metagRoot

F452697

General Info

Members	Datasets	Scaffolds	Average Seq Length
482	287	444	427

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8003400568\|8003404467
Length	500
Sequence	RSPAHAPHFRFRPLPAAITALAAAAGLLGGSAIVSPAFAQTAQTAQTAQTAKTAQTAKTAQTAQTTQAVSAPASQSQPTIGDPALHAQIETRAKAAEARLIAWRRDIHQHPELGNYEVRTAKLVADHLRKLGMEVKTGVAKTGVVGLLKGGKPGPVVALRADMDALPVKERVDVPFASKAKGKYLGKEVDVMHACGHDTHVAILMATAEVLAGMKDQLPGTVKFIFQPAEESPADIEPDGTNIWGAKQMVAEGVLENPKVDAIFGLHVSSGIESGKLAWRSGPAMAAADQFWIDVKGRQTHGARPWGGIDPIVVSSQIVLGLQTIQSRQVNAMLEPSVITVGTIHGGNRMNIVPEKVEMMGTIRTYDEGMKKDIHARMKRTTESIAASSGAEATFRVVELYNATVNQPALTEKMAPTLKRVAGDGNWMLAPKATASEDFSFYQEKVPGLFFNLGVTPKGTDVTKAPSNHSPEFYVDEPALINGVRALSNLTVDYMTMAQR

Samples

	Sample ID	Description	Type	Environment
1	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
2	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
3	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
4	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
5	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
6	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
7	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
8	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
9	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
10	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
11	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
12	2643221598	Phenylobacterium sp. Root700	Isolate	Unclassified
13	2643221614	Phenylobacterium sp. Root77	Isolate	Unclassified
14	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
15	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
16	2643221661	Phenylobacterium sp. Root1277	Isolate	Unclassified
17	2643221666	Phenylobacterium sp. Root1290	Isolate	Unclassified
18	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
19	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
20	2818991435	Caulobacter henricii 536	Isolate	Unclassified
21	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
22	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
23	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
24	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
25	2849560528	Caulobacter zeae 410	Isolate	Unclassified
26	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
27	2851153111	Caulobacter radicis 736	Isolate	Unclassified
28	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
29	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
30	2858950400	Achromobacter sp. K91	Isolate	Unclassified
31	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
32	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
33	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
34	2901300506	Cupriavidus sp. UYMSc13B	Isolate	Unclassified
35	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
36	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
37	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
38	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
39	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
40	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
41	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
42	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
43	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
44	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
45	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
46	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
47	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
48	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
49	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
50	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
51	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
52	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
53	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
54	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
55	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
56	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
57	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
58	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
59	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
60	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
61	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
62	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
63	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
64	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
65	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
66	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
67	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
68	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
69	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
70	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
71	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
72	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
73	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
74	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
75	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
76	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
77	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
78	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
79	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
80	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
81	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
82	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
83	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
84	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
85	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
86	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
87	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
88	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
89	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
90	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
92	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
93	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
94	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
95	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
96	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
97	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
98	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
99	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
101	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
102	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
103	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
104	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
105	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
106	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
107	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
108	3300009979	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG	Metagenome	Rhizosphere
109	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
110	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
111	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
112	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
113	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
114	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
115	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
116	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
117	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
118	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
119	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
120	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
122	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
125	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
128	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
164	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
168	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
169	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
170	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
171	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
172	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
173	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
174	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
175	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
176	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
177	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
178	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
179	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
180	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
181	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
182	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
183	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
184	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
185	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
186	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
187	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
188	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
189	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
190	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
191	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
192	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
193	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
194	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
195	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
196	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
197	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
198	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
199	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
200	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
201	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
202	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
203	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
204	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
205	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
206	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
207	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
208	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
209	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
210	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
211	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
212	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
213	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
214	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
215	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
216	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
217	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
218	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
219	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
220	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
221	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
222	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
223	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
224	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
225	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
226	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
227	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
228	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
229	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
230	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
231	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
232	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
233	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
234	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
235	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
236	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
237	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
240	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
241	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
242	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
243	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
244	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
247	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
248	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
253	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
254	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
257	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
258	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
259	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
260	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
261	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
262	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
263	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
264	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
265	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
266	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
267	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
268	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
269	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
270	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
271	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
272	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
273	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
274	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
275	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
276	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
277	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
278	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
279	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
280	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
281	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
282	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
283	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
284	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
285	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
286	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
287	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.12
Metatranscriptomes	0
Isolates	7.88

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.66
Nodule	1.04
Rhizoplane	3.11
Rhizosphere	70.33
Stem	0
Stem Tuber	0
Unclassified	12.86

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10004046	3300003187	Bacteria	7864
2	Ga0055537_1003315	3300003773	Bacteria	4991
3	Ga0055524_1021748	3300003775	Bacteria	2115
4	Ga0055536_1006198	3300003781	Bacteria	5649
5	Ga0055536_1006624	3300003781	Bacteria	5339
6	Ga0055536_1015937	3300003781	Bacteria	2541
7	Ga0055530_10008211	3300003791	Bacteria	4223
8	Ga0055530_10025688	3300003791	Bacteria	1640
9	Ga0055531_10006317	3300003794	Bacteria	6745
10	Ga0055531_10010864	3300003794	Bacteria	4470
11	Ga0065165_1001315	3300005262	Bacteria	27750
12	Ga0065712_10070771	3300005290	Bacteria	5724
13	Ga0065715_10001439	3300005293	Bacteria	8048
14	Ga0070690_100019986	3300005330	Bacteria	4076
15	Ga0070670_100002549	3300005331	Bacteria	15038
16	Ga0070670_100004943	3300005331	Bacteria	11215
17	Ga0070670_100009504	3300005331	Bacteria	8300
18	Ga0070670_100029399	3300005331	Bacteria	4731
19	Ga0070670_100122082	3300005331	Bacteria	2247
20	Ga0070670_100130844	3300005331	Bacteria	2167
21	Ga0068869_100067325	3300005334	Bacteria	2642
22	Ga0070666_10032576	3300005335	Bacteria	3443
23	Ga0068868_100161894	3300005338	Bacteria	1848
24	Ga0070689_100005098	3300005340	Bacteria	8939
25	Ga0070689_100038191	3300005340	Bacteria	3673
26	Ga0070661_100004864	3300005344	Bacteria	9248
27	Ga0070661_100040730	3300005344	Bacteria	3390
28	Ga0070661_100204657	3300005344	Bacteria	1509
29	Ga0070692_10006179	3300005345	Bacteria	5180
30	Ga0070668_100041655	3300005347	Bacteria	3519
31	Ga0070668_100065563	3300005347	Bacteria	2817
32	Ga0070668_100103195	3300005347	Unclassified	2262
33	Ga0070669_100007215	3300005353	Bacteria	7982
34	Ga0070669_100012176	3300005353	Bacteria	6106
35	Ga0070675_100001536	3300005354	Bacteria	17075
36	Ga0070675_100002818	3300005354	Bacteria	13105
37	Ga0070675_100033656	3300005354	Bacteria	4156
38	Ga0070675_100044020	3300005354	Bacteria	3650
39	Ga0070675_100113741	3300005354	Bacteria	2292
40	Ga0070671_100082027	3300005355	Bacteria	2696
41	Ga0070673_100000343	3300005364	Bacteria	24535
42	Ga0070673_100005247	3300005364	Bacteria	8271
43	Ga0070688_100001041	3300005365	Bacteria	13961
44	Ga0070667_100033548	3300005367	Bacteria	4292
45	Ga0070667_100046323	3300005367	Bacteria	3658
46	Ga0070700_100039662	3300005441	Bacteria	2878
47	Ga0070700_100046775	3300005441	Bacteria	2675
48	Ga0070694_100000300	3300005444	Bacteria	26523
49	Ga0070662_100021599	3300005457	Bacteria	4397
50	Ga0068867_100047889	3300005459	Bacteria	3144
51	Ga0068867_100050611	3300005459	Bacteria	3062
52	Ga0070707_100000065	3300005468	Bacteria	95519
53	Ga0070699_100235891	3300005518	Bacteria	1632
54	Ga0070684_100000400	3300005535	Bacteria	29645
55	Ga0070672_100004990	3300005543	Bacteria	8745
56	Ga0070672_100026888	3300005543	Bacteria	4288
57	Ga0070672_100074896	3300005543	Bacteria	2701
58	Ga0070672_100102441	3300005543	Bacteria	2323
59	Ga0070672_100124355	3300005543	Bacteria	2114
60	Ga0070686_100001547	3300005544	Bacteria	12928
61	Ga0070695_100102453	3300005545	Bacteria	1930
62	Ga0070665_100063836	3300005548	Bacteria	3692
63	Ga0070704_100116547	3300005549	Bacteria	2043
64	Ga0070664_100006400	3300005564	Bacteria	9497
65	Ga0068857_100008698	3300005577	Bacteria	8787
66	Ga0068857_100010570	3300005577	Bacteria	8025
67	Ga0068857_100017548	3300005577	Bacteria	6275
68	Ga0068857_100027574	3300005577	Bacteria	5010
69	Ga0068856_100040454	3300005614	Bacteria	4580
70	Ga0070702_100015392	3300005615	Bacteria	3905
71	Ga0068859_100001499	3300005617	Bacteria	23784
72	Ga0068859_100013452	3300005617	Bacteria	8206
73	Ga0068859_100398084	3300005617	Unclassified	1473
74	Ga0068864_100002261	3300005618	Bacteria	15918
75	Ga0068864_100003344	3300005618	Bacteria	13257
76	Ga0068864_100015484	3300005618	Bacteria	6340
77	Ga0068861_100001976	3300005719	Bacteria	13228
78	Ga0068861_100011137	3300005719	Bacteria	6244
79	Ga0068861_100043761	3300005719	Bacteria	3363
80	Ga0068851_10025199	3300005834	Bacteria	2917
81	Ga0068870_10012554	3300005840	Bacteria	3962
82	Ga0068870_10036946	3300005840	Bacteria	2515
83	Ga0068863_100006103	3300005841	Bacteria	11819
84	Ga0068863_100009076	3300005841	Bacteria	9710
85	Ga0068863_100074237	3300005841	Bacteria	3217
86	Ga0068858_100046526	3300005842	Bacteria	4021
87	Ga0068858_100202477	3300005842	Bacteria	1877
88	Ga0068860_100012025	3300005843	Bacteria	8525
89	Ga0068860_100023765	3300005843	Bacteria	5925
90	Ga0068860_100190403	3300005843	Unclassified	1985
91	Ga0068862_100003542	3300005844	Bacteria	13388
92	Ga0068862_100003666	3300005844	Bacteria	13139
93	Ga0068862_100016887	3300005844	Bacteria	6074
94	Ga0068862_100241863	3300005844	Bacteria	1641
95	Ga0081455_10106195	3300005937	Bacteria	2242
96	Ga0081539_10005403	3300005985	Bacteria	13073
97	Ga0075363_100005597	3300006048	Bacteria	5610
98	Ga0075369_10005345	3300006186	Bacteria	4789
99	Ga0075366_10017203	3300006195	Bacteria	4159
100	Ga0097621_100000586	3300006237	Bacteria	25626
101	Ga0097621_100040443	3300006237	Bacteria	3748
102	Ga0068871_100001603	3300006358	Bacteria	15221
103	Ga0068871_100005351	3300006358	Bacteria	8997
104	Ga0075428_100001733	3300006844	Bacteria	23283
105	Ga0075428_100007897	3300006844	Bacteria	11795
106	Ga0075428_100037664	3300006844	Bacteria	5322
107	Ga0075430_100007041	3300006846	Bacteria	9482
108	Ga0075430_100040088	3300006846	Bacteria	3964
109	Ga0075430_100046661	3300006846	Bacteria	3659
110	Ga0075430_100179281	3300006846	Bacteria	1762
111	Ga0075431_100000001	3300006847	Bacteria	200168
112	Ga0075431_100006494	3300006847	Bacteria	11608
113	Ga0075431_100027806	3300006847	Bacteria	5805
114	Ga0075431_100088861	3300006847	Bacteria	3189
115	Ga0075431_100129997	3300006847	Unclassified	2598
116	Ga0075433_10163095	3300006852	Bacteria	1984
117	Ga0075434_100013575	3300006871	Bacteria	7761
118	Ga0075434_100156010	3300006871	Bacteria	2302
119	Ga0075434_100205111	3300006871	Bacteria	1991
120	Ga0075429_100004981	3300006880	Bacteria	11440
121	Ga0075429_100044681	3300006880	Bacteria	3853
122	Ga0075436_100011764	3300006914	Bacteria	6007
123	Ga0097620_100001499	3300006931	Bacteria	23784
124	Ga0075435_100086681	3300007076	Bacteria	2579
125	Ga0111539_10000468	3300009094	Bacteria	50826
126	Ga0111539_10011118	3300009094	Bacteria	11326
127	Ga0111539_10022238	3300009094	Bacteria	7795
128	Ga0111539_10062114	3300009094	Bacteria	4424
129	Ga0111539_10099621	3300009094	Bacteria	3412
130	Ga0105245_10044206	3300009098	Bacteria	3975
131	Ga0114129_10001478	3300009147	Bacteria	31837
132	Ga0114129_10002156	3300009147	Bacteria	27129
133	Ga0114129_10048962	3300009147	Bacteria	5940
134	Ga0114129_10078823	3300009147	Bacteria	4581
135	Ga0114129_10230172	3300009147	Bacteria	2496
136	Ga0114129_10465525	3300009147	Bacteria	1656
137	Ga0105243_10181754	3300009148	Bacteria	1830
138	Ga0105242_10114977	3300009176	Bacteria	2300
139	Ga0105242_10145650	3300009176	Bacteria	2060
140	Ga0105248_10006711	3300009177	Bacteria	12623
141	Ga0105248_10152661	3300009177	Bacteria	2606
142	Ga0105248_10175007	3300009177	Bacteria	2419
143	Ga0105248_10193479	3300009177	Unclassified	2292
144	Ga0105249_10000703	3300009553	Bacteria	30325
145	Ga0105249_10006723	3300009553	Bacteria	10015
146	Ga0105249_10095759	3300009553	Bacteria	2784
147	Ga0105032_100113	3300009979	Bacteria	8394
148	Ga0157378_10083577	3300013297	Bacteria	2890
149	Ga0163162_10052587	3300013306	Bacteria	4091
150	Ga0157375_10000118	3300013308	Bacteria	77255
151	Ga0157375_10030149	3300013308	Bacteria	5111
152	Ga0157375_10074914	3300013308	Bacteria	3407
153	Ga0157375_10085699	3300013308	Bacteria	3200
154	Ga0163163_10001049	3300014325	Bacteria	23401
155	Ga0157380_10041852	3300014326	Bacteria	3578
156	Ga0157380_10060525	3300014326	Bacteria	3026
157	Ga0157379_10091022	3300014968	Bacteria	2736
158	Ga0157379_10143368	3300014968	Unclassified	2154
159	Ga0157376_10000378	3300014969	Bacteria	29031
160	Ga0157376_10066518	3300014969	Bacteria	3046
161	Ga0182007_10013941	3300015262	Bacteria	3047
162	Ga0213876_10000142	3300021384	Bacteria	77431
163	Ga0213876_10057338	3300021384	Bacteria	2056
164	Ga0209759_1005615	3300025256	Bacteria	4346
165	Ga0209565_1000469	3300025263	Bacteria	30315
166	Ga0209673_1001526	3300025273	Bacteria	21165
167	Ga0209675_1010694	3300025291	Bacteria	3109
168	Ga0209676_1000035	3300025292	Bacteria	459284
169	Ga0209676_1000691	3300025292	Bacteria	47509
170	Ga0209676_1001269	3300025292	Bacteria	26245
171	Ga0209676_1002398	3300025292	Bacteria	13402
172	Ga0209676_1007674	3300025292	Bacteria	4997
173	Ga0209025_1000021	3300025294	Bacteria	593083
174	Ga0209564_1001610	3300025295	Bacteria	21907
175	Ga0209758_1001228	3300025297	Bacteria	32082
176	Ga0209758_1009411	3300025297	Bacteria	6080
177	Ga0209050_1001896	3300025298	Bacteria	20030
178	Ga0209050_1006193	3300025298	Bacteria	7185
179	Ga0209050_1012461	3300025298	Bacteria	3895
180	Ga0209256_1004179	3300025299	Bacteria	9305
181	Ga0209256_1004748	3300025299	Bacteria	8300
182	Ga0209257_1000187	3300025304	Bacteria	154077
183	Ga0209257_1003467	3300025304	Bacteria	13476
184	Ga0207656_10018978	3300025321	Bacteria	2715
185	Ga0207682_10006911	3300025893	Bacteria	4550
186	Ga0207682_10012494	3300025893	Bacteria	3313
187	Ga0207682_10025714	3300025893	Bacteria	2335
188	Ga0207642_10008588	3300025899	Bacteria	3514
189	Ga0207680_10012174	3300025903	Bacteria	4374
190	Ga0207645_10067030	3300025907	Bacteria	2294
191	Ga0207643_10005751	3300025908	Bacteria	6630
192	Ga0207643_10008806	3300025908	Bacteria	5415
193	Ga0207643_10043453	3300025908	Bacteria	2536
194	Ga0207684_10007207	3300025910	Bacteria	10048
195	Ga0207649_10002046	3300025920	Bacteria	11467
196	Ga0207646_10000162	3300025922	Bacteria	90943
197	Ga0207646_10096627	3300025922	Bacteria	2647
198	Ga0207681_10178601	3300025923	Bacteria	1615
199	Ga0207650_10009236	3300025925	Bacteria	6737
200	Ga0207650_10022418	3300025925	Bacteria	4469
201	Ga0207650_10051372	3300025925	Bacteria	3051
202	Ga0207650_10139729	3300025925	Bacteria	1903
203	Ga0207659_10005678	3300025926	Bacteria	7592
204	Ga0207659_10054746	3300025926	Bacteria	2850
205	Ga0207659_10061610	3300025926	Bacteria	2705
206	Ga0207659_10291244	3300025926	Bacteria	1338
207	Ga0207687_10092264	3300025927	Bacteria	2211
208	Ga0207644_10007613	3300025931	Bacteria	7061
209	Ga0207644_10034509	3300025931	Bacteria	3540
210	Ga0207706_10005871	3300025933	Bacteria	11423
211	Ga0207706_10038897	3300025933	Bacteria	4219
212	Ga0207686_10046239	3300025934	Bacteria	2683
213	Ga0207670_10002126	3300025936	Bacteria	10358
214	Ga0207669_10012632	3300025937	Bacteria	4160
215	Ga0207691_10005307	3300025940	Bacteria	12438
216	Ga0207691_10013482	3300025940	Bacteria	7821
217	Ga0207691_10020243	3300025940	Bacteria	6292
218	Ga0207691_10024536	3300025940	Bacteria	5671
219	Ga0207691_10052934	3300025940	Bacteria	3707
220	Ga0207651_10005825	3300025960	Bacteria	6370
221	Ga0207651_10006508	3300025960	Bacteria	6127
222	Ga0207712_10051860	3300025961	Bacteria	2871
223	Ga0207668_10030802	3300025972	Bacteria	3528
224	Ga0207668_10048566	3300025972	Bacteria	2913
225	Ga0207668_10065684	3300025972	Bacteria	2569
226	Ga0207640_10197875	3300025981	Bacteria	1520
227	Ga0207658_10015144	3300025986	Bacteria	5289
228	Ga0207658_10040336	3300025986	Bacteria	3374
229	Ga0207658_10102365	3300025986	Bacteria	2246
230	Ga0207677_10021297	3300026023	Bacteria	3958
231	Ga0207703_10184135	3300026035	Bacteria	1845
232	Ga0207678_10047811	3300026067	Bacteria	3699
233	Ga0207708_10018725	3300026075	Bacteria	5216
234	Ga0207708_10053437	3300026075	Bacteria	3078
235	Ga0207641_10002775	3300026088	Bacteria	15958
236	Ga0207641_10007153	3300026088	Bacteria	9319
237	Ga0207641_10092044	3300026088	Bacteria	2655
238	Ga0207648_10024621	3300026089	Bacteria	5369
239	Ga0207648_10028260	3300026089	Bacteria	4974
240	Ga0207648_10067437	3300026089	Bacteria	3119
241	Ga0207676_10003185	3300026095	Bacteria	11690
242	Ga0207676_10004425	3300026095	Bacteria	9933
243	Ga0207674_10014023	3300026116	Bacteria	8858
244	Ga0207674_10024028	3300026116	Bacteria	6517
245	Ga0207674_10081436	3300026116	Bacteria	3239
246	Ga0207674_10164555	3300026116	Bacteria	2172
247	Ga0207675_100001118	3300026118	Bacteria	26568
248	Ga0207675_100015366	3300026118	Bacteria	7140
249	Ga0207675_100021394	3300026118	Bacteria	6025
250	Ga0207675_100032453	3300026118	Bacteria	4864
251	Ga0207683_10004615	3300026121	Bacteria	11873
252	Ga0207683_10028758	3300026121	Bacteria	4808
253	Ga0207428_10003234	3300027907	Bacteria	15908
254	Ga0207428_10017493	3300027907	Bacteria	6149
255	Ga0207428_10026605	3300027907	Bacteria	4827
256	Ga0207428_10031987	3300027907	Bacteria	4333
257	Ga0207428_10049829	3300027907	Bacteria	3353
258	Ga0268266_10071351	3300028379	Bacteria	3010
259	Ga0268266_10118812	3300028379	Bacteria	2350
260	Ga0268265_10001267	3300028380	Bacteria	21801
261	Ga0268265_10018570	3300028380	Bacteria	4821
262	Ga0268265_10032388	3300028380	Bacteria	3787
263	Ga0268265_10073534	3300028380	Bacteria	2670
264	Ga0268264_10101941	3300028381	Bacteria	2497
265	Ga0307517_10000058	3300028786	Bacteria	148725
266	Ga0307515_10014689	3300028794	Bacteria	14492
267	Ga0307515_10041817	3300028794	Bacteria	7192
268	Ga0307515_10076420	3300028794	Bacteria	4443
269	Ga0307515_10090082	3300028794	Bacteria	3852
270	Ga0307515_10123440	3300028794	Bacteria	2913
271	Ga0307513_10005622	3300031456	Bacteria	16527
272	Ga0307513_10012688	3300031456	Bacteria	10375
273	Ga0307509_10152348	3300031507	Bacteria	2225
274	Ga0307408_100152479	3300031548	Bacteria	1826
275	Ga0307508_10001441	3300031616	Bacteria	26778
276	Ga0307516_10001192	3300031730	Bacteria	36321
277	Ga0307410_10021305	3300031852	Bacteria	3984
278	Ga0307407_10084993	3300031903	Bacteria	1924
279	Ga0307412_10055170	3300031911	Bacteria	2642
280	Ga0307409_100080369	3300031995	Bacteria	2630
281	Ga0307409_100254035	3300031995	Bacteria	1609
282	Ga0307416_100046737	3300032002	Bacteria	3419
283	Ga0307415_100095858	3300032126	Bacteria	2161
284	Ga0307510_10018632	3300033180	Bacteria	8163
285	Ga0373936_0004100	3300035113	Bacteria	5486
286	Ga0373939_0009243	3300035114	Bacteria	2441
287	Ga0373943_0004588	3300035170	Bacteria	6241
288	Ga0373946_0042641	3300035171	Bacteria	1866
289	Ga0373931_0031054	3300035691	Bacteria	2754
290	Ga0373935_0015263	3300035692	Bacteria	4641
291	Ga0373947_0001491	3300035725	Bacteria	14353
292	Ga0373925_0013274	3300037068	Bacteria	5962
293	Ga0395905_0002335	3300037471	Bacteria	21169
294	Ga0400483_114185	3300039062	Bacteria	1921
295	Ga0436365_0085195	3300039437	Bacteria	2166
296	Ga0436365_0087353	3300039437	Bacteria	57993
297	Ga0436365_0134020	3300039437	Bacteria	1769
298	Ga0451791_0225305	3300041451	Bacteria	2472
299	Ga0451807_0557744	3300041486	Bacteria	2047
300	Ga0451807_0978577	3300041486	Bacteria	5364
301	Ga0451837_0678773	3300041494	Bacteria	2261
302	Ga0451843_0318638	3300041509	Bacteria	1658
303	Ga0439442_012434	3300042002	Bacteria	1741
304	Ga0439435_0009806	3300042436	Bacteria	2256
305	Ga0451577_0010772	3300042876	Bacteria	8699
306	Ga0453684_0246443	3300044712	Bacteria	2054
307	Ga0495590_0055205	3300046457	Bacteria	1388
308	Ga0495629_0067830	3300046459	Bacteria	2489
309	Ga0495638_0000845	3300046460	Bacteria	32033
310	Ga0495638_0002190	3300046460	Bacteria	16335
311	Ga0495638_0019642	3300046460	Bacteria	4469
312	Ga0495650_0000030	3300046471	Bacteria	436318
313	Ga0495650_0013322	3300046471	Bacteria	4355
314	Ga0495605_0075647	3300046474	Bacteria	1583
315	Ga0495583_0000002	3300046506	Bacteria	782521
316	Ga0495610_0000091	3300046512	Bacteria	105916
317	Ga0495610_0014477	3300046512	Bacteria	4630
318	Ga0495610_0036104	3300046512	Bacteria	2529
319	Ga0495616_0000094	3300046513	Bacteria	75611
320	Ga0495616_0059373	3300046513	Bacteria	1881
321	Ga0495620_0007802	3300046515	Bacteria	5782
322	Ga0495628_0054232	3300046516	Bacteria	3161
323	Ga0495632_0005026	3300046519	Bacteria	8859
324	Ga0495632_0025043	3300046519	Bacteria	3160
325	Ga0495632_0070490	3300046519	Bacteria	1681
326	Ga0495637_0012325	3300046520	Bacteria	4093
327	Ga0495643_0023681	3300046522	Bacteria	3488
328	Ga0495648_0047718	3300046524	Bacteria	2644
329	Ga0495654_0000048	3300046530	Bacteria	147348
330	Ga0495668_0000703	3300046616	Bacteria	40297
331	Ga0495668_0008073	3300046616	Bacteria	6629
332	Ga0495668_0013065	3300046616	Bacteria	4913
333	Ga0495668_0014556	3300046616	Bacteria	4607
334	Ga0495625_0000058	3300046660	Bacteria	180863
335	Ga0495625_0012736	3300046660	Bacteria	6801
336	Ga0495625_0018521	3300046660	Bacteria	5433
337	Ga0495635_0106523	3300046663	Bacteria	1915
338	Ga0495661_0000458	3300046665	Bacteria	43236
339	Ga0495613_0139886	3300046689	Bacteria	1730
340	Ga0495660_0007868	3300046810	Bacteria	6259
341	Ga0495674_0097372	3300047319	Bacteria	2506
342	Ga0495672_0022241	3300047320	Bacteria	4125
343	Ga0495687_009412	3300047443	Bacteria	5463
344	Ga0495687_015914	3300047443	Bacteria	3801
345	Ga0495673_0001111	3300047469	Bacteria	23151
346	Ga0495673_0001399	3300047469	Bacteria	19397
347	Ga0495673_0024171	3300047469	Bacteria	2942
348	Ga0495673_0099990	3300047469	Bacteria	1174
349	Ga0495686_0119546	3300047472	Bacteria	1572
350	Ga0496101_0030488	3300048904	Bacteria	3782
351	Ga0496102_0055930	3300048905	Bacteria	3598
352	Ga0496106_0160973	3300048909	Bacteria	1775
353	Ga0496107_0000188	3300048910	Bacteria	32167
354	Ga0496108_0026311	3300048911	Bacteria	4798
355	Ga0496108_0033902	3300048911	Bacteria	4241
356	Ga0496109_0000061	3300048912	Bacteria	114091
357	Ga0496109_0032072	3300048912	Bacteria	4720
358	Ga0496109_0143516	3300048912	Bacteria	2233
359	Ga0496113_0008823	3300048916	Bacteria	6586
360	Ga0496114_0000301	3300048917	Bacteria	36310
361	Ga0496115_0003924	3300048918	Bacteria	10719
362	Ga0496116_0003236	3300048919	Bacteria	16218
363	Ga0496118_0005662	3300048921	Bacteria	14080
364	Ga0496120_0003222	3300048923	Bacteria	15145
365	Ga0496121_0000145	3300048924	Bacteria	156655
366	Ga0496121_0026081	3300048924	Bacteria	5522
367	Ga0496121_0028412	3300048924	Bacteria	5205
368	Ga0496122_0000029	3300048925	Bacteria	336396
369	Ga0496122_0006328	3300048925	Bacteria	13631
370	Ga0496123_0000216	3300048926	Bacteria	117098
371	Ga0496123_0043204	3300048926	Bacteria	3099
372	Ga0496124_0038215	3300048927	Bacteria	4169
373	Ga0496124_0039155	3300048927	Bacteria	4111
374	Ga0496125_0000560	3300048928	Bacteria	64063
375	Ga0496125_0000706	3300048928	Bacteria	55374
376	Ga0496125_0028269	3300048928	Bacteria	5069
377	Ga0496126_0011904	3300048929	Bacteria	8947
378	Ga0496126_0012930	3300048929	Bacteria	8522
379	Ga0496126_0016315	3300048929	Bacteria	7431
380	Ga0496126_0040740	3300048929	Bacteria	4305
381	Ga0501034_0000444	3300049571	Bacteria	68426
382	Ga0501034_0057026	3300049571	Bacteria	3928
383	Ga0501039_0197882	3300049575	Bacteria	1580
384	Ga0501046_0163748	3300049580	Bacteria	1672
385	Ga0501048_0114910	3300049582	Bacteria	1901
386	Ga0501068_0004390	3300049584	Bacteria	7674
387	Ga0501072_0009274	3300049588	Bacteria	7477
388	Ga0501073_0000407	3300049589	Bacteria	29387
389	Ga0501074_0084213	3300049590	Bacteria	2279
390	Ga0501080_0004932	3300049742	Bacteria	11890
391	Ga0501080_0154646	3300049742	Bacteria	2119
392	Ga0501081_0046212	3300049743	Bacteria	2992
393	Ga0501083_0059927	3300049744	Bacteria	2545
394	Ga0501045_0031466	3300049824	Bacteria	3843
395	nmdc:mga0k408_41990_c1	3300050493	Bacteria	2634
396	nmdc:mga0k408_50757_c1	3300050493	Bacteria	2402
397	nmdc:mga0k408_95017_c1	3300050493	Bacteria	1753
398	nmdc:mga07m45_1604_c1	3300050496	Bacteria	10411
399	nmdc:mga07m45_82064_c1	3300050496	Bacteria	1841
400	nmdc:mga05p37_11320_c1	3300050507	Bacteria	10612
401	nmdc:mga05p37_15473_c1	3300050507	Bacteria	9169
402	nmdc:mga05p37_205815_c1	3300050507	Bacteria	2380
403	nmdc:mga05p37_26586_c1	3300050507	Bacteria	7037
404	nmdc:mga09592_624_c1	3300050508	Bacteria	27050
405	nmdc:mga0qj67_33729_c1	3300050509	Bacteria	3996
406	nmdc:mga0qj67_5622_c1	3300050509	Bacteria	9165
407	nmdc:mga0qj67_63205_c1	3300050509	Bacteria	2944
408	nmdc:mga06r32_13_c1	3300050510	Bacteria	110292
409	nmdc:mga06r32_229435_c1	3300050510	Bacteria	1844
410	nmdc:mga06r32_8202_c1	3300050510	Bacteria	9402
411	nmdc:mga08y16_145143_c1	3300050511	Bacteria	2467
412	nmdc:mga08y16_1569_c1	3300050511	Bacteria	23063
413	nmdc:mga08y16_227425_c1	3300050511	Bacteria	1930
414	nmdc:mga08y16_41003_c1	3300050511	Bacteria	4850
415	nmdc:mga0n895_42043_c1	3300050512	Bacteria	4445
416	nmdc:mga0n895_91564_c1	3300050512	Bacteria	3043
417	nmdc:mga0rr50_156578_c1	3300050513	Bacteria	1846
418	nmdc:mga08x19_3428_c1	3300050514	Bacteria	9452
419	nmdc:mga0a205_329464_c1	3300050515	Bacteria	1397
420	Ga0495595_0039653	3300053084	Bacteria	2150
421	Ga0495619_0163296	3300053085	Bacteria	1539
422	Ga0500578_0001504	3300053086	Bacteria	23136
423	Ga0500644_0000340	3300053088	Bacteria	23717
424	Ga0500644_0009741	3300053088	Bacteria	2580
425	Ga0500583_0060272	3300053092	Bacteria	1789
426	Ga0500651_0003289	3300053093	Bacteria	8800
427	Ga0500554_000965	3300053102	Bacteria	5595
428	Ga0500556_0011903	3300053104	Bacteria	2587
429	Ga0500562_006111	3300053108	Bacteria	3033
430	Ga0500594_0000137	3300053118	Bacteria	20341
431	Ga0500594_0003531	3300053118	Bacteria	3442
432	Ga0500608_000007	3300053122	Bacteria	100296
433	Ga0500658_0002823	3300053134	Bacteria	6666
434	Ga0500658_0004233	3300053134	Bacteria	5383
435	Ga0500559_0000079	3300053136	Bacteria	75437
436	Ga0500559_0006240	3300053136	Bacteria	5395
437	Ga0500564_020552	3300053138	Bacteria	3020
438	Ga0500577_0006022	3300053142	Bacteria	3311
439	Ga0500622_0000173	3300053156	Bacteria	69414
440	Ga0500622_0003592	3300053156	Bacteria	10223
441	Ga0500622_0028104	3300053156	Bacteria	2961
442	Ga0500627_0015757	3300053158	Bacteria	2931
443	Ga0500609_001233	3300053731	Bacteria	3811
444	Ga0500587_002285	3300053739	Bacteria	2730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025899	Ga0207642_10008588	Ga0207642_100085881	342
2	3300047469	Ga0495673_0099990	Ga0495673_0099990_27_1145	359
3	3300005344	Ga0070661_100204657	Ga0070661_1002046571	364
4	3300005347	Ga0070668_100065563	Ga0070668_1000655632	364
5	3300005441	Ga0070700_100039662	Ga0070700_1000396622	364
6	3300005457	Ga0070662_100021599	Ga0070662_1000215993	364
7	3300005577	Ga0068857_100027574	Ga0068857_1000275743	364
8	3300005719	Ga0068861_100001976	Ga0068861_1000019766	364
9	3300005844	Ga0068862_100003666	Ga0068862_1000036665	364
10	3300009094	Ga0111539_10011118	Ga0111539_100111185	364
11	3300009553	Ga0105249_10006723	Ga0105249_100067235	364
12	3300025908	Ga0207643_10008806	Ga0207643_100088066	364
13	3300025933	Ga0207706_10005871	Ga0207706_100058713	364
14	3300025972	Ga0207668_10048566	Ga0207668_100485662	364
15	3300025981	Ga0207640_10197875	Ga0207640_101978751	364
16	3300026075	Ga0207708_10053437	Ga0207708_100534372	364
17	3300026116	Ga0207674_10164555	Ga0207674_101645552	364
18	3300026118	Ga0207675_100001118	Ga0207675_10000111818	364
19	3300027907	Ga0207428_10031987	Ga0207428_100319872	364
20	3300028380	Ga0268265_10001267	Ga0268265_1000126714	364
21	3300006846	Ga0075430_100007041	Ga0075430_1000070414	365
22	3300050509	nmdc:mga0qj67_5622_c1	nmdc:mga0qj67_5622_c1_31_1389	365
23	3300006847	Ga0075431_100006494	Ga0075431_1000064941	370
24	3300050510	nmdc:mga06r32_229435_c1	nmdc:mga06r32_229435_c1_81_1451	370
25	3300053085	Ga0495619_0163296	Ga0495619_0163296_226_1506	371
26	3300005290	Ga0065712_10070771	Ga0065712_100707713	373
27	3300005293	Ga0065715_10001439	Ga0065715_100014394	373
28	3300005330	Ga0070690_100019986	Ga0070690_1000199863	373
29	3300005331	Ga0070670_100009504	Ga0070670_1000095044	373
30	3300005340	Ga0070689_100005098	Ga0070689_1000050984	373
31	3300005344	Ga0070661_100004864	Ga0070661_1000048645	373
32	3300005353	Ga0070669_100012176	Ga0070669_1000121764	373
33	3300005354	Ga0070675_100002818	Ga0070675_1000028185	373
34	3300005364	Ga0070673_100000343	Ga0070673_10000034313	373
35	3300005365	Ga0070688_100001041	Ga0070688_1000010413	373
36	3300005367	Ga0070667_100046323	Ga0070667_1000463232	373
37	3300005441	Ga0070700_100046775	Ga0070700_1000467752	373
38	3300005459	Ga0068867_100050611	Ga0068867_1000506112	373
39	3300005543	Ga0070672_100004990	Ga0070672_1000049905	373
40	3300005544	Ga0070686_100001547	Ga0070686_10000154710	373
41	3300005548	Ga0070665_100063836	Ga0070665_1000638362	373
42	3300005564	Ga0070664_100006400	Ga0070664_1000064002	373
43	3300005615	Ga0070702_100015392	Ga0070702_1000153922	373
44	3300005617	Ga0068859_100001499	Ga0068859_10000149913	373
45	3300005618	Ga0068864_100003344	Ga0068864_1000033449	373
46	3300005719	Ga0068861_100011137	Ga0068861_1000111372	373
47	3300005840	Ga0068870_10036946	Ga0068870_100369462	373
48	3300005841	Ga0068863_100009076	Ga0068863_1000090764	373
49	3300005842	Ga0068858_100046526	Ga0068858_1000465263	373
50	3300005842	Ga0068858_100202477	Ga0068858_1002024772	373
51	3300005843	Ga0068860_100012025	Ga0068860_1000120257	373
52	3300005844	Ga0068862_100003542	Ga0068862_1000035425	373
53	3300006931	Ga0097620_100001499	Ga0097620_10000149913	373
54	3300009177	Ga0105248_10006711	Ga0105248_100067119	373
55	3300013308	Ga0157375_10030149	Ga0157375_100301492	373
56	3300014325	Ga0163163_10001049	Ga0163163_100010495	373
57	3300014968	Ga0157379_10091022	Ga0157379_100910222	373
58	3300025907	Ga0207645_10067030	Ga0207645_100670302	373
59	3300025908	Ga0207643_10043453	Ga0207643_100434532	373
60	3300025920	Ga0207649_10002046	Ga0207649_100020465	373
61	3300025925	Ga0207650_10022418	Ga0207650_100224182	373
62	3300025926	Ga0207659_10061610	Ga0207659_100616102	373
63	3300025936	Ga0207670_10002126	Ga0207670_100021263	373
64	3300025940	Ga0207691_10052934	Ga0207691_100529342	373
65	3300025960	Ga0207651_10006508	Ga0207651_100065082	373
66	3300025972	Ga0207668_10065684	Ga0207668_100656842	373
67	3300025986	Ga0207658_10040336	Ga0207658_100403362	373
68	3300026035	Ga0207703_10184135	Ga0207703_101841352	373
69	3300026067	Ga0207678_10047811	Ga0207678_100478112	373
70	3300026075	Ga0207708_10018725	Ga0207708_100187253	373
71	3300026088	Ga0207641_10007153	Ga0207641_100071537	373
72	3300026089	Ga0207648_10024621	Ga0207648_100246215	373
73	3300026095	Ga0207676_10004425	Ga0207676_100044257	373
74	3300026116	Ga0207674_10014023	Ga0207674_100140234	373
75	3300026118	Ga0207675_100015366	Ga0207675_1000153662	373
76	3300026121	Ga0207683_10028758	Ga0207683_100287584	373
77	3300028379	Ga0268266_10071351	Ga0268266_100713512	373
78	3300028381	Ga0268264_10101941	Ga0268264_101019411	373
79	3300048909	Ga0496106_0160973	Ga0496106_0160973_144_1484	373
80	3300048912	Ga0496109_0032072	Ga0496109_0032072_2315_3655	373
81	3300048916	Ga0496113_0008823	Ga0496113_0008823_552_1892	373
82	3300006871	Ga0075434_100156010	Ga0075434_1001560102	376
83	3300050511	nmdc:mga08y16_145143_c1	nmdc:mga08y16_145143_c1_795_2141	376
84	3300050512	nmdc:mga0n895_91564_c1	nmdc:mga0n895_91564_c1_1510_2856	376
85	3300025893	Ga0207682_10025714	Ga0207682_100257141	377
86	3300005444	Ga0070694_100000300	Ga0070694_10000030011	379
87	3300025256	Ga0209759_1005615	Ga0209759_10056152	380
88	3300028380	Ga0268265_10018570	Ga0268265_100185702	380
89	3300009979	Ga0105032_100113	Ga0105032_1001133	381
90	3300035171	Ga0373946_0042641	Ga0373946_0042641_485_1753	381
91	3300046459	Ga0495629_0067830	Ga0495629_0067830_847_2115	381
92	3300046516	Ga0495628_0054232	Ga0495628_0054232_544_1812	381
93	3300046663	Ga0495635_0106523	Ga0495635_0106523_502_1770	381
94	3300046689	Ga0495613_0139886	Ga0495613_0139886_266_1534	381
95	3300047319	Ga0495674_0097372	Ga0495674_0097372_177_1445	381
96	3300053084	Ga0495595_0039653	Ga0495595_0039653_346_1614	381
97	3300005331	Ga0070670_100002549	Ga0070670_10000254912	383
98	3300005354	Ga0070675_100113741	Ga0070675_1001137412	383
99	3300005355	Ga0070671_100082027	Ga0070671_1000820273	383
100	3300005618	Ga0068864_100015484	Ga0068864_1000154846	383
101	3300006237	Ga0097621_100040443	Ga0097621_1000404434	383
102	3300013308	Ga0157375_10074914	Ga0157375_100749144	383
103	3300014969	Ga0157376_10066518	Ga0157376_100665183	383
104	3300025925	Ga0207650_10009236	Ga0207650_100092361	383
105	3300025926	Ga0207659_10291244	Ga0207659_102912441	383
106	3300025931	Ga0207644_10034509	Ga0207644_100345093	383
107	3300025940	Ga0207691_10005307	Ga0207691_100053077	383
108	3300026088	Ga0207641_10092044	Ga0207641_100920443	383
109	3300026095	Ga0207676_10003185	Ga0207676_100031854	383
110	3300026121	Ga0207683_10004615	Ga0207683_100046157	383
111	3300048911	Ga0496108_0033902	Ga0496108_0033902_1701_2969	383
112	3300005335	Ga0070666_10032576	Ga0070666_100325762	384
113	3300005367	Ga0070667_100033548	Ga0070667_1000335485	384
114	3300006237	Ga0097621_100000586	Ga0097621_1000005868	384
115	3300006358	Ga0068871_100001603	Ga0068871_10000160310	384
116	3300009176	Ga0105242_10114977	Ga0105242_101149772	384
117	3300013297	Ga0157378_10083577	Ga0157378_100835772	384
118	3300013308	Ga0157375_10000118	Ga0157375_1000011837	384
119	3300014968	Ga0157379_10143368	Ga0157379_101433682	384
120	3300014969	Ga0157376_10000378	Ga0157376_1000037821	384
121	3300025903	Ga0207680_10012174	Ga0207680_100121743	384
122	3300025986	Ga0207658_10102365	Ga0207658_101023652	384
123	3300048904	Ga0496101_0030488	Ga0496101_0030488_2262_3557	384
124	3300005331	Ga0070670_100130844	Ga0070670_1001308441	385
125	3300005577	Ga0068857_100010570	Ga0068857_1000105703	385
126	3300009553	Ga0105249_10000703	Ga0105249_100007034	385
127	3300014326	Ga0157380_10041852	Ga0157380_100418522	385
128	3300025925	Ga0207650_10139729	Ga0207650_101397291	385
129	3300026116	Ga0207674_10081436	Ga0207674_100814363	385
130	3300005347	Ga0070668_100041655	Ga0070668_1000416552	386
131	3300005353	Ga0070669_100007215	Ga0070669_1000072153	386
132	3300005543	Ga0070672_100124355	Ga0070672_1001243552	386
133	3300005840	Ga0068870_10012554	Ga0068870_100125542	386
134	3300005844	Ga0068862_100016887	Ga0068862_1000168873	386
135	3300009094	Ga0111539_10062114	Ga0111539_100621141	386
136	3300009147	Ga0114129_10048962	Ga0114129_100489622	386
137	3300013306	Ga0163162_10052587	Ga0163162_100525872	386
138	3300025908	Ga0207643_10005751	Ga0207643_100057512	386
139	3300025972	Ga0207668_10030802	Ga0207668_100308022	386
140	3300026118	Ga0207675_100021394	Ga0207675_1000213942	386
141	3300028380	Ga0268265_10032388	Ga0268265_100323883	386
142	3300050507	nmdc:mga05p37_15473_c1	nmdc:mga05p37_15473_c1_3189_4523	386
143	3300050509	nmdc:mga0qj67_33729_c1	nmdc:mga0qj67_33729_c1_1950_3284	386
144	3300050510	nmdc:mga06r32_8202_c1	nmdc:mga06r32_8202_c1_5551_6885	386
145	3300050511	nmdc:mga08y16_227425_c1	nmdc:mga08y16_227425_c1_444_1778	386
146	3300009147	Ga0114129_10001478	Ga0114129_100014783	387
147	3300050507	nmdc:mga05p37_11320_c1	nmdc:mga05p37_11320_c1_5872_7128	387
148	3300027907	Ga0207428_10017493	Ga0207428_100174933	388
149	3300031507	Ga0307509_10152348	Ga0307509_101523481	388
150	iso_pu_bacteria	2643221598	2644000341	388
151	iso_pu_bacteria	2643221614	2644084890	388
152	iso_pu_bacteria	2643221661	2644342442	388
153	iso_pu_bacteria	2643221666	2644365742	388
154	3300009147	Ga0114129_10078823	Ga0114129_100788233	389
155	3300003781	Ga0055536_1006198	Ga0055536_10061984	390
156	3300025292	Ga0209676_1000035	Ga0209676_1000035134	390
157	3300031995	Ga0307409_100080369	Ga0307409_1000803691	390
158	3300032002	Ga0307416_100046737	Ga0307416_1000467373	390
159	3300005262	Ga0065165_1001315	Ga0065165_100131512	391
160	3300005331	Ga0070670_100004943	Ga0070670_1000049437	391
161	3300005344	Ga0070661_100040730	Ga0070661_1000407302	391
162	3300005354	Ga0070675_100033656	Ga0070675_1000336562	391
163	3300005543	Ga0070672_100026888	Ga0070672_1000268882	391
164	3300009177	Ga0105248_10152661	Ga0105248_101526612	391
165	3300013308	Ga0157375_10085699	Ga0157375_100856992	391
166	3300021384	Ga0213876_10000142	Ga0213876_1000014252	391
167	3300025295	Ga0209564_1001610	Ga0209564_10016107	391
168	3300025297	Ga0209758_1001228	Ga0209758_100122817	391
169	3300025299	Ga0209256_1004179	Ga0209256_10041798	391
170	3300025923	Ga0207681_10178601	Ga0207681_101786012	391
171	3300025925	Ga0207650_10051372	Ga0207650_100513722	391
172	3300025933	Ga0207706_10038897	Ga0207706_100388972	391
173	3300025940	Ga0207691_10013482	Ga0207691_100134822	391
174	3300039437	Ga0436365_0087353	Ga0436365_0087353_12879_14192	391
175	3300053142	Ga0500577_0006022	Ga0500577_0006022_641_1996	391
176	3300005577	Ga0068857_100017548	Ga0068857_1000175483	392
177	3300006847	Ga0075431_100027806	Ga0075431_1000278062	392
178	3300015262	Ga0182007_10013941	Ga0182007_100139413	392
179	3300026116	Ga0207674_10024028	Ga0207674_100240283	392
180	3300046616	Ga0495668_0008073	Ga0495668_0008073_44_1342	392
181	3300028794	Ga0307515_10090082	Ga0307515_100900823	393
182	3300046512	Ga0495610_0036104	Ga0495610_0036104_1032_2336	393
183	3300046513	Ga0495616_0000094	Ga0495616_0000094_66409_67704	393
184	3300046660	Ga0495625_0000058	Ga0495625_0000058_96949_98244	393
185	3300048910	Ga0496107_0000188	Ga0496107_0000188_8502_9797	393
186	3300048924	Ga0496121_0028412	Ga0496121_0028412_1839_3134	393
187	3300003773	Ga0055537_1003315	Ga0055537_10033154	394
188	3300025263	Ga0209565_1000469	Ga0209565_10004693	394
189	3300025273	Ga0209673_1001526	Ga0209673_10015265	394
190	3300025291	Ga0209675_1010694	Ga0209675_10106942	394
191	3300046460	Ga0495638_0019642	Ga0495638_0019642_2041_3336	394
192	3300048918	Ga0496115_0003924	Ga0496115_0003924_6237_7532	394
193	3300005331	Ga0070670_100122082	Ga0070670_1001220822	395
194	3300005345	Ga0070692_10006179	Ga0070692_100061792	395
195	3300005468	Ga0070707_100000065	Ga0070707_10000006553	395
196	3300005518	Ga0070699_100235891	Ga0070699_1002358911	395
197	3300005937	Ga0081455_10106195	Ga0081455_101061952	395
198	3300005985	Ga0081539_10005403	Ga0081539_100054033	395
199	3300006847	Ga0075431_100088861	Ga0075431_1000888613	395
200	3300006871	Ga0075434_100205111	Ga0075434_1002051112	395
201	3300009147	Ga0114129_10230172	Ga0114129_102301722	395
202	3300025922	Ga0207646_10000162	Ga0207646_1000016221	395
203	3300028380	Ga0268265_10073534	Ga0268265_100735341	395
204	3300028794	Ga0307515_10041817	Ga0307515_100418173	395
205	3300031456	Ga0307513_10012688	Ga0307513_100126884	395
206	3300035114	Ga0373939_0009243	Ga0373939_0009243_327_1559	395
207	3300039062	Ga0400483_114185	Ga0400483_114185_329_1567	395
208	3300039437	Ga0436365_0134020	Ga0436365_0134020_259_1584	395
209	3300046512	Ga0495610_0014477	Ga0495610_0014477_1772_3037	395
210	3300046519	Ga0495632_0005026	Ga0495632_0005026_5801_7096	395
211	3300046519	Ga0495632_0025043	Ga0495632_0025043_378_1673	395
212	3300046616	Ga0495668_0013065	Ga0495668_0013065_2136_3431	395
213	3300048912	Ga0496109_0000061	Ga0496109_0000061_8231_9541	395
214	3300050515	nmdc:mga0a205_329464_c1	nmdc:mga0a205_329464_c1_24_1334	395
215	3300053731	Ga0500609_001233	Ga0500609_001233_1821_3116	395
216	3300006844	Ga0075428_100037664	Ga0075428_1000376645	396
217	3300046460	Ga0495638_0000845	Ga0495638_0000845_7186_8481	396
218	3300046471	Ga0495650_0000030	Ga0495650_0000030_333669_334970	396
219	3300046810	Ga0495660_0007868	Ga0495660_0007868_3971_5266	396
220	3300006358	Ga0068871_100005351	Ga0068871_1000053519	397
221	3300009098	Ga0105245_10044206	Ga0105245_100442062	397
222	3300025927	Ga0207687_10092264	Ga0207687_100922642	397
223	3300047443	Ga0495687_015914	Ga0495687_015914_2475_3746	397
224	3300048917	Ga0496114_0000301	Ga0496114_0000301_33402_34715	397
225	3300048929	Ga0496126_0040740	Ga0496126_0040740_1085_2398	397
226	3300053134	Ga0500658_0002823	Ga0500658_0002823_3756_5027	397
227	3300006844	Ga0075428_100001733	Ga0075428_1000017334	398
228	3300006846	Ga0075430_100046661	Ga0075430_1000466612	398
229	3300006847	Ga0075431_100000001	Ga0075431_10000000187	398
230	3300006880	Ga0075429_100044681	Ga0075429_1000446813	398
231	3300009094	Ga0111539_10000468	Ga0111539_1000046835	398
232	3300009147	Ga0114129_10002156	Ga0114129_1000215628	398
233	3300027907	Ga0207428_10003234	Ga0207428_100032342	398
234	3300031730	Ga0307516_10001192	Ga0307516_1000119226	398
235	3300041451	Ga0451791_0225305	Ga0451791_0225305_191_1552	398
236	3300041486	Ga0451807_0557744	Ga0451807_0557744_391_1752	398
237	3300042876	Ga0451577_0010772	Ga0451577_0010772_562_1827	398
238	3300044712	Ga0453684_0246443	Ga0453684_0246443_501_1769	398
239	3300046512	Ga0495610_0000091	Ga0495610_0000091_42338_43639	398
240	3300046520	Ga0495637_0012325	Ga0495637_0012325_1152_2447	398
241	3300046660	Ga0495625_0018521	Ga0495625_0018521_2743_4038	398
242	3300047320	Ga0495672_0022241	Ga0495672_0022241_1703_3004	398
243	3300048925	Ga0496122_0006328	Ga0496122_0006328_8684_10063	398
244	3300048926	Ga0496123_0043204	Ga0496123_0043204_1021_2400	398
245	3300048928	Ga0496125_0000560	Ga0496125_0000560_6496_7875	398
246	3300050507	nmdc:mga05p37_26586_c1	nmdc:mga05p37_26586_c1_2412_3746	398
247	3300050508	nmdc:mga09592_624_c1	nmdc:mga09592_624_c1_24824_26158	398
248	3300050510	nmdc:mga06r32_13_c1	nmdc:mga06r32_13_c1_51888_53222	398
249	3300050511	nmdc:mga08y16_1569_c1	nmdc:mga08y16_1569_c1_421_1755	398
250	3300053104	Ga0500556_0011903	Ga0500556_0011903_198_1472	398
251	3300005340	Ga0070689_100038191	Ga0070689_1000381912	399
252	3300005354	Ga0070675_100001536	Ga0070675_10000153619	399
253	3300005364	Ga0070673_100005247	Ga0070673_1000052476	399
254	3300005543	Ga0070672_100074896	Ga0070672_1000748964	399
255	3300005549	Ga0070704_100116547	Ga0070704_1001165472	399
256	3300005614	Ga0068856_100040454	Ga0068856_1000404543	399
257	3300005618	Ga0068864_100002261	Ga0068864_1000022617	399
258	3300005834	Ga0068851_10025199	Ga0068851_100251991	399
259	3300005841	Ga0068863_100006103	Ga0068863_1000061039	399
260	3300005841	Ga0068863_100074237	Ga0068863_1000742373	399
261	3300006871	Ga0075434_100013575	Ga0075434_1000135753	399
262	3300006914	Ga0075436_100011764	Ga0075436_1000117642	399
263	3300007076	Ga0075435_100086681	Ga0075435_1000866812	399
264	3300009176	Ga0105242_10145650	Ga0105242_101456502	399
265	3300021384	Ga0213876_10057338	Ga0213876_100573383	399
266	3300025321	Ga0207656_10018978	Ga0207656_100189783	399
267	3300025893	Ga0207682_10006911	Ga0207682_100069113	399
268	3300025926	Ga0207659_10005678	Ga0207659_100056784	399
269	3300025931	Ga0207644_10007613	Ga0207644_100076139	399
270	3300025934	Ga0207686_10046239	Ga0207686_100462391	399
271	3300025940	Ga0207691_10020243	Ga0207691_100202432	399
272	3300025960	Ga0207651_10005825	Ga0207651_100058256	399
273	3300025961	Ga0207712_10051860	Ga0207712_100518602	399
274	3300025986	Ga0207658_10015144	Ga0207658_100151445	399
275	3300026023	Ga0207677_10021297	Ga0207677_100212974	399
276	3300026088	Ga0207641_10002775	Ga0207641_100027757	399
277	3300026089	Ga0207648_10028260	Ga0207648_100282605	399
278	3300026118	Ga0207675_100032453	Ga0207675_1000324534	399
279	3300028786	Ga0307517_10000058	Ga0307517_1000005884	399
280	3300031456	Ga0307513_10005622	Ga0307513_100056225	399
281	3300031616	Ga0307508_10001441	Ga0307508_1000144111	399
282	3300031995	Ga0307409_100254035	Ga0307409_1002540351	399
283	3300033180	Ga0307510_10018632	Ga0307510_100186327	399
284	3300035691	Ga0373931_0031054	Ga0373931_0031054_221_1486	399
285	3300039437	Ga0436365_0085195	Ga0436365_0085195_587_1891	399
286	3300046471	Ga0495650_0013322	Ga0495650_0013322_120_1397	399
287	3300046522	Ga0495643_0023681	Ga0495643_0023681_542_1867	399
288	3300046665	Ga0495661_0000458	Ga0495661_0000458_19910_21235	399
289	3300047443	Ga0495687_009412	Ga0495687_009412_2253_3578	399
290	3300047469	Ga0495673_0001399	Ga0495673_0001399_1775_3070	399
291	3300048912	Ga0496109_0143516	Ga0496109_0143516_773_2047	399
292	3300048929	Ga0496126_0016315	Ga0496126_0016315_5947_7326	399
293	3300050496	nmdc:mga07m45_1604_c1	nmdc:mga07m45_1604_c1_5773_7050	399
294	3300050512	nmdc:mga0n895_42043_c1	nmdc:mga0n895_42043_c1_2745_4013	399
295	3300050513	nmdc:mga0rr50_156578_c1	nmdc:mga0rr50_156578_c1_459_1727	399
296	3300050514	nmdc:mga08x19_3428_c1	nmdc:mga08x19_3428_c1_6068_7336	399
297	3300053088	Ga0500644_0009741	Ga0500644_0009741_11_1288	399
298	3300053092	Ga0500583_0060272	Ga0500583_0060272_121_1386	399
299	3300053093	Ga0500651_0003289	Ga0500651_0003289_6593_7870	399
300	3300053136	Ga0500559_0000079	Ga0500559_0000079_68699_69976	399
301	3300053156	Ga0500622_0003592	Ga0500622_0003592_6371_7648	399
302	3300053739	Ga0500587_002285	Ga0500587_002285_21_1298	399
303	3300003794	Ga0055531_10010864	Ga0055531_100108643	400
304	3300025304	Ga0209257_1000187	Ga0209257_100018752	400
305	3300028794	Ga0307515_10014689	Ga0307515_100146898	400
306	3300042002	Ga0439442_012434	Ga0439442_012434_88_1422	400
307	3300042436	Ga0439435_0009806	Ga0439435_0009806_115_1410	400
308	3300005334	Ga0068869_100067325	Ga0068869_1000673251	401
309	3300037471	Ga0395905_0002335	Ga0395905_0002335_11723_13048	401
310	3300046474	Ga0495605_0075647	Ga0495605_0075647_154_1491	401
311	3300048905	Ga0496102_0055930	Ga0496102_0055930_120_1445	401
312	3300048911	Ga0496108_0026311	Ga0496108_0026311_499_1824	401
313	iso_pu_bacteria	2510917020	2511124284	401
314	iso_pu_bacteria	2582581279	2585146885	401
315	iso_pu_bacteria	2582581280	2585151420	401
316	iso_pu_bacteria	2582581293	2585196133	401
317	iso_pu_bacteria	2585428106	2587919444	401
318	iso_pu_bacteria	2643221552	2643782704	401
319	iso_pu_bacteria	2643221583	2643926477	401
320	iso_pu_bacteria	2643221584	2643928917	401
321	iso_pu_bacteria	2643221640	2644225275	401
322	iso_pu_bacteria	2643221642	2644232583	401
323	iso_pu_bacteria	2643221691	2644508465	401
324	iso_pu_bacteria	2818991435	2819536994	401
325	iso_pu_bacteria	2818991454	2819645406	401
326	iso_pu_bacteria	2857504554	2857504594	401
327	iso_pu_bacteria	2884960567	2884960700	401
328	iso_pu_bacteria	2928531327	2928534403	401
329	3300005338	Ga0068868_100161894	Ga0068868_1001618942	402
330	3300005347	Ga0070668_100103195	Ga0070668_1001031952	402
331	3300005354	Ga0070675_100044020	Ga0070675_1000440203	402
332	3300005459	Ga0068867_100047889	Ga0068867_1000478893	402
333	3300005543	Ga0070672_100102441	Ga0070672_1001024412	402
334	3300005545	Ga0070695_100102453	Ga0070695_1001024532	402
335	3300005719	Ga0068861_100043761	Ga0068861_1000437613	402
336	3300005844	Ga0068862_100241863	Ga0068862_1002418631	402
337	3300006846	Ga0075430_100040088	Ga0075430_1000400882	402
338	3300006846	Ga0075430_100179281	Ga0075430_1001792811	402
339	3300006847	Ga0075431_100129997	Ga0075431_1001299972	402
340	3300006852	Ga0075433_10163095	Ga0075433_101630952	402
341	3300006880	Ga0075429_100004981	Ga0075429_1000049813	402
342	3300009094	Ga0111539_10099621	Ga0111539_100996212	402
343	3300009148	Ga0105243_10181754	Ga0105243_101817542	402
344	3300014326	Ga0157380_10060525	Ga0157380_100605253	402
345	3300025893	Ga0207682_10012494	Ga0207682_100124943	402
346	3300025922	Ga0207646_10096627	Ga0207646_100966273	402
347	3300025926	Ga0207659_10054746	Ga0207659_100547462	402
348	3300025940	Ga0207691_10024536	Ga0207691_100245362	402
349	3300026089	Ga0207648_10067437	Ga0207648_100674373	402
350	3300027907	Ga0207428_10026605	Ga0207428_100266053	402
351	3300028379	Ga0268266_10118812	Ga0268266_101188122	402
352	3300035113	Ga0373936_0004100	Ga0373936_0004100_1543_2841	402
353	3300035170	Ga0373943_0004588	Ga0373943_0004588_3364_4662	402
354	3300035692	Ga0373935_0015263	Ga0373935_0015263_1541_2839	402
355	3300035725	Ga0373947_0001491	Ga0373947_0001491_1529_2827	402
356	3300037068	Ga0373925_0013274	Ga0373925_0013274_1555_2853	402
357	3300041509	Ga0451843_0318638	Ga0451843_0318638_332_1630	402
358	3300049571	Ga0501034_0057026	Ga0501034_0057026_2447_3739	402
359	3300049575	Ga0501039_0197882	Ga0501039_0197882_141_1484	402
360	3300049580	Ga0501046_0163748	Ga0501046_0163748_142_1485	402
361	3300049582	Ga0501048_0114910	Ga0501048_0114910_381_1724	402
362	3300049584	Ga0501068_0004390	Ga0501068_0004390_4300_5595	402
363	3300049589	Ga0501073_0000407	Ga0501073_0000407_3546_4841	402
364	3300049590	Ga0501074_0084213	Ga0501074_0084213_67_1362	402
365	3300049742	Ga0501080_0004932	Ga0501080_0004932_5978_7273	402
366	3300049742	Ga0501080_0154646	Ga0501080_0154646_270_1613	402
367	3300049743	Ga0501081_0046212	Ga0501081_0046212_1399_2742	402
368	3300049744	Ga0501083_0059927	Ga0501083_0059927_46_1341	402
369	3300049824	Ga0501045_0031466	Ga0501045_0031466_702_2045	402
370	3300050509	nmdc:mga0qj67_63205_c1	nmdc:mga0qj67_63205_c1_720_2063	402
371	3300053156	Ga0500622_0000173	Ga0500622_0000173_63535_64860	402
372	iso_pu_bacteria	2857537821	2857541187	402
373	iso_pu_bacteria	2858950400	2858953276	402
374	iso_pu_bacteria	2941479691	2941483700	402
375	3300005331	Ga0070670_100029399	Ga0070670_1000293992	403
376	3300005617	Ga0068859_100013452	Ga0068859_1000134524	403
377	3300005843	Ga0068860_100023765	Ga0068860_1000237655	403
378	3300006195	Ga0075366_10017203	Ga0075366_100172035	403
379	3300025910	Ga0207684_10007207	Ga0207684_1000720712	403
380	3300032126	Ga0307415_100095858	Ga0307415_1000958582	403
381	3300050493	nmdc:mga0k408_41990_c1	nmdc:mga0k408_41990_c1_345_1640	403
382	3300050496	nmdc:mga07m45_82064_c1	nmdc:mga07m45_82064_c1_18_1313	403
383	3300053118	Ga0500594_0003531	Ga0500594_0003531_1534_2868	403
384	iso_pu_bacteria	2643221545	2643749509	403
385	iso_pu_bacteria	2791355048	2792458953	403
386	iso_pu_bacteria	2843744320	2843749112	403
387	iso_pu_bacteria	2849560528	2849564420	403
388	iso_pu_bacteria	2849573788	2849575291	403
389	iso_pu_bacteria	2851153111	2851155546	403
390	iso_pu_bacteria	2898329390	2898330852	403
391	3300005535	Ga0070684_100000400	Ga0070684_10000040011	404
392	3300005577	Ga0068857_100008698	Ga0068857_1000086984	404
393	3300006844	Ga0075428_100007897	Ga0075428_10000789710	404
394	3300025937	Ga0207669_10012632	Ga0207669_100126323	404
395	3300031852	Ga0307410_10021305	Ga0307410_100213052	404
396	3300031911	Ga0307412_10055170	Ga0307412_100551702	404
397	3300046457	Ga0495590_0055205	Ga0495590_0055205_44_1339	404
398	3300046513	Ga0495616_0059373	Ga0495616_0059373_159_1451	404
399	3300047469	Ga0495673_0001111	Ga0495673_0001111_1455_2747	404
400	3300003775	Ga0055524_1021748	Ga0055524_10217481	405
401	3300003781	Ga0055536_1006624	Ga0055536_10066244	405
402	3300003781	Ga0055536_1015937	Ga0055536_10159371	405
403	3300003791	Ga0055530_10008211	Ga0055530_100082113	405
404	3300003791	Ga0055530_10025688	Ga0055530_100256881	405
405	3300003794	Ga0055531_10006317	Ga0055531_100063176	405
406	3300006048	Ga0075363_100005597	Ga0075363_1000055972	405
407	3300006186	Ga0075369_10005345	Ga0075369_100053452	405
408	3300009094	Ga0111539_10022238	Ga0111539_100222382	405
409	3300009147	Ga0114129_10465525	Ga0114129_104655251	405
410	3300009553	Ga0105249_10095759	Ga0105249_100957591	405
411	3300025292	Ga0209676_1000691	Ga0209676_100069112	405
412	3300025292	Ga0209676_1001269	Ga0209676_100126912	405
413	3300025292	Ga0209676_1002398	Ga0209676_10023987	405
414	3300025298	Ga0209050_1001896	Ga0209050_100189613	405
415	3300025298	Ga0209050_1006193	Ga0209050_10061931	405
416	3300025298	Ga0209050_1012461	Ga0209050_10124612	405
417	3300025299	Ga0209256_1004748	Ga0209256_10047487	405
418	3300025304	Ga0209257_1003467	Ga0209257_10034676	405
419	3300027907	Ga0207428_10049829	Ga0207428_100498292	405
420	3300028794	Ga0307515_10076420	Ga0307515_100764203	405
421	3300028794	Ga0307515_10123440	Ga0307515_101234402	405
422	3300031548	Ga0307408_100152479	Ga0307408_1001524791	405
423	3300041486	Ga0451807_0978577	Ga0451807_0978577_17_1348	405
424	3300041494	Ga0451837_0678773	Ga0451837_0678773_375_1703	405
425	3300046460	Ga0495638_0002190	Ga0495638_0002190_6127_7422	405
426	3300046506	Ga0495583_0000002	Ga0495583_0000002_38757_40058	405
427	3300046515	Ga0495620_0007802	Ga0495620_0007802_626_1921	405
428	3300046524	Ga0495648_0047718	Ga0495648_0047718_352_1653	405
429	3300046530	Ga0495654_0000048	Ga0495654_0000048_13469_14770	405
430	3300046616	Ga0495668_0000703	Ga0495668_0000703_37486_38784	405
431	3300046616	Ga0495668_0014556	Ga0495668_0014556_1633_2976	405
432	3300046660	Ga0495625_0012736	Ga0495625_0012736_1480_2781	405
433	3300047469	Ga0495673_0024171	Ga0495673_0024171_1148_2443	405
434	3300047472	Ga0495686_0119546	Ga0495686_0119546_63_1361	405
435	3300048927	Ga0496124_0038215	Ga0496124_0038215_1677_2975	405
436	3300048929	Ga0496126_0012930	Ga0496126_0012930_359_1672	405
437	3300050493	nmdc:mga0k408_50757_c1	nmdc:mga0k408_50757_c1_34_1347	405
438	3300050493	nmdc:mga0k408_95017_c1	nmdc:mga0k408_95017_c1_251_1546	405
439	3300050507	nmdc:mga05p37_205815_c1	nmdc:mga05p37_205815_c1_191_1531	405
440	3300050511	nmdc:mga08y16_41003_c1	nmdc:mga08y16_41003_c1_2322_3659	405
441	3300053086	Ga0500578_0001504	Ga0500578_0001504_20064_21359	405
442	3300053088	Ga0500644_0000340	Ga0500644_0000340_20798_22093	405
443	3300053102	Ga0500554_000965	Ga0500554_000965_3041_4336	405
444	3300053108	Ga0500562_006111	Ga0500562_006111_68_1363	405
445	3300053118	Ga0500594_0000137	Ga0500594_0000137_17333_18628	405
446	3300053122	Ga0500608_000007	Ga0500608_000007_12401_13714	405
447	3300053134	Ga0500658_0004233	Ga0500658_0004233_3985_5286	405
448	3300053136	Ga0500559_0006240	Ga0500559_0006240_1674_3014	405
449	3300053138	Ga0500564_020552	Ga0500564_020552_1708_3003	405
450	3300053156	Ga0500622_0028104	Ga0500622_0028104_60_1355	405
451	3300053158	Ga0500627_0015757	Ga0500627_0015757_54_1355	405
452	iso_pu_bacteria	2513237150	2513957547	405
453	iso_pu_bacteria	2513237165	2514044974	405
454	iso_pu_bacteria	2835312727	2835319088	405
455	iso_pu_bacteria	2901300506	2901300817	405
456	3300005617	Ga0068859_100398084	Ga0068859_1003980841	406
457	3300005843	Ga0068860_100190403	Ga0068860_1001904031	406
458	3300009177	Ga0105248_10175007	Ga0105248_101750072	406
459	3300009177	Ga0105248_10193479	Ga0105248_101934792	406
460	3300025292	Ga0209676_1007674	Ga0209676_10076743	406
461	3300031903	Ga0307407_10084993	Ga0307407_100849931	406
462	3300046519	Ga0495632_0070490	Ga0495632_0070490_204_1532	406
463	3300048919	Ga0496116_0003236	Ga0496116_0003236_4794_6182	406
464	3300048921	Ga0496118_0005662	Ga0496118_0005662_6966_8354	406
465	3300048923	Ga0496120_0003222	Ga0496120_0003222_11423_12811	406
466	3300048924	Ga0496121_0000145	Ga0496121_0000145_111612_113000	406
467	3300048924	Ga0496121_0026081	Ga0496121_0026081_3079_4467	406
468	3300048925	Ga0496122_0000029	Ga0496122_0000029_331044_332432	406
469	3300048926	Ga0496123_0000216	Ga0496123_0000216_3965_5353	406
470	3300048927	Ga0496124_0039155	Ga0496124_0039155_2277_3665	406
471	3300048928	Ga0496125_0000706	Ga0496125_0000706_47848_49236	406
472	3300048928	Ga0496125_0028269	Ga0496125_0028269_1845_3233	406
473	3300048929	Ga0496126_0011904	Ga0496126_0011904_1646_3034	406
474	3300049571	Ga0501034_0000444	Ga0501034_0000444_26523_27827	406
475	3300049588	Ga0501072_0009274	Ga0501072_0009274_5891_7195	406
476	iso_pu_bacteria	2894023352	2894024177	406
477	iso_pu_bacteria	644736347	644747679	406
478	iso_pu_bacteria	2834641062	2834641991	408
479	iso_pu_bacteria	8003400568	8003404467	408
480	3300003187	JGI25151J46595_10004046	JGI25151J46595_100040464	409
481	3300025294	Ga0209025_1000021	Ga0209025_1000021211	409
482	3300025297	Ga0209758_1009411	Ga0209758_10094115	409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

287

389

0.92 PF01546

Peptidase_M20

Peptidase family M20/M25/M40

158

493

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4ewt-assembly1.cif.gz_B	the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus	0.8579	13	403
6slf-assembly1.cif.gz_D	nalpha-acylglutamine aminoacylase from corynebacterium sp.releasing human axilla odorants co-crystallised with high affinity inhibitor	0.8519	12	402
4ewt-assembly1.cif.gz_B	the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus	0.8494	13	403
4ewt-assembly1.cif.gz_D	the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus	0.8431	13	406
6slf-assembly1.cif.gz_D	nalpha-acylglutamine aminoacylase from corynebacterium sp.releasing human axilla odorants co-crystallised with high affinity inhibitor	0.8378	12	402

ID	Description	Score	Start	End	Superfamily
4ewtB01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9459	13	403	3.40.630.10
2q43A01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9365	16	406	3.40.630.10
4ewtB01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9321	13	403	3.40.630.10
af_A0A0R0IPM0_41_149_3.30.70.360	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.919	210	307	3.30.70.360
2q43A01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.91	16	406	3.40.630.10

ID	Description	Score	Start	End	GO Terms
AF-A0A519LL25-F1-model_v4	M20/M25/M40 family metallo-hydrolase	0.9824	12	154	GO:0016787
AF-A0A523LKY6-F1-model_v4	Amidohydrolase	0.9774	19	190	GO:0016787
AF-A0A7L4TR88-F1-model_v4	N-acyl-L-amino acid amidohydrolase	0.9735	47	187	GO:0016787
AF-A0A7V2PK22-F1-model_v4	Amidohydrolase	0.9717	16	148	GO:0016787
AF-A0A2R7R2R7-F1-model_v4	deleted	0.971	13	194

Feature Viewer

pLDDT	pTM	Quality
91.14	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F452697

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07687

M20_dimer

Peptidase dimerisation domain

287

389

0.92

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

158

493

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map