metagRoot

F452479

General Info

Members	Datasets	Scaffolds	Average Seq Length
481	322	343	354

Family's Representative Sequence

Representative Sequence	3300046558\|Ga0495633_0028360\|Ga0495633_0028360_592_1746
Length	384
Sequence	MRHYPARFDAKGCLTDEPRLPWEEVLAGLELRNIDKTYGAFQAIEGLNLEVEDGSFTVFVGPSGCGKSTLLRMIAGLEKITSGELVIGGRTVNNADPIERGVAMVFQNYALYPHMTVEQNIGFSLRLAGLGKTEIARRVMDAATTLQVEGLLKRKPAQLSGGQRQRVAIGRAIVRNPSVFLFDEPLSNLDAELRVSMRVEIAKLHQRLGTTMIYVTHDQTEAMTLADKIVVIRAGKIQQAGTPQQLYSDPNSLFVAGFIGSPRMNFLEGTMAADGSVRLKCGSAFQARARASAGDAPIKLGIRPEHFSVDASDVEIEVTVDVVENLGGTRFIYGQLASGESVVIEDRSERPLRRGETLAFKASLARSLLFAADGQRIRDHARGE

Samples

	Sample ID	Description	Type	Environment
1	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
2	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
3	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
4	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
5	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
6	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
7	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
8	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
9	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
10	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
11	2516143018	Ensifer sp. BR816	Isolate	Nodule
12	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
13	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
14	2523231067	Pleomorphomonas oryzae DSM 16300	Isolate	Unclassified
15	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
16	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
17	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
18	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
19	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
20	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
21	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
22	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
23	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
24	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
25	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
26	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
27	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
28	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
29	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
30	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
31	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
32	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
33	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
34	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
35	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
36	2643221591	Devosia sp. Root685	Isolate	Unclassified
37	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
38	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
39	2643221629	Devosia sp. Root105	Isolate	Unclassified
40	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
41	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
42	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
43	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
44	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
45	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
46	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
47	2718217882	Rhizobium sp. N741	Isolate	Nodule
48	2718218009	Rhizobium sp. N561	Isolate	Nodule
49	2718218363	Rhizobium sp. N113	Isolate	Nodule
50	2718218365	Rhizobium sp. N731	Isolate	Nodule
51	2718218366	Rhizobium sp. N621	Isolate	Nodule
52	2721755514	Rhizobium sp. N6212	Isolate	Nodule
53	2721755810	Rhizobium sp. N871	Isolate	Nodule
54	2728369365	Rhizobium sp. N1341	Isolate	Nodule
55	2728369397	Rhizobium sp. N1314	Isolate	Nodule
56	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
57	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
58	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
59	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
60	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
61	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
62	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
63	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
64	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
65	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
66	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
67	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
68	2791355260	Rhizobium sp. L9	Isolate	Nodule
69	2791355264	Rhizobium sp. S9	Isolate	Nodule
70	2791355266	Rhizobium sp. L43	Isolate	Nodule
71	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
72	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
73	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
74	2818991467	Bosea vestrisii 3192	Isolate	Unclassified
75	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
76	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
77	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
78	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
79	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
80	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
81	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
82	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
83	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
84	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
85	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
86	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
87	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
88	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
89	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
90	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
91	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
92	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
93	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
94	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
95	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
96	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
97	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
98	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
99	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
100	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
101	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
102	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
103	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
104	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
105	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
106	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
107	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
108	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
109	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
110	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
111	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
112	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
113	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
114	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
115	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
116	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
117	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
118	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
119	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
120	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
121	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
122	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
123	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
124	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
125	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
126	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
127	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
128	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
129	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
130	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
131	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
132	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
133	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
134	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
135	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
136	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
137	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
138	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
139	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
140	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
141	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
142	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
143	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
144	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
145	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
146	3300009763	Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix	Metagenome	Nodule
147	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
148	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
149	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
150	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
151	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
152	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
153	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
154	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
155	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
156	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
159	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
160	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
161	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
162	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
163	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
165	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
166	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
168	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
171	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
174	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
188	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
189	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
190	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
191	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
192	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
193	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
194	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
195	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
196	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
197	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
198	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
199	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
200	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
201	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
202	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
203	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
204	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
205	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
206	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
207	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
208	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
209	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
210	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
211	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
212	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
213	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
214	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
215	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
216	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
217	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
218	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
219	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
220	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
221	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
222	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
223	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
224	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
225	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
226	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
227	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
228	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
229	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
230	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
231	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
232	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
233	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
234	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
235	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
236	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
237	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
238	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
239	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
240	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
241	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
242	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
243	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
244	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
245	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
246	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
247	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
248	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
249	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
250	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
251	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
252	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
253	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
254	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
255	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
256	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
257	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
258	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
259	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
260	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
261	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
262	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
263	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
264	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
265	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
266	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
267	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
268	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
269	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
270	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
271	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
272	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
274	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
276	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
277	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
278	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
279	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
280	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
281	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
282	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
283	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
284	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
285	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
286	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
287	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
288	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
289	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
290	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
291	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
292	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
293	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
294	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
295	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
296	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
297	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
298	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
299	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
300	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
301	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
302	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
303	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
304	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
305	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
306	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
307	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
308	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
309	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
310	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
311	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
312	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
313	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
314	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
315	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
316	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
317	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
318	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
319	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
320	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
321	8024501048	Rhizobium sp. H4	Isolate	Nodule
322	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	71.52
Metatranscriptomes	0
Isolates	28.48

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	24.53
Nodule	15.38
Rhizoplane	1.66
Rhizosphere	31.19
Stem	0
Stem Tuber	0
Unclassified	27.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10009419	3300001979	Bacteria	3825
2	JGI25155J39150_1000056	3300002704	Bacteria	73160
3	JGI25156J39149_1000007	3300002705	Bacteria	252108
4	JGI25162J39368_1000322	3300002737	Bacteria	42100
5	JGI25162J39368_1000388	3300002737	Bacteria	37283
6	JGI25154J39366_1000013	3300002738	Bacteria	268260
7	JGI25157J39369_1000012	3300002741	Bacteria	205167
8	JGI25157J39369_1000099	3300002741	Bacteria	73678
9	JGI25152J39213_1000239	3300002773	Bacteria	36762
10	JGI25152J39213_1001578	3300002773	Bacteria	9561
11	JGI25152J39213_1003376	3300002773	Bacteria	5478
12	JGI25150J39212_1000026	3300002774	Bacteria	107804
13	JGI25150J39212_1004490	3300002774	Bacteria	3100
14	JGI25159J45721_1001590	3300002987	Bacteria	9281
15	JGI25159J45721_1003759	3300002987	Bacteria	5251
16	JGI25151J46595_10000053	3300003187	Bacteria	156841
17	JGI25151J46595_10010235	3300003187	Bacteria	4372
18	JGI25151J46595_10017200	3300003187	Bacteria	3142
19	JGI25151J46595_10052572	3300003187	Bacteria	1368
20	JGI25165J46597_1000248	3300003214	Bacteria	73257
21	JGI25165J46597_1000569	3300003214	Bacteria	33265
22	JGI25153J46596_10000682	3300003215	Bacteria	20724
23	JGI25153J46596_10012472	3300003215	Bacteria	3663
24	JGI25153J46596_10025372	3300003215	Bacteria	2119
25	JGI25160J50197_1003478	3300003354	Bacteria	7037
26	JGI25161J50226_1000025	3300003374	Bacteria	148471
27	JGI25161J50226_1000050	3300003374	Bacteria	110628
28	JGI25404J52841_10000142	3300003659	Bacteria	7758
29	Ga0055526_1000231	3300003771	Bacteria	46760
30	Ga0055526_1000595	3300003771	Bacteria	28430
31	Ga0055526_1006927	3300003771	Bacteria	6031
32	Ga0055524_1005755	3300003775	Bacteria	5480
33	Ga0055524_1011810	3300003775	Bacteria	3387
34	Ga0055528_1000515	3300003790	Bacteria	30346
35	Ga0055528_1001730	3300003790	Bacteria	12622
36	Ga0055528_1001916	3300003790	Bacteria	11817
37	Ga0055540_1026198	3300003792	Bacteria	1414
38	Ga0055531_10003633	3300003794	Bacteria	9733
39	Ga0055543_1000021	3300004625	Bacteria	150116
40	Ga0055543_1000977	3300004625	Bacteria	12940
41	Ga0065165_1015659	3300005262	Bacteria	2882
42	Ga0070667_100103770	3300005367	Bacteria	2458
43	Ga0070714_100182767	3300005435	Bacteria	1909
44	Ga0070698_100001123	3300005471	Bacteria	29566
45	Ga0070665_100057341	3300005548	Bacteria	3904
46	Ga0068857_100004330	3300005577	Bacteria	11978
47	Ga0068862_100024708	3300005844	Bacteria	5042
48	Ga0081455_10000164	3300005937	Bacteria	81995
49	Ga0081455_10019177	3300005937	Bacteria	6481
50	Ga0081538_10031194	3300005981	Bacteria	3601
51	Ga0081540_1003322	3300005983	Bacteria	12752
52	Ga0081540_1004760	3300005983	Bacteria	10248
53	Ga0081539_10004478	3300005985	Bacteria	15387
54	Ga0075369_10080020	3300006186	Bacteria	1448
55	Ga0099822_1018066	3300006943	Bacteria	7406
56	Ga0105240_10000012	3300009093	Bacteria	496639
57	Ga0105237_10000054	3300009545	Bacteria	155063
58	Ga0123340_1002768	3300009763	Bacteria	16059
59	Ga0123341_1000020	3300009765	Bacteria	79523
60	Ga0123341_1001832	3300009765	Bacteria	16699
61	Ga0105239_10015313	3300010375	Bacteria	8498
62	Ga0105239_10274384	3300010375	Bacteria	1897
63	Ga0157370_10000078	3300013104	Bacteria	107381
64	Ga0182007_10001537	3300015262	Bacteria	12304
65	Ga0182005_1002399	3300015265	Bacteria	6734
66	Ga0213874_10009712	3300021377	Bacteria	2388
67	Ga0213874_10011055	3300021377	Bacteria	2276
68	Ga0213876_10006190	3300021384	Bacteria	6529
69	Ga0213875_10005685	3300021388	Bacteria	6651
70	Ga0209435_100006	3300025206	Bacteria	542459
71	Ga0209436_100031	3300025208	Bacteria	82827
72	Ga0209436_100044	3300025208	Bacteria	70547
73	Ga0209672_104041	3300025228	Bacteria	2830
74	Ga0209563_102460	3300025230	Bacteria	4182
75	Ga0209437_100040	3300025233	Bacteria	448096
76	Ga0209437_100067	3300025233	Bacteria	317685
77	Ga0209437_111110	3300025233	Bacteria	1356
78	Ga0207425_1000113	3300025245	Bacteria	77236
79	Ga0207425_1002080	3300025245	Bacteria	7430
80	Ga0209646_1000015	3300025246	Bacteria	542459
81	Ga0209026_1000046	3300025250	Bacteria	262031
82	Ga0209677_100158	3300025253	Bacteria	61587
83	Ga0209759_1000005	3300025256	Bacteria	542459
84	Ga0209129_1000082	3300025258	Bacteria	183436
85	Ga0209129_1000181	3300025258	Bacteria	89982
86	Ga0209129_1000969	3300025258	Bacteria	17242
87	Ga0209129_1002611	3300025258	Bacteria	8594
88	Ga0209233_1000051	3300025261	Bacteria	447617
89	Ga0209233_1000088	3300025261	Bacteria	317980
90	Ga0209233_1000161	3300025261	Bacteria	158607
91	Ga0209673_1000005	3300025273	Bacteria	692788
92	Ga0209673_1003632	3300025273	Bacteria	8920
93	Ga0209130_1000001	3300025284	Bacteria	831557
94	Ga0209130_1000031	3300025284	Bacteria	322932
95	Ga0209025_1000181	3300025294	Bacteria	156894
96	Ga0209025_1005172	3300025294	Bacteria	10791
97	Ga0209025_1010720	3300025294	Bacteria	6164
98	Ga0209025_1012688	3300025294	Bacteria	5376
99	Ga0209025_1014558	3300025294	Bacteria	4821
100	Ga0209564_1000023	3300025295	Bacteria	555102
101	Ga0209564_1000586	3300025295	Bacteria	57490
102	Ga0209564_1003532	3300025295	Bacteria	10535
103	Ga0209758_1000118	3300025297	Bacteria	195889
104	Ga0209758_1000156	3300025297	Bacteria	156894
105	Ga0209758_1002373	3300025297	Bacteria	19377
106	Ga0209758_1006683	3300025297	Bacteria	8144
107	Ga0209758_1013603	3300025297	Bacteria	4417
108	Ga0209758_1018283	3300025297	Bacteria	3445
109	Ga0209758_1021678	3300025297	Bacteria	2985
110	Ga0209758_1055690	3300025297	Bacteria	1341
111	Ga0209050_1005583	3300025298	Bacteria	7814
112	Ga0209256_1000642	3300025299	Bacteria	47524
113	Ga0209256_1002390	3300025299	Bacteria	15468
114	Ga0207426_1000005	3300025302	Bacteria	1037188
115	Ga0207426_1000042	3300025302	Bacteria	433289
116	Ga0209051_1059452	3300025303	Bacteria	1211
117	Ga0209257_1001285	3300025304	Bacteria	30689
118	Ga0209257_1019203	3300025304	Bacteria	2586
119	Ga0207684_10107251	3300025910	Bacteria	2390
120	Ga0207695_10000097	3300025913	Bacteria	262517
121	Ga0207671_10000023	3300025914	Bacteria	274756
122	Ga0207693_10004189	3300025915	Bacteria	12229
123	Ga0207681_10272164	3300025923	Bacteria	1330
124	Ga0207664_10223070	3300025929	Bacteria	1636
125	Ga0207664_10358685	3300025929	Bacteria	1291
126	Ga0207667_10232830	3300025949	Bacteria	1886
127	Ga0207702_10151221	3300026078	Bacteria	2111
128	Ga0207674_10007567	3300026116	Bacteria	12655
129	Ga0268265_10115856	3300028380	Bacteria	2197
130	Ga0307515_10000068	3300028794	Bacteria	242305
131	Ga0307515_10000145	3300028794	Bacteria	170814
132	Ga0307515_10011115	3300028794	Bacteria	17122
133	Ga0307515_10013167	3300028794	Bacteria	15476
134	Ga0307515_10068604	3300028794	Bacteria	4868
135	Ga0307515_10300493	3300028794	Bacteria	1291
136	Ga0265340_10079238	3300031247	Bacteria	1548
137	Ga0265339_10083011	3300031249	Bacteria	1691
138	Ga0307513_10009000	3300031456	Bacteria	12669
139	Ga0307513_10252330	3300031456	Bacteria	1560
140	Ga0265313_10031369	3300031595	Bacteria	2725
141	Ga0265342_10037828	3300031712	Bacteria	2941
142	Ga0307516_10116293	3300031730	Bacteria	2470
143	Ga0373923_0047083	3300035111	Bacteria	1796
144	Ga0373954_0094149	3300035118	Bacteria	1441
145	Ga0373956_0028098	3300035119	Bacteria	2446
146	Ga0373957_0050143	3300035120	Bacteria	1595
147	Ga0373946_0054362	3300035171	Bacteria	1685
148	Ga0373927_0002442	3300035695	Bacteria	13556
149	Ga0373927_0044163	3300035695	Bacteria	2884
150	Ga0373933_0064046	3300035724	Bacteria	2223
151	Ga0373937_0124545	3300036401	Bacteria	2403
152	Ga0373925_0005427	3300037068	Bacteria	9498
153	Ga0395905_0000453	3300037471	Bacteria	57443
154	Ga0395905_0006852	3300037471	Bacteria	11392
155	Ga0395905_0029264	3300037471	Bacteria	5191
156	Ga0395905_0066164	3300037471	Bacteria	3384
157	Ga0436364_0014466	3300037853	Bacteria	20235
158	Ga0436365_0106426	3300039437	Bacteria	12094
159	Ga0436360_0148239	3300039438	Bacteria	2615
160	Ga0436363_0259999	3300039450	Bacteria	4253
161	Ga0436363_0882643	3300039450	Bacteria	22262
162	Ga0436363_1223256	3300039450	Bacteria	5358
163	Ga0436362_0224785	3300039453	Bacteria	18225
164	Ga0439465_0018834	3300041413	Bacteria	2157
165	Ga0451833_0456311	3300041491	Bacteria	1443
166	Ga0451833_1404057	3300041491	Bacteria	3246
167	Ga0451847_0188749	3300041503	Bacteria	1265
168	Ga0451849_0045153	3300041505	Bacteria	2027
169	Ga0451849_0900339	3300041505	Bacteria	5495
170	Ga0451851_0230272	3300041507	Bacteria	3008
171	Ga0439432_024495	3300042006	Bacteria	1984
172	Ga0450920_008326	3300042122	Bacteria	1894
173	Ga0439435_0005711	3300042436	Bacteria	2752
174	Ga0450918_014222	3300042531	Bacteria	1383
175	Ga0466959_0019840	3300045049	Bacteria	4946
176	Ga0495592_0020163	3300046454	Bacteria	5071
177	Ga0495590_0059204	3300046457	Bacteria	1340
178	Ga0495629_0012041	3300046459	Bacteria	6269
179	Ga0495629_0265999	3300046459	Bacteria	1178
180	Ga0495638_0000145	3300046460	Bacteria	112275
181	Ga0495638_0056352	3300046460	Bacteria	2439
182	Ga0495638_0056403	3300046460	Bacteria	2437
183	Ga0495638_0101522	3300046460	Bacteria	1720
184	Ga0495651_0121563	3300046462	Bacteria	1917
185	Ga0495651_0267396	3300046462	Bacteria	1161
186	Ga0495605_0011024	3300046474	Bacteria	5050
187	Ga0495585_0019254	3300046492	Bacteria	3938
188	Ga0495607_0049169	3300046501	Bacteria	2461
189	Ga0495583_0077394	3300046506	Bacteria	1451
190	Ga0495606_0001061	3300046507	Bacteria	39727
191	Ga0495606_0051136	3300046507	Bacteria	2698
192	Ga0495606_0061680	3300046507	Bacteria	2397
193	Ga0495608_0123344	3300046511	Bacteria	1660
194	Ga0495610_0003039	3300046512	Bacteria	13434
195	Ga0495610_0012578	3300046512	Bacteria	5083
196	Ga0495618_0097645	3300046514	Bacteria	1879
197	Ga0495628_0065258	3300046516	Bacteria	2848
198	Ga0495632_0054367	3300046519	Bacteria	1963
199	Ga0495643_0002913	3300046522	Bacteria	12977
200	Ga0495643_0013350	3300046522	Bacteria	4919
201	Ga0495643_0019014	3300046522	Bacteria	3978
202	Ga0495652_0066822	3300046529	Bacteria	3016
203	Ga0495587_0046103	3300046536	Bacteria	2588
204	Ga0495609_0028500	3300046538	Bacteria	2548
205	Ga0495645_0186846	3300046543	Bacteria	1415
206	Ga0495622_0012068	3300046557	Bacteria	3995
207	Ga0495633_0005897	3300046558	Bacteria	7368
208	Ga0495633_0028360	3300046558	Bacteria	2729
209	Ga0495668_0004522	3300046616	Bacteria	9832
210	Ga0495611_0102659	3300046648	Bacteria	1329
211	Ga0495625_0000467	3300046660	Bacteria	60730
212	Ga0495599_0015226	3300046678	Bacteria	4769
213	Ga0495623_0005039	3300046679	Bacteria	8664
214	Ga0495646_0050273	3300046680	Bacteria	2527
215	Ga0495670_0018997	3300046691	Bacteria	3386
216	Ga0495600_0065848	3300046809	Bacteria	2369
217	Ga0495600_0203794	3300046809	Bacteria	1269
218	Ga0495604_0023819	3300047317	Bacteria	4885
219	Ga0495604_0070023	3300047317	Bacteria	2657
220	Ga0495680_0048930	3300047322	Bacteria	3316
221	Ga0495686_0043944	3300047472	Bacteria	2830
222	Ga0495602_0084853	3300048088	Bacteria	2648
223	Ga0496102_0105053	3300048905	Bacteria	2628
224	Ga0496102_0114559	3300048905	Bacteria	2515
225	Ga0496103_0053578	3300048906	Bacteria	2500
226	Ga0496106_0000275	3300048909	Bacteria	36354
227	Ga0496107_0171493	3300048910	Bacteria	1610
228	Ga0496111_0005562	3300048914	Bacteria	8097
229	Ga0496116_0013777	3300048919	Bacteria	6498
230	Ga0496116_0027886	3300048919	Bacteria	4102
231	Ga0496116_0043771	3300048919	Bacteria	3046
232	Ga0496116_0123563	3300048919	Bacteria	1492
233	Ga0496117_0001460	3300048920	Bacteria	34058
234	Ga0496117_0001500	3300048920	Bacteria	33411
235	Ga0496117_0032227	3300048920	Bacteria	3985
236	Ga0496117_0058277	3300048920	Bacteria	2676
237	Ga0496117_0061119	3300048920	Bacteria	2592
238	Ga0496117_0070204	3300048920	Bacteria	2354
239	Ga0496118_0002016	3300048921	Bacteria	28725
240	Ga0496118_0015614	3300048921	Bacteria	7018
241	Ga0496118_0033989	3300048921	Bacteria	4171
242	Ga0496118_0038885	3300048921	Bacteria	3806
243	Ga0496118_0059712	3300048921	Bacteria	2837
244	Ga0496119_0072526	3300048922	Bacteria	2011
245	Ga0496119_0118766	3300048922	Bacteria	1457
246	Ga0496120_0015716	3300048923	Bacteria	4977
247	Ga0496120_0017750	3300048923	Bacteria	4602
248	Ga0496120_0061741	3300048923	Bacteria	2090
249	Ga0496121_0006299	3300048924	Bacteria	14829
250	Ga0496121_0024706	3300048924	Bacteria	5734
251	Ga0496121_0032209	3300048924	Bacteria	4769
252	Ga0496121_0036699	3300048924	Bacteria	4363
253	Ga0496121_0037891	3300048924	Bacteria	4277
254	Ga0496121_0045471	3300048924	Bacteria	3771
255	Ga0496121_0073102	3300048924	Bacteria	2749
256	Ga0496121_0081691	3300048924	Bacteria	2557
257	Ga0496121_0085848	3300048924	Bacteria	2476
258	Ga0496121_0190797	3300048924	Bacteria	1469
259	Ga0496122_0002854	3300048925	Bacteria	23661
260	Ga0496122_0004639	3300048925	Bacteria	16905
261	Ga0496122_0023679	3300048925	Bacteria	5400
262	Ga0496122_0029605	3300048925	Bacteria	4613
263	Ga0496122_0041305	3300048925	Bacteria	3649
264	Ga0496122_0053838	3300048925	Bacteria	3028
265	Ga0496123_0003850	3300048926	Bacteria	16333
266	Ga0496123_0011936	3300048926	Bacteria	7461
267	Ga0496123_0013291	3300048926	Bacteria	6932
268	Ga0496123_0018450	3300048926	Bacteria	5551
269	Ga0496123_0033496	3300048926	Bacteria	3696
270	Ga0496123_0068459	3300048926	Bacteria	2235
271	Ga0496123_0117365	3300048926	Bacteria	1505
272	Ga0496124_0000832	3300048927	Bacteria	50313
273	Ga0496124_0016292	3300048927	Bacteria	7077
274	Ga0496124_0053249	3300048927	Bacteria	3432
275	Ga0496124_0074065	3300048927	Bacteria	2815
276	Ga0496124_0129663	3300048927	Bacteria	2005
277	Ga0496124_0161123	3300048927	Bacteria	1748
278	Ga0496124_0163861	3300048927	Bacteria	1730
279	Ga0496124_0171365	3300048927	Bacteria	1680
280	Ga0496124_0258002	3300048927	Bacteria	1285
281	Ga0496125_0015235	3300048928	Bacteria	7442
282	Ga0496125_0017359	3300048928	Bacteria	6865
283	Ga0496125_0079867	3300048928	Bacteria	2506
284	Ga0496126_0018710	3300048929	Bacteria	6855
285	Ga0496126_0034992	3300048929	Bacteria	4710
286	Ga0496126_0037239	3300048929	Bacteria	4541
287	Ga0496126_0252374	3300048929	Bacteria	1469
288	Ga0496126_0315305	3300048929	Bacteria	1287
289	Ga0495682_0047537	3300049460	Bacteria	1565
290	Ga0501032_0037528	3300049569	Bacteria	3304
291	Ga0501039_0103537	3300049575	Bacteria	2222
292	Ga0501047_0071268	3300049581	Bacteria	3345
293	Ga0501048_0116114	3300049582	Bacteria	1891
294	Ga0501068_0005443	3300049584	Bacteria	6966
295	Ga0501073_0060054	3300049589	Bacteria	2653
296	Ga0501073_0089187	3300049589	Bacteria	2144
297	Ga0501080_0052543	3300049742	Bacteria	3792
298	Ga0501083_0110183	3300049744	Bacteria	1810
299	Ga0501044_0008268	3300049823	Bacteria	11411
300	nmdc:mga0n895_5560_c1	3300050512	Bacteria	10552
301	nmdc:mga0sz30_1705_c1	3300050516	Bacteria	7803
302	nmdc:mga0sz30_23577_c1	3300050516	Bacteria	2505
303	Ga0495601_0135152	3300053077	Bacteria	1607
304	Ga0495595_0072142	3300053084	Bacteria	1633
305	Ga0500578_0083125	3300053086	Bacteria	2035
306	Ga0500644_0004368	3300053088	Bacteria	3535
307	Ga0500651_0012143	3300053093	Bacteria	5213
308	Ga0500651_0046825	3300053093	Bacteria	2720
309	Ga0500651_0047064	3300053093	Bacteria	2712
310	Ga0500641_0016310	3300053096	Bacteria	2766
311	Ga0500557_004851	3300053105	Bacteria	2876
312	Ga0500572_001780	3300053111	Bacteria	5536
313	Ga0500594_0002244	3300053118	Bacteria	4186
314	Ga0500618_002342	3300053125	Bacteria	7239
315	Ga0500618_010358	3300053125	Bacteria	2504
316	Ga0500642_0012778	3300053130	Bacteria	3059
317	Ga0500642_0022858	3300053130	Bacteria	2502
318	Ga0500652_070313	3300053131	Bacteria	1450
319	Ga0500658_0079830	3300053134	Bacteria	1397
320	Ga0500559_0008057	3300053136	Bacteria	4638
321	Ga0500568_0000184	3300053139	Bacteria	55068
322	Ga0500568_0003144	3300053139	Bacteria	9411
323	Ga0500568_0018142	3300053139	Bacteria	3087
324	Ga0500568_0029115	3300053139	Bacteria	2295
325	Ga0500588_0012557	3300053146	Bacteria	2103
326	Ga0500604_0000827	3300053151	Bacteria	8539
327	Ga0500604_0026121	3300053151	Bacteria	1682
328	Ga0500616_0000094	3300053153	Bacteria	181038
329	Ga0500616_0002594	3300053153	Bacteria	14843
330	Ga0500622_0000185	3300053156	Bacteria	66073
331	Ga0500622_0000476	3300053156	Bacteria	37766
332	Ga0500622_0007625	3300053156	Bacteria	6125
333	Ga0500622_0097815	3300053156	Bacteria	1449
334	Ga0500634_0000001	3300053161	Bacteria	258285
335	Ga0500634_0000004	3300053161	Bacteria	214946
336	Ga0500634_0024423	3300053161	Bacteria	3288
337	Ga0500636_0036234	3300053177	Bacteria	2920
338	Ga0500645_005326	3300053730	Bacteria	4761
339	Ga0500609_001231	3300053731	Bacteria	3812
340	Ga0501084_0086684	3300054114	Bacteria	2629
341	Ga0501082_0034017	3300060353	Bacteria	4396
342	Ga0501082_0052523	3300060353	Bacteria	3514
343	Ga0466962_0027433	3300061719	Bacteria	2733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041503	Ga0451847_0188749	Ga0451847_0188749_265_1221	306
2	3300048927	Ga0496124_0074065	Ga0496124_0074065_1871_2794	307
3	3300046506	Ga0495583_0077394	Ga0495583_0077394_494_1423	308
4	iso_pu_bacteria	2513237141	2513887613	329
5	iso_pu_bacteria	2524023228	2524536375	330
6	iso_pu_bacteria	2791355197	2793069199	330
7	iso_pu_bacteria	2876761206	2876764305	330
8	iso_pu_bacteria	2906635258	2906636342	330
9	iso_pu_bacteria	2906660503	2906665409	330
10	iso_pu_bacteria	8006933436	8006938306	330
11	iso_pu_bacteria	8006973647	8006978383	330
12	iso_pu_bacteria	8056689827	8056695587	330
13	3300031247	Ga0265340_10079238	Ga0265340_100792381	332
14	3300031249	Ga0265339_10083011	Ga0265339_100830111	332
15	3300031595	Ga0265313_10031369	Ga0265313_100313691	332
16	3300031712	Ga0265342_10037828	Ga0265342_100378283	332
17	3300003659	JGI25404J52841_10000142	JGI25404J52841_100001423	333
18	3300005435	Ga0070714_100182767	Ga0070714_1001827671	333
19	3300005471	Ga0070698_100001123	Ga0070698_10000112326	333
20	3300005577	Ga0068857_100004330	Ga0068857_1000043306	333
21	3300005844	Ga0068862_100024708	Ga0068862_1000247085	333
22	3300005937	Ga0081455_10000164	Ga0081455_1000016440	333
23	3300005937	Ga0081455_10019177	Ga0081455_100191773	333
24	3300005981	Ga0081538_10031194	Ga0081538_100311943	333
25	3300005983	Ga0081540_1003322	Ga0081540_10033228	333
26	3300005983	Ga0081540_1004760	Ga0081540_10047604	333
27	3300005985	Ga0081539_10004478	Ga0081539_100044783	333
28	3300006943	Ga0099822_1018066	Ga0099822_10180667	333
29	3300021377	Ga0213874_10009712	Ga0213874_100097123	333
30	3300021377	Ga0213874_10011055	Ga0213874_100110551	333
31	3300021384	Ga0213876_10006190	Ga0213876_100061903	333
32	3300021388	Ga0213875_10005685	Ga0213875_100056854	333
33	3300025297	Ga0209758_1000118	Ga0209758_100011824	333
34	3300025297	Ga0209758_1018283	Ga0209758_10182833	333
35	3300025910	Ga0207684_10107251	Ga0207684_101072512	333
36	3300025915	Ga0207693_10004189	Ga0207693_100041897	333
37	3300025929	Ga0207664_10223070	Ga0207664_102230702	333
38	3300025929	Ga0207664_10358685	Ga0207664_103586852	333
39	3300026116	Ga0207674_10007567	Ga0207674_100075677	333
40	3300028380	Ga0268265_10115856	Ga0268265_101158563	333
41	3300035111	Ga0373923_0047083	Ga0373923_0047083_266_1270	333
42	3300035118	Ga0373954_0094149	Ga0373954_0094149_284_1288	333
43	3300035119	Ga0373956_0028098	Ga0373956_0028098_473_1477	333
44	3300035120	Ga0373957_0050143	Ga0373957_0050143_168_1172	333
45	3300035695	Ga0373927_0044163	Ga0373927_0044163_326_1330	333
46	3300035724	Ga0373933_0064046	Ga0373933_0064046_1129_2133	333
47	3300036401	Ga0373937_0124545	Ga0373937_0124545_677_1681	333
48	3300037853	Ga0436364_0014466	Ga0436364_0014466_14919_15923	333
49	3300039437	Ga0436365_0106426	Ga0436365_0106426_4849_5853	333
50	3300039438	Ga0436360_0148239	Ga0436360_0148239_44_1048	333
51	3300039450	Ga0436363_0259999	Ga0436363_0259999_1949_2953	333
52	3300039450	Ga0436363_0882643	Ga0436363_0882643_18074_19078	333
53	3300039450	Ga0436363_1223256	Ga0436363_1223256_2159_3163	333
54	3300039453	Ga0436362_0224785	Ga0436362_0224785_10158_11162	333
55	3300045049	Ga0466959_0019840	Ga0466959_0019840_2943_3947	333
56	3300046454	Ga0495592_0020163	Ga0495592_0020163_2060_3064	333
57	3300046459	Ga0495629_0265999	Ga0495629_0265999_156_1160	333
58	3300046460	Ga0495638_0056352	Ga0495638_0056352_361_1365	333
59	3300046462	Ga0495651_0121563	Ga0495651_0121563_723_1727	333
60	3300046511	Ga0495608_0123344	Ga0495608_0123344_390_1394	333
61	3300046514	Ga0495618_0097645	Ga0495618_0097645_809_1813	333
62	3300046516	Ga0495628_0065258	Ga0495628_0065258_1762_2766	333
63	3300046536	Ga0495587_0046103	Ga0495587_0046103_731_1735	333
64	3300046543	Ga0495645_0186846	Ga0495645_0186846_183_1187	333
65	3300046678	Ga0495599_0015226	Ga0495599_0015226_1725_2729	333
66	3300046679	Ga0495623_0005039	Ga0495623_0005039_2691_3695	333
67	3300046680	Ga0495646_0050273	Ga0495646_0050273_1265_2269	333
68	3300046809	Ga0495600_0065848	Ga0495600_0065848_1123_2127	333
69	3300047317	Ga0495604_0023819	Ga0495604_0023819_390_1394	333
70	3300047322	Ga0495680_0048930	Ga0495680_0048930_1248_2252	333
71	3300048088	Ga0495602_0084853	Ga0495602_0084853_495_1499	333
72	3300048925	Ga0496122_0002854	Ga0496122_0002854_13280_14305	333
73	3300048926	Ga0496123_0013291	Ga0496123_0013291_2258_3283	333
74	3300048929	Ga0496126_0018710	Ga0496126_0018710_3056_4060	333
75	3300049581	Ga0501047_0071268	Ga0501047_0071268_1823_2827	333
76	3300049584	Ga0501068_0005443	Ga0501068_0005443_4623_5627	333
77	3300049589	Ga0501073_0060054	Ga0501073_0060054_1618_2622	333
78	3300049589	Ga0501073_0089187	Ga0501073_0089187_799_1803	333
79	3300049742	Ga0501080_0052543	Ga0501080_0052543_319_1323	333
80	3300049823	Ga0501044_0008268	Ga0501044_0008268_4817_5821	333
81	3300050512	nmdc:mga0n895_5560_c1	nmdc:mga0n895_5560_c1_5201_6205	333
82	3300053077	Ga0495601_0135152	Ga0495601_0135152_130_1134	333
83	3300053084	Ga0495595_0072142	Ga0495595_0072142_84_1088	333
84	3300053093	Ga0500651_0047064	Ga0500651_0047064_1558_2562	333
85	3300053096	Ga0500641_0016310	Ga0500641_0016310_1603_2607	333
86	3300053130	Ga0500642_0012778	Ga0500642_0012778_1160_2164	333
87	3300053134	Ga0500658_0079830	Ga0500658_0079830_144_1148	333
88	3300053139	Ga0500568_0018142	Ga0500568_0018142_1132_2136	333
89	3300053146	Ga0500588_0012557	Ga0500588_0012557_342_1346	333
90	3300053151	Ga0500604_0000827	Ga0500604_0000827_1622_2626	333
91	3300053151	Ga0500604_0026121	Ga0500604_0026121_522_1526	333
92	3300053153	Ga0500616_0002594	Ga0500616_0002594_3779_4783	333
93	3300053731	Ga0500609_001231	Ga0500609_001231_1823_2827	333
94	3300054114	Ga0501084_0086684	Ga0501084_0086684_325_1329	333
95	3300060353	Ga0501082_0034017	Ga0501082_0034017_2015_3019	333
96	3300061719	Ga0466962_0027433	Ga0466962_0027433_1335_2339	333
97	3300046460	Ga0495638_0056403	Ga0495638_0056403_888_1973	334
98	3300048905	Ga0496102_0105053	Ga0496102_0105053_798_1805	334
99	3300048924	Ga0496121_0190797	Ga0496121_0190797_247_1254	334
100	3300053730	Ga0500645_005326	Ga0500645_005326_881_1894	334
101	iso_pu_bacteria	2643221634	2644192290	344
102	iso_pu_bacteria	2582581315	2585328366	345
103	iso_pu_bacteria	2582581316	2585334842	345
104	iso_pu_bacteria	2643221591	2643963696	345
105	iso_pu_bacteria	2791355091	2792621600	346
106	iso_pu_bacteria	2791355092	2792627713	346
107	3300053161	Ga0500634_0024423	Ga0500634_0024423_1750_2805	347
108	3300005548	Ga0070665_100057341	Ga0070665_1000573412	348
109	3300031730	Ga0307516_10116293	Ga0307516_101162932	348
110	3300041505	Ga0451849_0900339	Ga0451849_0900339_4241_5323	348
111	3300042436	Ga0439435_0005711	Ga0439435_0005711_657_1715	348
112	iso_pu_bacteria	2516653077	2517041114	348
113	3300053125	Ga0500618_002342	Ga0500618_002342_4586_5647	349
114	3300053153	Ga0500616_0000094	Ga0500616_0000094_176521_177639	349
115	3300053161	Ga0500634_0000004	Ga0500634_0000004_134572_135633	349
116	iso_pu_bacteria	2510917030	2511195656	349
117	iso_pu_bacteria	2513237093	2513634739	349
118	iso_pu_bacteria	2513237103	2513711193	349
119	iso_pu_bacteria	2513237162	2514024765	349
120	iso_pu_bacteria	2515154113	2515638887	349
121	iso_pu_bacteria	2515154116	2515661881	349
122	iso_pu_bacteria	2517093000	2517099716	349
123	iso_pu_bacteria	2582581298	2585222409	349
124	iso_pu_bacteria	2585427529	2585544639	349
125	iso_pu_bacteria	2765235942	2766064622	349
126	iso_pu_bacteria	2842110456	2842113783	349
127	iso_pu_bacteria	2842217011	2842221699	349
128	iso_pu_bacteria	2857516855	2857523147	349
129	iso_pu_bacteria	2919100787	2919102982	349
130	iso_pu_bacteria	2933586486	2933589581	349
131	iso_pu_bacteria	2936367885	2936371044	349
132	iso_pu_bacteria	2936375103	2936375706	349
133	iso_pu_bacteria	3005445848	3005450899	349
134	iso_pu_bacteria	639633055	639644886	349
135	iso_pu_bacteria	8005376324	8005380376	349
136	iso_pu_bacteria	8005563573	8005565098	349
137	iso_pu_bacteria	2523231067	2523466720	351
138	iso_pu_bacteria	2643221591	2643965294	351
139	iso_pu_bacteria	2738543031	2739351088	351
140	3300048923	Ga0496120_0061741	Ga0496120_0061741_1021_2079	352
141	iso_pu_bacteria	2643221599	2644006838	352
142	iso_pu_bacteria	3005452660	3005458207	352
143	3300002774	JGI25150J39212_1004490	JGI25150J39212_10044902	353
144	3300002987	JGI25159J45721_1001590	JGI25159J45721_10015906	353
145	3300002987	JGI25159J45721_1003759	JGI25159J45721_10037592	353
146	3300003187	JGI25151J46595_10010235	JGI25151J46595_100102351	353
147	3300003215	JGI25153J46596_10012472	JGI25153J46596_100124721	353
148	3300003354	JGI25160J50197_1003478	JGI25160J50197_10034783	353
149	3300003374	JGI25161J50226_1000050	JGI25161J50226_100005078	353
150	3300003771	Ga0055526_1000595	Ga0055526_10005953	353
151	3300003775	Ga0055524_1005755	Ga0055524_10057552	353
152	3300003790	Ga0055528_1001730	Ga0055528_10017302	353
153	3300003790	Ga0055528_1001916	Ga0055528_10019168	353
154	3300003792	Ga0055540_1026198	Ga0055540_10261981	353
155	3300004625	Ga0055543_1000977	Ga0055543_10009773	353
156	3300006186	Ga0075369_10080020	Ga0075369_100800202	353
157	3300009763	Ga0123340_1002768	Ga0123340_10027687	353
158	3300009765	Ga0123341_1001832	Ga0123341_10018327	353
159	3300025208	Ga0209436_100031	Ga0209436_10003150	353
160	3300025245	Ga0207425_1002080	Ga0207425_10020804	353
161	3300025273	Ga0209673_1000005	Ga0209673_100000534	353
162	3300025284	Ga0209130_1000031	Ga0209130_100003123	353
163	3300025294	Ga0209025_1010720	Ga0209025_10107205	353
164	3300025295	Ga0209564_1000586	Ga0209564_100058629	353
165	3300025297	Ga0209758_1006683	Ga0209758_10066836	353
166	3300025297	Ga0209758_1013603	Ga0209758_10136033	353
167	3300025297	Ga0209758_1021678	Ga0209758_10216782	353
168	3300025297	Ga0209758_1055690	Ga0209758_10556901	353
169	3300025299	Ga0209256_1000642	Ga0209256_100064234	353
170	3300025302	Ga0207426_1000042	Ga0207426_1000042387	353
171	3300025304	Ga0209257_1019203	Ga0209257_10192031	353
172	3300037471	Ga0395905_0000453	Ga0395905_0000453_20242_21339	353
173	3300041491	Ga0451833_0456311	Ga0451833_0456311_106_1203	353
174	3300041505	Ga0451849_0045153	Ga0451849_0045153_874_1971	353
175	3300041507	Ga0451851_0230272	Ga0451851_0230272_608_1705	353
176	3300046457	Ga0495590_0059204	Ga0495590_0059204_193_1290	353
177	3300046501	Ga0495607_0049169	Ga0495607_0049169_369_1466	353
178	3300046507	Ga0495606_0061680	Ga0495606_0061680_375_1472	353
179	3300046512	Ga0495610_0012578	Ga0495610_0012578_3426_4523	353
180	3300046522	Ga0495643_0002913	Ga0495643_0002913_3332_4429	353
181	3300046558	Ga0495633_0005897	Ga0495633_0005897_2989_4086	353
182	3300046558	Ga0495633_0028360	Ga0495633_0028360_592_1746	353
183	3300046648	Ga0495611_0102659	Ga0495611_0102659_23_1120	353
184	3300048919	Ga0496116_0013777	Ga0496116_0013777_3235_4332	353
185	3300048920	Ga0496117_0061119	Ga0496117_0061119_1049_2146	353
186	3300048921	Ga0496118_0059712	Ga0496118_0059712_565_1662	353
187	3300048924	Ga0496121_0081691	Ga0496121_0081691_232_1329	353
188	3300048926	Ga0496123_0018450	Ga0496123_0018450_2797_3894	353
189	3300048927	Ga0496124_0258002	Ga0496124_0258002_96_1193	353
190	3300048928	Ga0496125_0079867	Ga0496125_0079867_678_1775	353
191	3300050516	nmdc:mga0sz30_23577_c1	nmdc:mga0sz30_23577_c1_292_1389	353
192	3300053139	Ga0500568_0029115	Ga0500568_0029115_771_1868	353
193	3300053156	Ga0500622_0000476	Ga0500622_0000476_30858_31955	353
194	3300053156	Ga0500622_0097815	Ga0500622_0097815_250_1347	353
195	iso_pu_bacteria	2582581298	2585221646	353
196	iso_pu_bacteria	2582581308	2585278158	353
197	iso_pu_bacteria	2582581315	2585325026	353
198	iso_pu_bacteria	2582581316	2585332809	353
199	iso_pu_bacteria	2582581866	2585391796	353
200	iso_pu_bacteria	2585427527	2585532182	353
201	iso_pu_bacteria	2585427529	2585544184	353
202	iso_pu_bacteria	2585427530	2585552542	353
203	iso_pu_bacteria	2615840626	2616307676	353
204	iso_pu_bacteria	2615840698	2616552115	353
205	iso_pu_bacteria	2617270742	2617382185	353
206	iso_pu_bacteria	2643221607	2644048628	353
207	iso_pu_bacteria	2643221636	2644202131	353
208	iso_pu_bacteria	2643221686	2644481430	353
209	iso_pu_bacteria	2667528174	2671114132	353
210	iso_pu_bacteria	2751185821	2753462896	353
211	iso_pu_bacteria	2757320392	2757569334	353
212	iso_pu_bacteria	2775507266	2778176598	353
213	iso_pu_bacteria	2818991448	2819610014	353
214	iso_pu_bacteria	2818991453	2819640427	353
215	iso_pu_bacteria	2838022645	2838024144	353
216	iso_pu_bacteria	2838029111	2838032666	353
217	iso_pu_bacteria	2838042994	2838048155	353
218	iso_pu_bacteria	2838074704	2838079130	353
219	iso_pu_bacteria	2842198810	2842201738	353
220	iso_pu_bacteria	2842217011	2842223909	353
221	iso_pu_bacteria	2842475841	2842479398	353
222	iso_pu_bacteria	2842502639	2842506443	353
223	iso_pu_bacteria	2896384573	2896385735	353
224	iso_pu_bacteria	2919100787	2919103416	353
225	iso_pu_bacteria	2919408235	2919412544	353
226	iso_pu_bacteria	2920760137	2920766407	353
227	iso_pu_bacteria	3005409236	3005409250	353
228	iso_pu_bacteria	3005416602	3005417290	353
229	iso_pu_bacteria	8005314921	8005320462	353
230	iso_pu_bacteria	8005484373	8005487433	353
231	iso_pu_bacteria	8005645114	8005647839	353
232	iso_pu_bacteria	8005682033	8005684325	353
233	iso_pu_bacteria	8024486573	8024488911	353
234	3300005367	Ga0070667_100103770	Ga0070667_1001037702	354
235	3300053161	Ga0500634_0000001	Ga0500634_0000001_190770_191843	354
236	iso_pu_bacteria	2516143018	2516206772	354
237	iso_pu_bacteria	2690316117	2692319126	354
238	iso_pu_bacteria	2791355094	2792640327	354
239	iso_pu_bacteria	2791355253	2793280594	354
240	iso_pu_bacteria	2847417321	2847422368	354
241	iso_pu_bacteria	2848992105	2848998181	354
242	iso_pu_bacteria	2855872281	2855875751	354
243	iso_pu_bacteria	643692032	643823708	354
244	3300003771	Ga0055526_1000231	Ga0055526_100023128	355
245	3300025295	Ga0209564_1000023	Ga0209564_1000023382	355
246	3300049569	Ga0501032_0037528	Ga0501032_0037528_802_1869	355
247	3300053131	Ga0500652_070313	Ga0500652_070313_146_1216	355
248	iso_pu_bacteria	2643221629	2644165714	355
249	iso_pu_bacteria	2643221662	2644346425	355
250	iso_pu_bacteria	2802429605	2805926086	355
251	iso_pu_bacteria	2917699015	2917700636	355
252	iso_pu_bacteria	8024501048	8024502457	355
253	3300009765	Ga0123341_1000020	Ga0123341_100002067	356
254	3300025230	Ga0209563_102460	Ga0209563_1024603	356
255	3300025297	Ga0209758_1002373	Ga0209758_100237319	356
256	3300028794	Ga0307515_10300493	Ga0307515_103004932	356
257	3300035171	Ga0373946_0054362	Ga0373946_0054362_315_1394	356
258	3300035695	Ga0373927_0002442	Ga0373927_0002442_2474_3553	356
259	3300037068	Ga0373925_0005427	Ga0373925_0005427_3607_4686	356
260	3300046512	Ga0495610_0003039	Ga0495610_0003039_127_1236	356
261	3300046519	Ga0495632_0054367	Ga0495632_0054367_21_1130	356
262	3300046522	Ga0495643_0013350	Ga0495643_0013350_1673_2782	356
263	3300048919	Ga0496116_0043771	Ga0496116_0043771_1468_2562	356
264	3300048920	Ga0496117_0001460	Ga0496117_0001460_26803_27897	356
265	3300048920	Ga0496117_0032227	Ga0496117_0032227_394_1509	356
266	3300048921	Ga0496118_0033989	Ga0496118_0033989_2344_3438	356
267	3300048922	Ga0496119_0072526	Ga0496119_0072526_739_1833	356
268	3300048923	Ga0496120_0017750	Ga0496120_0017750_2524_3618	356
269	3300048924	Ga0496121_0006299	Ga0496121_0006299_8868_9962	356
270	3300048924	Ga0496121_0032209	Ga0496121_0032209_472_1551	356
271	3300048925	Ga0496122_0029605	Ga0496122_0029605_2867_3961	356
272	3300048926	Ga0496123_0117365	Ga0496123_0117365_304_1398	356
273	3300048927	Ga0496124_0161123	Ga0496124_0161123_91_1185	356
274	3300048928	Ga0496125_0015235	Ga0496125_0015235_3322_4416	356
275	3300048929	Ga0496126_0315305	Ga0496126_0315305_90_1184	356
276	3300053093	Ga0500651_0012143	Ga0500651_0012143_3570_4649	356
277	3300053111	Ga0500572_001780	Ga0500572_001780_4209_5303	356
278	3300053130	Ga0500642_0022858	Ga0500642_0022858_532_1611	356
279	iso_pu_bacteria	2509276033	2509446038	356
280	iso_pu_bacteria	2510917030	2511197581	356
281	iso_pu_bacteria	2513237146	2513927373	356
282	iso_pu_bacteria	2585427594	2585842860	356
283	iso_pu_bacteria	2599185170	2599415184	356
284	iso_pu_bacteria	2738541293	2738801476	356
285	iso_pu_bacteria	2791355259	2793313531	356
286	iso_pu_bacteria	2818991467	2819719058	356
287	iso_pu_bacteria	2838035591	2838039091	356
288	iso_pu_bacteria	2838661181	2838664317	356
289	iso_pu_bacteria	2933016740	2933019447	356
290	iso_pu_bacteria	3003930520	3003935089	356
291	iso_pu_bacteria	3005445848	3005451485	356
292	3300001979	JGI24740J21852_10009419	JGI24740J21852_100094192	357
293	3300002704	JGI25155J39150_1000056	JGI25155J39150_100005624	357
294	3300002705	JGI25156J39149_1000007	JGI25156J39149_1000007194	357
295	3300002737	JGI25162J39368_1000322	JGI25162J39368_100032226	357
296	3300002737	JGI25162J39368_1000388	JGI25162J39368_100038821	357
297	3300002738	JGI25154J39366_1000013	JGI25154J39366_100001324	357
298	3300002741	JGI25157J39369_1000012	JGI25157J39369_10000126	357
299	3300002741	JGI25157J39369_1000099	JGI25157J39369_100009924	357
300	3300002773	JGI25152J39213_1000239	JGI25152J39213_10002399	357
301	3300002773	JGI25152J39213_1001578	JGI25152J39213_10015789	357
302	3300002773	JGI25152J39213_1003376	JGI25152J39213_10033764	357
303	3300002774	JGI25150J39212_1000026	JGI25150J39212_100002669	357
304	3300003187	JGI25151J46595_10000053	JGI25151J46595_1000005365	357
305	3300003187	JGI25151J46595_10017200	JGI25151J46595_100172002	357
306	3300003187	JGI25151J46595_10052572	JGI25151J46595_100525721	357
307	3300003214	JGI25165J46597_1000248	JGI25165J46597_100024839	357
308	3300003214	JGI25165J46597_1000569	JGI25165J46597_10005699	357
309	3300003215	JGI25153J46596_10000682	JGI25153J46596_100006822	357
310	3300003215	JGI25153J46596_10025372	JGI25153J46596_100253722	357
311	3300003374	JGI25161J50226_1000025	JGI25161J50226_1000025110	357
312	3300003771	Ga0055526_1006927	Ga0055526_10069276	357
313	3300003775	Ga0055524_1011810	Ga0055524_10118102	357
314	3300003790	Ga0055528_1000515	Ga0055528_100051512	357
315	3300003794	Ga0055531_10003633	Ga0055531_100036334	357
316	3300004625	Ga0055543_1000021	Ga0055543_100002185	357
317	3300005262	Ga0065165_1015659	Ga0065165_10156592	357
318	3300009093	Ga0105240_10000012	Ga0105240_10000012339	357
319	3300009545	Ga0105237_10000054	Ga0105237_10000054105	357
320	3300010375	Ga0105239_10015313	Ga0105239_100153137	357
321	3300010375	Ga0105239_10274384	Ga0105239_102743842	357
322	3300013104	Ga0157370_10000078	Ga0157370_1000007848	357
323	3300015262	Ga0182007_10001537	Ga0182007_100015375	357
324	3300015265	Ga0182005_1002399	Ga0182005_10023995	357
325	3300025206	Ga0209435_100006	Ga0209435_100006331	357
326	3300025208	Ga0209436_100044	Ga0209436_10004465	357
327	3300025228	Ga0209672_104041	Ga0209672_1040412	357
328	3300025233	Ga0209437_100040	Ga0209437_10004026	357
329	3300025233	Ga0209437_100067	Ga0209437_100067282	357
330	3300025233	Ga0209437_111110	Ga0209437_1111102	357
331	3300025245	Ga0207425_1000113	Ga0207425_100011366	357
332	3300025246	Ga0209646_1000015	Ga0209646_1000015203	357
333	3300025250	Ga0209026_1000046	Ga0209026_1000046203	357
334	3300025253	Ga0209677_100158	Ga0209677_10015855	357
335	3300025256	Ga0209759_1000005	Ga0209759_1000005331	357
336	3300025258	Ga0209129_1000082	Ga0209129_1000082103	357
337	3300025258	Ga0209129_1000181	Ga0209129_100018166	357
338	3300025258	Ga0209129_1000969	Ga0209129_100096917	357
339	3300025258	Ga0209129_1002611	Ga0209129_10026117	357
340	3300025261	Ga0209233_1000051	Ga0209233_100005127	357
341	3300025261	Ga0209233_1000088	Ga0209233_1000088282	357
342	3300025261	Ga0209233_1000161	Ga0209233_1000161126	357
343	3300025273	Ga0209673_1000005	Ga0209673_1000005118	357
344	3300025273	Ga0209673_1003632	Ga0209673_10036325	357
345	3300025284	Ga0209130_1000001	Ga0209130_1000001185	357
346	3300025294	Ga0209025_1000181	Ga0209025_100018181	357
347	3300025294	Ga0209025_1005172	Ga0209025_10051729	357
348	3300025294	Ga0209025_1012688	Ga0209025_10126882	357
349	3300025294	Ga0209025_1014558	Ga0209025_10145583	357
350	3300025295	Ga0209564_1003532	Ga0209564_10035324	357
351	3300025297	Ga0209758_1000156	Ga0209758_100015681	357
352	3300025298	Ga0209050_1005583	Ga0209050_10055836	357
353	3300025299	Ga0209256_1002390	Ga0209256_100239011	357
354	3300025302	Ga0207426_1000005	Ga0207426_1000005790	357
355	3300025303	Ga0209051_1059452	Ga0209051_10594522	357
356	3300025304	Ga0209257_1001285	Ga0209257_100128510	357
357	3300025913	Ga0207695_10000097	Ga0207695_10000097130	357
358	3300025914	Ga0207671_10000023	Ga0207671_10000023213	357
359	3300025923	Ga0207681_10272164	Ga0207681_102721641	357
360	3300025949	Ga0207667_10232830	Ga0207667_102328302	357
361	3300026078	Ga0207702_10151221	Ga0207702_101512211	357
362	3300028794	Ga0307515_10000068	Ga0307515_100000685	357
363	3300028794	Ga0307515_10000145	Ga0307515_10000145112	357
364	3300028794	Ga0307515_10011115	Ga0307515_1001111515	357
365	3300028794	Ga0307515_10013167	Ga0307515_100131673	357
366	3300028794	Ga0307515_10068604	Ga0307515_100686043	357
367	3300031456	Ga0307513_10009000	Ga0307513_100090005	357
368	3300031456	Ga0307513_10252330	Ga0307513_102523302	357
369	3300037471	Ga0395905_0006852	Ga0395905_0006852_9984_11060	357
370	3300037471	Ga0395905_0029264	Ga0395905_0029264_1281_2357	357
371	3300037471	Ga0395905_0066164	Ga0395905_0066164_487_1563	357
372	3300041413	Ga0439465_0018834	Ga0439465_0018834_652_1749	357
373	3300041491	Ga0451833_1404057	Ga0451833_1404057_137_1222	357
374	3300042006	Ga0439432_024495	Ga0439432_024495_505_1602	357
375	3300042122	Ga0450920_008326	Ga0450920_008326_67_1152	357
376	3300042531	Ga0450918_014222	Ga0450918_014222_217_1302	357
377	3300046459	Ga0495629_0012041	Ga0495629_0012041_341_1414	357
378	3300046460	Ga0495638_0000145	Ga0495638_0000145_52795_53871	357
379	3300046460	Ga0495638_0101522	Ga0495638_0101522_400_1494	357
380	3300046462	Ga0495651_0267396	Ga0495651_0267396_64_1137	357
381	3300046474	Ga0495605_0011024	Ga0495605_0011024_2779_3855	357
382	3300046492	Ga0495585_0019254	Ga0495585_0019254_2025_3101	357
383	3300046507	Ga0495606_0001061	Ga0495606_0001061_31195_32268	357
384	3300046507	Ga0495606_0051136	Ga0495606_0051136_1513_2625	357
385	3300046522	Ga0495643_0019014	Ga0495643_0019014_360_1439	357
386	3300046529	Ga0495652_0066822	Ga0495652_0066822_186_1259	357
387	3300046538	Ga0495609_0028500	Ga0495609_0028500_1264_2340	357
388	3300046557	Ga0495622_0012068	Ga0495622_0012068_1788_2861	357
389	3300046616	Ga0495668_0004522	Ga0495668_0004522_3689_4765	357
390	3300046660	Ga0495625_0000467	Ga0495625_0000467_27103_28179	357
391	3300046691	Ga0495670_0018997	Ga0495670_0018997_585_1661	357
392	3300046809	Ga0495600_0203794	Ga0495600_0203794_138_1217	357
393	3300047317	Ga0495604_0070023	Ga0495604_0070023_164_1237	357
394	3300047472	Ga0495686_0043944	Ga0495686_0043944_785_1867	357
395	3300048905	Ga0496102_0114559	Ga0496102_0114559_719_1792	357
396	3300048906	Ga0496103_0053578	Ga0496103_0053578_690_1763	357
397	3300048909	Ga0496106_0000275	Ga0496106_0000275_1623_2702	357
398	3300048910	Ga0496107_0171493	Ga0496107_0171493_462_1538	357
399	3300048914	Ga0496111_0005562	Ga0496111_0005562_3582_4700	357
400	3300048919	Ga0496116_0027886	Ga0496116_0027886_2190_3275	357
401	3300048919	Ga0496116_0123563	Ga0496116_0123563_76_1164	357
402	3300048920	Ga0496117_0001500	Ga0496117_0001500_5675_6748	357
403	3300048920	Ga0496117_0058277	Ga0496117_0058277_450_1538	357
404	3300048920	Ga0496117_0070204	Ga0496117_0070204_15_1100	357
405	3300048921	Ga0496118_0002016	Ga0496118_0002016_26628_27701	357
406	3300048921	Ga0496118_0015614	Ga0496118_0015614_1010_2098	357
407	3300048921	Ga0496118_0038885	Ga0496118_0038885_1604_2689	357
408	3300048922	Ga0496119_0118766	Ga0496119_0118766_357_1430	357
409	3300048923	Ga0496120_0015716	Ga0496120_0015716_368_1441	357
410	3300048924	Ga0496121_0024706	Ga0496121_0024706_1047_2126	357
411	3300048924	Ga0496121_0036699	Ga0496121_0036699_2923_3996	357
412	3300048924	Ga0496121_0037891	Ga0496121_0037891_1599_2675	357
413	3300048924	Ga0496121_0045471	Ga0496121_0045471_1098_2174	357
414	3300048924	Ga0496121_0073102	Ga0496121_0073102_1545_2621	357
415	3300048924	Ga0496121_0085848	Ga0496121_0085848_1015_2172	357
416	3300048925	Ga0496122_0004639	Ga0496122_0004639_814_1887	357
417	3300048925	Ga0496122_0023679	Ga0496122_0023679_3220_4338	357
418	3300048925	Ga0496122_0041305	Ga0496122_0041305_1557_2642	357
419	3300048925	Ga0496122_0053838	Ga0496122_0053838_567_1643	357
420	3300048926	Ga0496123_0003850	Ga0496123_0003850_998_2083	357
421	3300048926	Ga0496123_0011936	Ga0496123_0011936_5414_6487	357
422	3300048926	Ga0496123_0033496	Ga0496123_0033496_2063_3142	357
423	3300048926	Ga0496123_0068459	Ga0496123_0068459_641_1759	357
424	3300048927	Ga0496124_0000832	Ga0496124_0000832_48260_49333	357
425	3300048927	Ga0496124_0016292	Ga0496124_0016292_2167_3252	357
426	3300048927	Ga0496124_0053249	Ga0496124_0053249_744_1817	357
427	3300048927	Ga0496124_0129663	Ga0496124_0129663_748_1866	357
428	3300048927	Ga0496124_0163861	Ga0496124_0163861_396_1475	357
429	3300048927	Ga0496124_0171365	Ga0496124_0171365_174_1250	357
430	3300048928	Ga0496125_0017359	Ga0496125_0017359_4825_5910	357
431	3300048929	Ga0496126_0034992	Ga0496126_0034992_1165_2241	357
432	3300048929	Ga0496126_0037239	Ga0496126_0037239_1108_2193	357
433	3300048929	Ga0496126_0252374	Ga0496126_0252374_196_1281	357
434	3300049460	Ga0495682_0047537	Ga0495682_0047537_11_1087	357
435	3300049575	Ga0501039_0103537	Ga0501039_0103537_780_1853	357
436	3300049582	Ga0501048_0116114	Ga0501048_0116114_207_1280	357
437	3300049744	Ga0501083_0110183	Ga0501083_0110183_585_1664	357
438	3300050516	nmdc:mga0sz30_1705_c1	nmdc:mga0sz30_1705_c1_753_1838	357
439	3300053086	Ga0500578_0083125	Ga0500578_0083125_714_1790	357
440	3300053088	Ga0500644_0004368	Ga0500644_0004368_1704_2798	357
441	3300053093	Ga0500651_0046825	Ga0500651_0046825_197_1276	357
442	3300053105	Ga0500557_004851	Ga0500557_004851_679_1755	357
443	3300053118	Ga0500594_0002244	Ga0500594_0002244_737_1813	357
444	3300053125	Ga0500618_010358	Ga0500618_010358_592_1665	357
445	3300053136	Ga0500559_0008057	Ga0500559_0008057_2732_3808	357
446	3300053139	Ga0500568_0000184	Ga0500568_0000184_1003_2079	357
447	3300053139	Ga0500568_0003144	Ga0500568_0003144_976_2055	357
448	3300053156	Ga0500622_0000185	Ga0500622_0000185_1605_2684	357
449	3300053156	Ga0500622_0007625	Ga0500622_0007625_1516_2610	357
450	3300053177	Ga0500636_0036234	Ga0500636_0036234_547_1620	357
451	3300060353	Ga0501082_0052523	Ga0501082_0052523_679_1758	357
452	iso_pu_bacteria	2513237144	2513914743	357
453	iso_pu_bacteria	2582581283	2585167164	357
454	iso_pu_bacteria	2582581306	2585269116	357
455	iso_pu_bacteria	2582581865	2585390618	357
456	iso_pu_bacteria	2585427633	2585992675	357
457	iso_pu_bacteria	2585427634	2586003392	357
458	iso_pu_bacteria	2599185156	2599334328	357
459	iso_pu_bacteria	2615840624	2616296436	357
460	iso_pu_bacteria	2643221643	2644237767	357
461	iso_pu_bacteria	2718217882	2719182840	357
462	iso_pu_bacteria	2718218009	2719733557	357
463	iso_pu_bacteria	2718218363	2721148952	357
464	iso_pu_bacteria	2718218365	2721160350	357
465	iso_pu_bacteria	2718218366	2721165765	357
466	iso_pu_bacteria	2721755514	2722841935	357
467	iso_pu_bacteria	2721755810	2724046313	357
468	iso_pu_bacteria	2728369365	2730166075	357
469	iso_pu_bacteria	2728369397	2730299982	357
470	iso_pu_bacteria	2791355260	2793325031	357
471	iso_pu_bacteria	2791355264	2793346477	357
472	iso_pu_bacteria	2791355266	2793359522	357
473	iso_pu_bacteria	2818991448	2819613423	357
474	iso_pu_bacteria	2839993093	2839996675	357
475	iso_pu_bacteria	2842922631	2842925390	357
476	iso_pu_bacteria	2854896431	2854900021	357
477	iso_pu_bacteria	2936375103	2936378929	357
478	iso_pu_bacteria	8005301065	8005305835	357
479	iso_pu_bacteria	8005645114	8005648568	357
480	iso_pu_bacteria	8005688590	8005690056	357
481	iso_pu_bacteria	8018127388	8018130661	357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

187

0.98 PF08402

TOBE_2

TOBE domain

300

370

0.9 PF17912

OB_MalK

MalK OB fold domain

260

307

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4tqu-assembly1.cif.gz_T	crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate	0.9485	4	357
7x0q-assembly1.cif.gz_A	crystal structure of atpase clo1313_2554 from clostridium thermocellum	0.94	6	357
5xu1-assembly1.cif.gz_A	structure of a non-canonical abc transporter from streptococcus pneumoniae r6	0.9398	3	218
4tqu-assembly1.cif.gz_T	crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate	0.9382	4	357
2onk-assembly1.cif.gz_B	abc transporter modbc in complex with its binding protein moda	0.937	5	235

ID	Description	Score	Start	End	Superfamily
af_P77795_1_218_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9786	4	219	3.40.50.300
2awoD01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9745	6	218	3.40.50.300
af_P77795_1_218_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9654	4	219	3.40.50.300
1oxuA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9632	6	237	3.40.50.300
2awnA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9614	6	218	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A6D0IIJ6-F1-model_v4	ATP-binding cassette domain-containing protein	0.9822	32	264	GO:0005524 GO:0008643 GO:0016887 GO:0055052 GO:0140359
AF-A0A5J4F8B2-F1-model_v4	Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)	0.9801	6	244	GO:0005524 GO:0015419 GO:0016887 GO:0043190
AF-A0A0D6JVA7-F1-model_v4	Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6)	0.9756	6	237	GO:0005524 GO:0016887
AF-A0A7J9YE84-F1-model_v4	ATP-binding cassette domain-containing protein	0.975	6	223	GO:0005524 GO:0016887 GO:0055052
AF-A0A1J5HAE4-F1-model_v4	Sugar ABC transporter ATP-binding protein	0.9728	4	281	GO:0005524 GO:0008643 GO:0016887 GO:0055052 GO:0140359

Feature Viewer

pLDDT	pTM	Quality
92.75	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F452479

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

44

187

0.98

PF08402

TOBE_2

TOBE domain

300

370

0.9

PF17912

OB_MalK

MalK OB fold domain

260

307

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map