteria 1248
210 Ga0157374_10609885 3300013296 Unclassified 1102
211 Ga0157378_10293046 3300013297 Bacteria 1572
212 Ga0163162_10251394 3300013306 Bacteria 1900
213 Ga0163162_10321618 3300013306 Bacteria 1679
214 Ga0157372_10043530 3300013307 Bacteria 4971
215 Ga0157372_10070680 3300013307 Bacteria 3928
216 Ga0157372_10967853 3300013307 Unclassified 986
217 Ga0157372_11259701 3300013307 Unclassified 854
218 Ga0157372_11320455 3300013307 Unclassified 832
219 Ga0157375_10285540 3300013308 Bacteria 1813
220 Ga0157375_10401453 3300013308 Bacteria 1537
221 Ga0157375_10549189 3300013308 Bacteria 1317
222 Ga0157375_10856102 3300013308 Bacteria 1055
223 Ga0163163_10154709 3300014325 Bacteria 2337
224 Ga0163163_10435818 3300014325 Unclassified 1370
225 Ga0163163_10645656 3300014325 Bacteria 1122
226 Ga0157380_10070543 3300014326 Bacteria 2823
227 Ga0157380_10188365 3300014326 Bacteria 1819
228 Ga0157380_10446739 3300014326 Bacteria 1240
229 Ga0157380_11212168 3300014326 Bacteria 799
230 Ga0182008_10089238 3300014497 Bacteria 1519
231 Ga0157377_10366707 3300014745 Bacteria 971
232 Ga0206350_10799874 3300020080 Unclassified 1286
233 Ga0207653_10000371 3300025885 Bacteria 21042
234 Ga0207642_10106483 3300025899 Bacteria 1419
235 Ga0207688_10168438 3300025901 Bacteria 1302
236 Ga0207680_10585769 3300025903 Unclassified 797
237 Ga0207647_10119965 3300025904 Bacteria 1551
238 Ga0207645_10005699 3300025907 Bacteria 8998
239 Ga0207645_10012483 3300025907 Bacteria 5761
240 Ga0207643_10110742 3300025908 Bacteria 1618
241 Ga0207705_10053972 3300025909 Bacteria 2896
242 Ga0207684_10029016 3300025910 Unclassified 4712
243 Ga0207654_10028636 3300025911 Bacteria 3038
244 Ga0207707_10335679 3300025912 Bacteria 1304
245 Ga0207695_10002596 3300025913 Bacteria 26488
246 Ga0207671_10000120 3300025914 Bacteria 120786
247 Ga0207663_10000020 3300025916 Bacteria 137200
248 Ga0207662_10001028 3300025918 Bacteria 13053
249 Ga0207662_10096495 3300025918 Bacteria 1826
250 Ga0207662_10121406 3300025918 Bacteria 1639
251 Ga0207649_10003405 3300025920 Bacteria 8692
252 Ga0207649_10212241 3300025920 Bacteria 1374
253 Ga0207652_10008447 3300025921 Bacteria 8284
254 Ga0207646_10693937 3300025922 Bacteria 910
255 Ga0207646_10718615 3300025922 Unclassified 893
256 Ga0207681_10090380 3300025923 Bacteria 2185
257 Ga0207681_10100492 3300025923 Bacteria 2085
258 Ga0207681_10782736 3300025923 Unclassified 796
259 Ga0207650_10050073 3300025925 Bacteria 3087
260 Ga0207650_10081286 3300025925 Bacteria 2458
261 Ga0207650_10085863 3300025925 Bacteria 2395
262 Ga0207659_10000080 3300025926 Bacteria 60332
263 Ga0207659_10086616 3300025926 Bacteria 2330
264 Ga0207659_10121086 3300025926 Bacteria 2005
265 Ga0207659_10721135 3300025926 Bacteria 854
266 Ga0207664_10139265 3300025929 Bacteria 2051
267 Ga0207644_10088344 3300025931 Unclassified 2305
268 Ga0207644_10313168 3300025931 Bacteria 1267
269 Ga0207690_10172695 3300025932 Bacteria 1621
270 Ga0207690_10639025 3300025932 Bacteria 871
271 Ga0207686_10000039 3300025934 Bacteria 126792
272 Ga0207686_10018260 3300025934 Bacteria 3969
273 Ga0207709_10000192 3300025935 Bacteria 81277
274 Ga0207670_10123155 3300025936 Unclassified 1888
275 Ga0207670_10176706 3300025936 Unclassified 1605
276 Ga0207670_10821205 3300025936 Unclassified 775
277 Ga0207704_10354383 3300025938 Unclassified 1143
278 Ga0207704_10718283 3300025938 Bacteria 829
279 Ga0207691_10082925 3300025940 Bacteria 2879
280 Ga0207691_10212179 3300025940 Bacteria 1681
281 Ga0207691_10385075 3300025940 Bacteria 1197
282 Ga0207711_10008173 3300025941 Bacteria 8759
283 Ga0207711_10051954 3300025941 Bacteria 3511
284 Ga0207711_10445140 3300025941 Bacteria 1206
285 Ga0207711_10582269 3300025941 Bacteria 1044
286 Ga0207689_10197230 3300025942 Bacteria 1662
287 Ga0207679_10003018 3300025945 Bacteria 10433
288 Ga0207679_10059517 3300025945 Bacteria 2834
289 Ga0207667_10024393 3300025949 Bacteria 6640
290 Ga0207667_10182646 3300025949 Bacteria 2153
291 Ga0207651_10000043 3300025960 Bacteria 59486
292 Ga0207651_10000742 3300025960 Bacteria 13984
293 Ga0207651_10133680 3300025960 Bacteria 1904
294 Ga0207651_10272376 3300025960 Bacteria 1395
295 Ga0207651_10371221 3300025960 Bacteria 1210
296 Ga0207712_10074634 3300025961 Bacteria 2449
297 Ga0207640_10058212 3300025981 Bacteria 2545
298 Ga0207640_10231941 3300025981 Bacteria 1421
299 Ga0207640_10543034 3300025981 Bacteria 975
300 Ga0207658_10822449 3300025986 Unclassified 844
301 Ga0207703_10066486 3300026035 Bacteria 2965
302 Ga0207703_10076448 3300026035 Bacteria 2777
303 Ga0207708_10007480 3300026075 Bacteria 8072
304 Ga0207708_10195689 3300026075 Bacteria 1611
305 Ga0207708_11010918 3300026075 Bacteria 723
306 Ga0207702_10400526 3300026078 Bacteria 1323
307 Ga0207641_10172698 3300026088 Bacteria 1974
308 Ga0207641_10206350 3300026088 Bacteria 1815
309 Ga0207648_10009113 3300026089 Bacteria 9540
310 Ga0207648_10026336 3300026089 Bacteria 5169
311 Ga0207648_10113187 3300026089 Bacteria 2383
312 Ga0207648_11578240 3300026089 Unclassified 617
313 Ga0207676_10043806 3300026095 Bacteria 3448
314 Ga0207674_10189743 3300026116 Bacteria 2005
315 Ga0207674_10318495 3300026116 Bacteria 1505
316 Ga0207675_100057364 3300026118 Bacteria 3633
317 Ga0207675_100261829 3300026118 Bacteria 1676
318 Ga0207683_10222713 3300026121 Bacteria 1719
319 Ga0207683_10346761 3300026121 Bacteria 1362
320 Ga0207698_10115319 3300026142 Bacteria 2262
321 Ga0207698_10184647 3300026142 Bacteria 1851
322 Ga0209971_1022578 3300027682 Bacteria 1499
323 Ga0209813_10050951 3300027866 Bacteria 1293
324 Ga0207428_10000601 3300027907 Bacteria 42555
325 Ga0207428_10004578 3300027907 Bacteria 13102
326 Ga0207428_10025538 3300027907 Bacteria 4945
327 Ga0207428_10035629 3300027907 Bacteria 4066
328 Ga0207428_10051568 3300027907 Bacteria 3289
329 Ga0207428_10259467 3300027907 Bacteria 1294
330 Ga0268266_10099462 3300028379 Bacteria 2560
331 Ga0268265_10007072 3300028380 Bacteria 7585
332 Ga0268265_10169004 3300028380 Bacteria 1866
333 Ga0268265_10724647 3300028380 Unclassified 963
334 Ga0268264_10031212 3300028381 Bacteria 4369
335 Ga0268264_10299233 3300028381 Bacteria 1514
336 Ga0268264_10675408 3300028381 Bacteria 1024
337 Ga0265334_10088355 3300028573 Bacteria 1134
338 Ga0307405_10504912 3300031731 Bacteria 970
339 Ga0307413_10068735 3300031824 Bacteria 2220
340 Ga0307410_10164825 3300031852 Bacteria 1664
341 Ga0307410_10204716 3300031852 Bacteria 1509
342 Ga0307406_10015500 3300031901 Bacteria 4413
343 Ga0307406_10499374 3300031901 Unclassified 986
344 Ga0307407_10079523 3300031903 Bacteria 1978
345 Ga0307409_100011665 3300031995 Bacteria 5555
346 Ga0307409_100035367 3300031995 Bacteria 3660
347 Ga0307409_100438292 3300031995 Bacteria 1258
348 Ga0307409_100466756 3300031995 Bacteria 1222
349 Ga0307416_100676635 3300032002 Bacteria 1119
350 Ga0307411_10080593 3300032005 Bacteria 2239
351 Ga0307415_100213510 3300032126 Bacteria 1541
352 Ga0373948_0006201 3300034817 Bacteria 1969
353 Ga0373950_0041394 3300034818 Unclassified 883
354 Ga0373949_0082047 3300035090 Unclassified 861
355 Ga0373933_0108114 3300035724 Bacteria 1732
356 Ga0373937_0019343 3300036401 Bacteria 6094
357 Ga0373937_0062585 3300036401 Bacteria 3421
358 Ga0373937_0330816 3300036401 Bacteria 1442
359 Ga0450920_004091 3300042122 Bacteria 2553
360 Ga0450895_000570 3300042132 Bacteria 2194
361 Ga0450896_015208 3300042133 Bacteria 1101
362 Ga0439435_0009020 3300042436 Bacteria 2330
363 Ga0451577_0029001 3300042876 Bacteria 5004
364 Ga0453684_0570270 3300044712 Unclassified 1244
365 Ga0453684_1012005 3300044712 Unclassified 883
366 Ga0451576_0369379 3300045051 Bacteria 1503
367 Ga0466967_0550101 3300045976 Bacteria 1136
368 Ga0495603_0129208 3300046455 Bacteria 1472
369 Ga0495652_0511464 3300046529 Unclassified 831
370 Ga0495645_0201425 3300046543 Bacteria 1350
371 Ga0495659_0010397 3300046664 Bacteria 2985
372 Ga0495613_0134204 3300046689 Archaea 1772
373 Ga0495613_0390517 3300046689 Bacteria 950
374 Ga0495581_0161880 3300047315 Bacteria 1308
375 Ga0495675_0206808 3300047444 Bacteria 1193
376 Ga0495684_0014303 3300047471 Bacteria 6109
377 Ga0495602_0629458 3300048088 Bacteria 735
378 Ga0496106_0147025 3300048909 Bacteria 1857
379 Ga0496108_0326538 3300048911 Bacteria 1338
380 Ga0496109_0804389 3300048912 Unclassified 878
381 Ga0496110_0143080 3300048913 Bacteria 2162
382 Ga0496112_0160858 3300048915 Bacteria 2212
383 Ga0496112_1147049 3300048915 Bacteria 695
384 Ga0496112_1445487 3300048915 Unclassified 602
385 Ga0496113_0367579 3300048916 Bacteria 1154
386 Ga0496114_0079214 3300048917 Bacteria 2773
387 Ga0496114_0111338 3300048917 Bacteria 2346
388 Ga0501034_0000429 3300049571 Bacteria 69803
389 Ga0501034_0010374 3300049571 Bacteria 9709
390 Ga0501034_0014249 3300049571 Bacteria 8196
391 Ga0501034_0083212 3300049571 Bacteria 3202
392 Ga0501036_0527102 3300049572 Bacteria 982
393 Ga0501038_0017381 3300049574 Bacteria 6500
394 Ga0501038_0621000 3300049574 Bacteria 816
395 Ga0501039_0082974 3300049575 Bacteria 2496
396 Ga0501039_0140597 3300049575 Bacteria 1896
397 Ga0501040_0281805 3300049576 Bacteria 1187
398 Ga0501041_0058265 3300049577 Bacteria 2362
399 Ga0501042_0032513 3300049578 Bacteria 3695
400 Ga0501043_0479145 3300049579 Bacteria 932
401 Ga0501046_0149788 3300049580 Bacteria 1760
402 Ga0501046_0364094 3300049580 Bacteria 1048
403 Ga0501046_0557551 3300049580 Bacteria 816
404 Ga0501047_0011206 3300049581 Bacteria 8484
405 Ga0501047_0912743 3300049581 Unclassified 692
406 Ga0501047_1016707 3300049581 Unclassified 642
407 Ga0501067_0052116 3300049583 Bacteria 2267
408 Ga0501068_0047422 3300049584 Bacteria 2592
409 Ga0501071_0090149 3300049587 Bacteria 2251
410 Ga0501072_0018404 3300049588 Bacteria 5379
411 Ga0501072_0085076 3300049588 Bacteria 2508
412 Ga0501073_0197385 3300049589 Bacteria 1392
413 Ga0501074_0087298 3300049590 Bacteria 2234
414 Ga0501075_0041188 3300049591 Bacteria 3461
415 Ga0501075_0196390 3300049591 Bacteria 1539
416 Ga0501075_0238794 3300049591 Bacteria 1385
417 Ga0501076_0090493 3300049592 Bacteria 2461
418 Ga0501077_0094466 3300049593 Bacteria 1896
419 Ga0501079_0160717 3300049741 Bacteria 1752
420 Ga0501080_0060052 3300049742 Bacteria 3538
421 Ga0501080_0071633 3300049742 Bacteria 3224
422 Ga0501081_0051943 3300049743 Bacteria 2827
423 Ga0501081_0907845 3300049743 Unclassified 664
424 Ga0501083_0112924 3300049744 Bacteria 1785
425 Ga0501035_0193281 3300049822 Unclassified 1749
426 Ga0501044_0005183 3300049823 Bacteria 14507
427 Ga0501044_0009239 3300049823 Bacteria 10766
428 Ga0501045_0005562 3300049824 Bacteria 8717
429 Ga0501045_0081402 3300049824 Bacteria 2388
430 Ga0501045_0311098 3300049824 Bacteria 1172
431 nmdc:mga0yw44_61008_c1 3300050492 Bacteria 2312
432 nmdc:mga0k408_644_c1 3300050493 Bacteria 19205
433 nmdc:mga06z11_2728_c1 3300050494 Bacteria 6770
434 nmdc:mga04h51_49429_c1 3300050495 Bacteria 1405
435 nmdc:mga07m45_9191_c1 3300050496 Bacteria 5112
436 nmdc:mga05p37_13360_c1 3300050507 Bacteria 9837
437 nmdc:mga05p37_306856_c1 3300050507 Bacteria 1883
438 nmdc:mga05p37_69833_c2 3300050507 Bacteria 3113
439 nmdc:mga09592_161827_c1 3300050508 Unclassified 1934
440 nmdc:mga09592_24696_c2 3300050508 Bacteria 3477
441 nmdc:mga09592_443769_c1 3300050508 Bacteria 1120
442 nmdc:mga09592_73219_c1 3300050508 Bacteria 2910
443 nmdc:mga0qj67_11122_c1 3300050509 Bacteria 6740
444 nmdc:mga0qj67_33684_c1 3300050509 Bacteria 3998
445 nmdc:mga06r32_1147776_c1 3300050510 Bacteria 725
446 nmdc:mga06r32_189360_c1 3300050510 Bacteria 2045
447 nmdc:mga06r32_343859_c1 3300050510 Bacteria 1476
448 nmdc:mga06r32_399133_c1 3300050510 Unclassified 1357
449 nmdc:mga06r32_60244_c1 3300050510 Bacteria 3653
450 nmdc:mga06r32_639088_c1 3300050510 Bacteria 1033
451 nmdc:mga08y16_116689_c1 3300050511 Bacteria 2779
452 nmdc:mga08y16_1227849_c1 3300050511 Bacteria 719
453 nmdc:mga08y16_19620_c1 3300050511 Bacteria 7129
454 nmdc:mga08y16_365994_c1 3300050511 Bacteria 1480
455 nmdc:mga08y16_555438_c1 3300050511 Bacteria 1162
456 nmdc:mga08y16_655_c1 3300050511 Bacteria 32531
457 nmdc:mga08y16_9913_c1 3300050511 Bacteria 10001
458 nmdc:mga0n895_316469_c1 3300050512 Unclassified 1582
459 nmdc:mga0n895_344296_c1 3300050512 Bacteria 1510
460 nmdc:mga0n895_509011_c1 3300050512 Bacteria 1212
461 nmdc:mga0rr50_160216_c1 3300050513 Bacteria 1826
462 nmdc:mga0rr50_566_c1 3300050513 Bacteria 19832
463 nmdc:mga0rr50_68868_c1 3300050513 Bacteria 2692
464 nmdc:mga0a205_132227_c1 3300050515 Bacteria 2396
465 nmdc:mga0a205_24570_c1 3300050515 Bacteria 5732
466 Ga0495601_0114309 3300053077 Bacteria 1750
467 Ga0495595_0117157 3300053084 Bacteria 1296
468 Ga0495619_0556231 3300053085 Bacteria 787
469 Ga0501084_0037455 3300054114 Bacteria 4052
470 Ga0501084_0063908 3300054114 Bacteria 3082
471 Ga0501084_0663989 3300054114 Bacteria 880
472 Ga0501084_0715303 3300054114 Unclassified 844
473 Ga0590071_000235 3300059421 Bacteria 16189
474 Ga0590074_000772 3300059423 Bacteria 4900
475 Ga0590075_000649 3300059424 Bacteria 9247
476 Ga0590075_002431 3300059424 Bacteria 4463
477 Ga0590077_000031 3300059426 Bacteria 33228
478 Ga0590077_000825 3300059426 Bacteria 8006
479 Ga0501082_0064049 3300060353 Bacteria 3166
480 Ga0501082_0358893 3300060353 Bacteria 1271
481 Ga0530510_0027475 3300061734 Bacteria 4076
482 Ga0530510_0233040 3300061734 Bacteria 1370
483 Ga0530510_0262125 3300061734 Bacteria 1289
484 Ga0307408_100356427
485 Ga0065712_10081967
486 Ga0065712_10365430
487 Ga0065715_10095063
488 Ga0070676_10020433
489 Ga0070676_10028078
490 Ga0070690_100017159
491 Ga0070690_100413006
492 Ga0070670_100048541
493 Ga0070670_100129959
494 Ga0070670_100230423
495 Ga0070670_100441771
496 Ga0070677_10096110
497 Ga0068869_101049686
498 Ga0070682_100068558
499 Ga0068868_100486694
500 Ga0068868_101016352
501 Ga0070660_100191928
502 Ga0070689_100015138
503 Ga0070689_100269747
504 Ga0070689_100397536
505 Ga0070689_100424819
506 Ga0070689_100563450
507 Ga0070691_10001764
508 Ga0070691_10031943
509 Ga0070687_100157151
510 Ga0070687_100287408
511 Ga0070661_100000811
512 Ga0070661_100180439
513 Ga0070669_100082767
514 Ga0070669_100429382
515 Ga0070675_100000389
516 Ga0070675_100139050
517 Ga0070675_100272722
518 Ga0070675_100810955
519 Ga0070671_100010640
520 Ga0070671_100068315
521 Ga0070674_100130733
522 Ga0070673_100000749
523 Ga0070673_100131582
524 Ga0070673_100164624
525 Ga0070688_100006574
526 Ga0070688_100116383
527 Ga0070688_100349609
528 Ga0070688_100723552
529 Ga0070659_100107164
530 Ga0070667_100173051
531 Ga0070667_100302778
532 Ga0070667_100711079
533 Ga0070703_10000339
534 Ga0070714_100005531
535 Ga0070714_100209508
536 Ga0070705_100028130
537 Ga0070705_100055886
538 Ga0070705_100460003
539 Ga0070700_100008636
540 Ga0070700_100010235
541 Ga0070700_101030836
542 Ga0070694_100000585
543 Ga0070694_100099854
544 Ga0070708_100000508
545 Ga0070678_100166440
546 Ga0070662_100242731
547 Ga0070681_10482134
548 Ga0068867_100014650
549 Ga0068867_100103135
550 Ga0068867_100254628
551 Ga0070685_10226653
552 Ga0070685_10384236
553 Ga0070706_100004927
554 Ga0070706_101134606
555 Ga0070707_100607673
556 Ga0070698_100012336
557 Ga0070698_100627878
558 Ga0070699_100001427
559 Ga0070679_100115205
560 Ga0070679_100885821
561 Ga0070697_100032588
562 Ga0068853_100763931
563 Ga0070672_100075300
564 Ga0070672_100192159
565 Ga0070672_100603670
566 Ga0070686_100027149
567 Ga0070686_100196893
568 Ga0070686_100245238
569 Ga0070686_100487121
570 Ga0070695_100201203
571 Ga0070695_100348907
572 Ga0070696_100057800
573 Ga0070696_100312672
574 Ga0070693_100009557
575 Ga0070665_100010950
576 Ga0070704_100009220
577 Ga0070704_100341386
578 Ga0068855_100034080
579 Ga0068855_100312688
580 Ga0068855_100472171
581 Ga0068855_100479867
582 Ga0068855_100719476
583 Ga0070664_100002095
584 Ga0070664_100089314
585 Ga0068857_100169430
586 Ga0068857_100270718
587 Ga0068857_100318437
588 Ga0068857_100433770
589 Ga0068854_100028438
590 Ga0068854_100120814
591 Ga0068854_100177142
592 Ga0068856_100336965
593 Ga0070702_100019667
594 Ga0068852_100029482
595 Ga0068852_100110217
596 Ga0068852_100647327
597 Ga0068859_100004031
598 Ga0068859_100095744
599 Ga0068859_100280079
600 Ga0068859_100936648
601 Ga0068859_101021336
602 Ga0068864_100506148
603 Ga0068864_101232700
604 Ga0068866_10013391
605 Ga0068866_10245501
606 Ga0068861_100010652
607 Ga0068861_100549194
608 Ga0068861_100569995
609 Ga0068861_100789061
610 Ga0068870_10222047
611 Ga0068863_100064197
612 Ga0068863_100271839
613 Ga0068858_100088009
614 Ga0068860_100029980
615 Ga0068860_100307052
616 Ga0068860_100383367
617 Ga0068860_100460339
618 Ga0068862_100024038
619 Ga0068862_100213300
620 Ga0068862_100238207
621 Ga0081538_10012338
622 Ga0075368_10104942
623 Ga0075363_100260510
624 Ga0075364_10064337
625 Ga0075362_10001619
626 Ga0075367_10010192
627 Ga0075366_10000100
628 Ga0097621_100011130
629 Ga0075370_10009355
630 Ga0075428_100016776
631 Ga0075428_100122047
632 Ga0075428_100232664
633 Ga0075428_100256045
634 Ga0075428_100280631
635 Ga0075428_100614952
636 Ga0075430_100020048
637 Ga0075430_100035132
638 Ga0075430_100246537
639 Ga0075431_100070494
640 Ga0075431_100136056
641 Ga0075431_100566068
642 Ga0075433_10023993
643 Ga0075434_100062375
644 Ga0075434_100064690
645 Ga0075434_100162228
646 Ga0075429_100036403
647 Ga0075429_100066680
648 Ga0075429_100074842
649 Ga0075429_100242918
650 Ga0075429_100413147
651 Ga0068865_100269344
652 Ga0097620_100004031
653 Ga0097620_100095746
654 Ga0097620_100280077
655 Ga0097620_100936641
656 Ga0097620_101021503
657 Ga0075435_100006983
658 Ga0075435_100014420
659 Ga0075435_100079465
660 Ga0075435_100107132
661 Ga0105240_10176216
662 Ga0105240_10219420
663 Ga0111539_10000732
664 Ga0111539_10018934
665 Ga0111539_10022531
666 Ga0111539_10143646
667 Ga0111539_10212649
668 Ga0111539_11466047
669 Ga0105245_10044318
670 Ga0105245_10983985
671 Ga0114129_10147659
672 Ga0105243_10000629
673 Ga0105243_10277391
674 Ga0105242_10000849
675 Ga0105248_10011673
676 Ga0105248_10119321
677 Ga0105248_10341786
678 Ga0105248_10514327
679 Ga0105248_10859863
680 Ga0105237_10000919
681 Ga0105249_10055707
682 Ga0105249_10127420
683 Ga0105249_10979740
684 Ga0105239_10210855
685 Ga0105246_10681295
686 Ga0157370_10026930
687 Ga0157370_10105679
688 Ga0157370_10282005
689 Ga0157369_10300130
690 Ga0157369_10349668
691 Ga0157369_10454463
692 Ga0157369_10507383
693 Ga0157374_10609885
694 Ga0157378_10293046
695 Ga0163162_10251394
696 Ga0163162_10321618
697 Ga0157372_10043530
698 Ga0157372_10070680
699 Ga0157372_10967853
700 Ga0157372_11259701
701 Ga0157372_11320455
702 Ga0157375_10285540
703 Ga0157375_10401453
704 Ga0157375_10549189
705 Ga0157375_10856102
706 Ga0163163_10154709
707 Ga0163163_10435818
708 Ga0163163_10645656
709 Ga0157380_10070543
710 Ga0157380_10188365
711 Ga0157380_10446739
712 Ga0157380_11212168
713 Ga0182008_10089238
714 Ga0157377_10366707
715 Ga0206350_10799874
716 Ga0207653_10000371
717 Ga0207642_10106483
718 Ga0207688_10168438
719 Ga0207680_10585769
720 Ga0207647_10119965
721 Ga0207645_10005699
722 Ga0207645_10012483
723 Ga0207643_10110742
724 Ga0207705_10053972
725 Ga0207684_10029016
726 Ga0207654_10028636
727 Ga0207707_10335679
728 Ga0207695_10002596
729 Ga0207671_10000120
730 Ga0207663_10000020
731 Ga0207662_10001028
732 Ga0207662_10096495
733 Ga0207662_10121406
734 Ga0207649_10003405
735 Ga0207649_10212241
736 Ga0207652_10008447
737 Ga0207646_10693937
738 Ga0207646_10718615
739 Ga0207681_10090380
740 Ga0207681_10100492
741 Ga0207681_10782736
742 Ga0207650_10050073
743 Ga0207650_10081286
744 Ga0207650_10085863
745 Ga0207659_10000080
746 Ga0207659_10086616
747 Ga0207659_10121086
748 Ga0207659_10721135
749 Ga0207664_10139265
750 Ga0207644_10088344
751 Ga0207644_10313168
752 Ga0207690_10172695
753 Ga0207690_10639025
754 Ga0207686_10000039
755 Ga0207686_10018260
756 Ga0207709_10000192
757 Ga0207670_10123155
758 Ga0207670_10176706
759 Ga0207670_10821205
760 Ga0207704_10354383
761 Ga0207704_10718283
762 Ga0207691_10082925
763 Ga0207691_10212179
764 Ga0207691_10385075
765 Ga0207711_10008173
766 Ga0207711_10051954
767 Ga0207711_10445140
768 Ga0207711_10582269
769 Ga0207689_10197230
770 Ga0207679_10003018
771 Ga0207679_10059517
772 Ga0207667_10024393
773 Ga0207667_10182646
774 Ga0207651_10000043
775 Ga0207651_10000742
776 Ga0207651_10133680
777 Ga0207651_10272376
778 Ga0207651_10371221
779 Ga0207712_10074634
780 Ga0207640_10058212
781 Ga0207640_10231941
782 Ga0207640_10543034
783 Ga0207658_10822449
784 Ga0207703_10066486
785 Ga0207703_10076448
786 Ga0207708_10007480
787 Ga0207708_10195689
788 Ga0207708_11010918
789 Ga0207702_10400526
790 Ga0207641_10172698
791 Ga0207641_10206350
792 Ga0207648_10009113
793 Ga0207648_10026336
794 Ga0207648_10113187
795 Ga0207648_11578240
796 Ga0207676_10043806
797 Ga0207674_10189743
798 Ga0207674_10318495
799 Ga0207675_100057364
800 Ga0207675_100261829
801 Ga0207683_10222713
802 Ga0207683_10346761
803 Ga0207698_10115319
804 Ga0207698_10184647
805 Ga0209971_1022578
806 Ga0209813_10050951
807 Ga0207428_10000601
808 Ga0207428_10004578
809 Ga0207428_10025538
810 Ga0207428_10035629
811 Ga0207428_10051568
812 Ga0207428_10259467
813 Ga0268266_10099462
814 Ga0268265_10007072
815 Ga0268265_10169004
816 Ga0268265_10724647
817 Ga0268264_10031212
818 Ga0268264_10299233
819 Ga0268264_10675408
820 Ga0265334_10088355
821 Ga0307405_10504912
822 Ga0307413_10068735
823 Ga0307410_10164825
824 Ga0307410_10204716
825 Ga0307406_10015500
826 Ga0307406_10499374
827 Ga0307407_10079523
828 Ga0307409_100011665
829 Ga0307409_100035367
830 Ga0307409_100438292
831 Ga0307409_100466756
832 Ga0307416_100676635
833 Ga0307411_10080593
834 Ga0307415_100213510
835 Ga0373948_0006201
836 Ga0373950_0041394
837 Ga0373949_0082047
838 Ga0373933_0108114
839 Ga0373937_0019343
840 Ga0373937_0062585
841 Ga0373937_0330816
842 Ga0450920_004091
843 Ga0450895_000570
844 Ga0450896_015208
845 Ga0439435_0009020
846 Ga0451577_0029001
847 Ga0453684_0570270
848 Ga0453684_1012005
849 Ga0451576_0369379
850 Ga0466967_0550101
851 Ga0495603_0129208
852 Ga0495652_0511464
853 Ga0495645_0201425
854 Ga0495659_0010397
855 Ga0495613_0134204
856 Ga0495613_0390517
857 Ga0495581_0161880
858 Ga0495675_0206808
859 Ga0495684_0014303
860 Ga0495602_0629458
861 Ga0496106_0147025
862 Ga0496108_0326538
863 Ga0496109_0804389
864 Ga0496110_0143080
865 Ga0496112_0160858
866 Ga0496112_1147049
867 Ga0496112_1445487
868 Ga0496113_0367579
869 Ga0496114_0079214
870 Ga0496114_0111338
871 Ga0501034_0000429
872 Ga0501034_0010374
873 Ga0501034_0014249
874 Ga0501034_0083212
875 Ga0501036_0527102
876 Ga0501038_0017381
877 Ga0501038_0621000
878 Ga0501039_0082974
879 Ga0501039_0140597
880 Ga0501040_0281805
881 Ga0501041_0058265
882 Ga0501042_0032513
883 Ga0501043_0479145
884 Ga0501046_0149788
885 Ga0501046_0364094
886 Ga0501046_0557551
887 Ga0501047_0011206
888 Ga0501047_0912743
889 Ga0501047_1016707
890 Ga0501067_0052116
891 Ga0501068_0047422
892 Ga0501071_0090149
893 Ga0501072_0018404
894 Ga0501072_0085076
895 Ga0501073_0197385
896 Ga0501074_0087298
897 Ga0501075_0041188
898 Ga0501075_0196390
899 Ga0501075_0238794
900 Ga0501076_0090493
901 Ga0501077_0094466
902 Ga0501079_0160717
903 Ga0501080_0060052
904 Ga0501080_0071633
905 Ga0501081_0051943
906 Ga0501081_0907845
907 Ga0501083_0112924
908 Ga0501035_0193281
909 Ga0501044_0005183
910 Ga0501044_0009239
911 Ga0501045_0005562
912 Ga0501045_0081402
913 Ga0501045_0311098
914 nmdc:mga0yw44_61008_c1
915 nmdc:mga0k408_644_c1
916 nmdc:mga06z11_2728_c1
917 nmdc:mga04h51_49429_c1
918 nmdc:mga07m45_9191_c1
919 nmdc:mga05p37_13360_c1
920 nmdc:mga05p37_306856_c1
921 nmdc:mga05p37_69833_c2
922 nmdc:mga09592_161827_c1
923 nmdc:mga09592_24696_c2
924 nmdc:mga09592_443769_c1
925 nmdc:mga09592_73219_c1
926 nmdc:mga0qj67_11122_c1
927 nmdc:mga0qj67_33684_c1
928 nmdc:mga06r32_1147776_c1
929 nmdc:mga06r32_189360_c1
930 nmdc:mga06r32_343859_c1
931 nmdc:mga06r32_399133_c1
932 nmdc:mga06r32_60244_c1
933 nmdc:mga06r32_639088_c1
934 nmdc:mga08y16_116689_c1
935 nmdc:mga08y16_1227849_c1
936 nmdc:mga08y16_19620_c1
937 nmdc:mga08y16_365994_c1
938 nmdc:mga08y16_555438_c1
939 nmdc:mga08y16_655_c1
940 nmdc:mga08y16_9913_c1
941 nmdc:mga0n895_316469_c1
942 nmdc:mga0n895_344296_c1
943 nmdc:mga0n895_509011_c1
944 nmdc:mga0rr50_160216_c1
945 nmdc:mga0rr50_566_c1
946 nmdc:mga0rr50_68868_c1
947 nmdc:mga0a205_132227_c1
948 nmdc:mga0a205_24570_c1
949 Ga0495601_0114309
950 Ga0495595_0117157
951 Ga0495619_0556231
952 Ga0501084_0037455
953 Ga0501084_0063908
954 Ga0501084_0663989
955 Ga0501084_0715303
956 Ga0590071_000235
957 Ga0590074_000772
958 Ga0590075_000649
959 Ga0590075_002431
960 Ga0590077_000031
961 Ga0590077_000825
962 Ga0501082_0064049
963 Ga0501082_0358893
964 Ga0530510_0027475
965 Ga0530510_0233040
966 Ga0530510_0262125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

154

237

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g8k-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9313 103 207
1g8j-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9307 105 207
8cgs-assembly1.cif.gz_B crystal structure of arsenite oxidase from alcaligenes faecalis (af aio) bound to antimony oxyanion 0.9196 102 207
5nqd-assembly2.cif.gz_D arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a 0.898 102 208
8ed4-assembly1.cif.gz_D structure of the complex between the arsenite oxidase and its native electron acceptor cytochrome c552 from pseudorhizobium sp. str. nt-26 0.8962 102 208
ID Description Score Start End Superfamily
1g8kF00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9338 103 207 2.102.10.10
4aayB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9011 102 208 2.102.10.10
1jm1A00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8733 103 206 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8713 106 205 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8553 106 205 2.102.10.10
ID Description Score Start End GO Terms
AF-B1I6L5-F1-model_v4 Rieske (2Fe-2S) domain protein 0.9658 105 204 GO:0046872
GO:0051537
AF-A0A535QCV9-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9591 103 206 GO:0046872
GO:0051537
AF-A0A3M2GQ28-F1-model_v4 Arsenate reductase (Azurin) small subunit (EC 1.20.9.1) 0.9424 105 207 GO:0046872
GO:0050611
GO:0051537
AF-A0A7Y3P3H0-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9379 102 206 GO:0016020
GO:0046872
GO:0051537
AF-A0A3B9MMI8-F1-model_v4 Rieske domain-containing protein 0.9372 102 206 GO:0016020
GO:0046872
GO:0051537

Map