F452444

General Info

Members Datasets Scaffolds Average Seq Length
481 193 481 237

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10164923|Ga0307411_101649232
Length 231
Sequence MWSSGRSEASLEAGLPVPIEIRPVRGARRLRLRLDDASGTLKLTCPLRTSRRAALAWALDQREWIEAQLARALPPEPFVPGAIIPVEGVETTLLWSPGEPRAPRLAGAELVCGGPREGFSRRMELYLKRLALDVMSLEVAEFARSVSVGDAATRWGSCSSGGAIRLSWRLVLAPPNVRRYVVAHEVAHLAHLDHGREFKALEARLFGPGVAEAKAALRRIGPRLRRIGRGT

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
162 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 4.78
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10016226 3300001979 Bacteria 2696
2 JGI24739J22299_10000653 3300001989 Bacteria 12444
3 JGI24737J22298_10000027 3300001990 Bacteria 43503
4 JGI24737J22298_10015450 3300001990 Bacteria 2471
5 JGI24735J21928_10073124 3300002067 Unclassified 982
6 JGI24738J21930_10004592 3300002075 Bacteria 3372
7 JGI24738J21930_10005479 3300002075 Bacteria 3039
8 Ga0070658_10000177 3300005327 Bacteria 56043
9 Ga0070658_10031868 3300005327 Bacteria 4236
10 Ga0070658_10064999 3300005327 Bacteria 2976
11 Ga0070658_10144665 3300005327 Bacteria 1987
12 Ga0070676_10001875 3300005328 Bacteria 10696
13 Ga0070683_100004360 3300005329 Bacteria 11644
14 Ga0070690_100039143 3300005330 Bacteria 2995
15 Ga0070670_100003382 3300005331 Bacteria 13217
16 Ga0070670_100042084 3300005331 Bacteria 3926
17 Ga0070670_100060498 3300005331 Bacteria 3252
18 Ga0070670_100093882 3300005331 Bacteria 2580
19 Ga0070670_100338758 3300005331 Bacteria 1320
20 Ga0070677_10019132 3300005333 Bacteria 2476
21 Ga0068869_100000085 3300005334 Bacteria 42599
22 Ga0068869_100105697 3300005334 Bacteria 2135
23 Ga0068869_100914475 3300005334 Bacteria 760
24 Ga0070666_10002806 3300005335 Bacteria 10520
25 Ga0070666_10172552 3300005335 Bacteria 1515
26 Ga0070666_10227641 3300005335 Bacteria 1316
27 Ga0070682_100016463 3300005337 Bacteria 4298
28 Ga0070682_100258652 3300005337 Bacteria 1259
29 Ga0068868_100002300 3300005338 Bacteria 13214
30 Ga0068868_100264533 3300005338 Bacteria 1451
31 Ga0070660_100000065 3300005339 Bacteria 61999
32 Ga0070660_100002055 3300005339 Bacteria 13887
33 Ga0070660_100017432 3300005339 Bacteria 5235
34 Ga0070660_100099476 3300005339 Bacteria 2303
35 Ga0070660_100773877 3300005339 Bacteria 806
36 Ga0070689_100473380 3300005340 Bacteria 1069
37 Ga0070689_100671150 3300005340 Bacteria 903
38 Ga0070661_100000084 3300005344 Bacteria 74971
39 Ga0070661_100034090 3300005344 Bacteria 3692
40 Ga0070661_100124616 3300005344 Bacteria 1932
41 Ga0070668_100004743 3300005347 Bacteria 10087
42 Ga0070668_100026394 3300005347 Bacteria 4408
43 Ga0070668_100040102 3300005347 Bacteria 3582
44 Ga0070669_100005573 3300005353 Bacteria 9093
45 Ga0070669_100013210 3300005353 Bacteria 5871
46 Ga0070669_100038445 3300005353 Bacteria 3475
47 Ga0070669_100050589 3300005353 Bacteria 3036
48 Ga0070669_100075266 3300005353 Bacteria 2503
49 Ga0070675_100002909 3300005354 Bacteria 12908
50 Ga0070675_100182332 3300005354 Bacteria 1816
51 Ga0070671_100008513 3300005355 Bacteria 8222
52 Ga0070671_100027725 3300005355 Bacteria 4664
53 Ga0070671_100386749 3300005355 Bacteria 1196
54 Ga0070671_100539720 3300005355 Unclassified 1005
55 Ga0070674_100028634 3300005356 Bacteria 3659
56 Ga0070673_100000058 3300005364 Bacteria 45772
57 Ga0070673_100019209 3300005364 Bacteria 4904
58 Ga0070673_100020640 3300005364 Bacteria 4754
59 Ga0070673_100064938 3300005364 Bacteria 2910
60 Ga0070659_100001520 3300005366 Bacteria 16726
61 Ga0070659_100001878 3300005366 Bacteria 15053
62 Ga0070659_100108109 3300005366 Bacteria 2243
63 Ga0070667_100006202 3300005367 Bacteria 9946
64 Ga0070667_100021891 3300005367 Bacteria 5304
65 Ga0070667_100042270 3300005367 Bacteria 3824
66 Ga0070667_100047561 3300005367 Bacteria 3609
67 Ga0070667_100120434 3300005367 Bacteria 2282
68 Ga0070667_100272294 3300005367 Bacteria 1518
69 Ga0070667_100330597 3300005367 Bacteria 1377
70 Ga0070714_100015427 3300005435 Bacteria 6149
71 Ga0070713_100035859 3300005436 Bacteria 3997
72 Ga0070663_100001477 3300005455 Bacteria 12918
73 Ga0070663_100020745 3300005455 Bacteria 4354
74 Ga0070678_100041993 3300005456 Bacteria 3247
75 Ga0070662_100000017 3300005457 Bacteria 105478
76 Ga0070662_100034247 3300005457 Bacteria 3580
77 Ga0070662_100035154 3300005457 Bacteria 3537
78 Ga0070662_100067670 3300005457 Bacteria 2623
79 Ga0070681_10602622 3300005458 Bacteria 1013
80 Ga0068867_100002374 3300005459 Bacteria 13239
81 Ga0068867_100002594 3300005459 Bacteria 12741
82 Ga0068867_100058883 3300005459 Bacteria 2846
83 Ga0070685_10402415 3300005466 Bacteria 948
84 Ga0070679_100299129 3300005530 Bacteria 1560
85 Ga0070684_100008650 3300005535 Bacteria 7976
86 Ga0068853_100126119 3300005539 Bacteria 2287
87 Ga0068853_100135385 3300005539 Bacteria 2208
88 Ga0070672_100072969 3300005543 Bacteria 2734
89 Ga0070672_100189555 3300005543 Bacteria 1716
90 Ga0070672_100390817 3300005543 Bacteria 1191
91 Ga0070686_100228224 3300005544 Bacteria 1349
92 Ga0070696_100052620 3300005546 Bacteria 2833
93 Ga0070696_100659392 3300005546 Bacteria 849
94 Ga0070693_100003637 3300005547 Bacteria 7205
95 Ga0070693_100262719 3300005547 Bacteria 1149
96 Ga0070665_100009518 3300005548 Bacteria 9828
97 Ga0070665_100010899 3300005548 Bacteria 9194
98 Ga0070665_100021178 3300005548 Bacteria 6536
99 Ga0070665_100048833 3300005548 Bacteria 4248
100 Ga0070665_100340925 3300005548 Bacteria 1503
101 Ga0068855_100000194 3300005563 Bacteria 78505
102 Ga0068855_100013882 3300005563 Bacteria 9713
103 Ga0070664_100000098 3300005564 Bacteria 55907
104 Ga0070664_100001195 3300005564 Bacteria 20694
105 Ga0070664_100004600 3300005564 Bacteria 11073
106 Ga0070664_100029056 3300005564 Bacteria 4607
107 Ga0070664_100077120 3300005564 Bacteria 2865
108 Ga0068857_100000665 3300005577 Bacteria 25438
109 Ga0068857_100019565 3300005577 Bacteria 5946
110 Ga0068854_100000173 3300005578 Bacteria 43694
111 Ga0068854_100020658 3300005578 Bacteria 4461
112 Ga0068854_100023454 3300005578 Bacteria 4215
113 Ga0068854_100288988 3300005578 Bacteria 1322
114 Ga0068856_100000098 3300005614 Bacteria 83221
115 Ga0068856_100032252 3300005614 Bacteria 5128
116 Ga0068856_100046194 3300005614 Bacteria 4289
117 Ga0070702_100158595 3300005615 Bacteria 1460
118 Ga0068852_100000440 3300005616 Bacteria 27519
119 Ga0068852_100003637 3300005616 Bacteria 10799
120 Ga0068852_100028817 3300005616 Bacteria 4549
121 Ga0068852_100433493 3300005616 Bacteria 1298
122 Ga0068859_100001231 3300005617 Bacteria 26157
123 Ga0068859_100005244 3300005617 Bacteria 13170
124 Ga0068859_100057868 3300005617 Bacteria 3904
125 Ga0068864_100000235 3300005618 Bacteria 49611
126 Ga0068864_100000953 3300005618 Bacteria 24235
127 Ga0068864_100006611 3300005618 Bacteria 9487
128 Ga0068864_100464188 3300005618 Bacteria 1213
129 Ga0068861_100097816 3300005719 Bacteria 2329
130 Ga0068851_10017630 3300005834 Bacteria 3432
131 Ga0068851_10101549 3300005834 Bacteria 1527
132 Ga0068870_10072294 3300005840 Bacteria 1884
133 Ga0068870_10115878 3300005840 Bacteria 1537
134 Ga0068863_100004123 3300005841 Bacteria 14367
135 Ga0068863_100094773 3300005841 Bacteria 2833
136 Ga0068863_100111816 3300005841 Bacteria 2601
137 Ga0068858_100000695 3300005842 Bacteria 35157
138 Ga0068858_100037523 3300005842 Bacteria 4494
139 Ga0068860_100006046 3300005843 Bacteria 12183
140 Ga0068860_100027907 3300005843 Bacteria 5435
141 Ga0068860_100046582 3300005843 Bacteria 4134
142 Ga0068860_100656940 3300005843 Bacteria 1056
143 Ga0068862_100009816 3300005844 Bacteria 7910
144 Ga0068862_100164749 3300005844 Bacteria 1981
145 Ga0068862_100334861 3300005844 Bacteria 1400
146 Ga0081539_10020238 3300005985 Bacteria 4509
147 Ga0070717_10017659 3300006028 Bacteria 5555
148 Ga0070716_100070302 3300006173 Bacteria 2055
149 Ga0070712_100017015 3300006175 Bacteria 4701
150 Ga0097621_100041530 3300006237 Bacteria 3702
151 Ga0097621_100228977 3300006237 Bacteria 1622
152 Ga0068871_100070166 3300006358 Bacteria 2879
153 Ga0075428_100301138 3300006844 Bacteria 1724
154 Ga0068865_100029596 3300006881 Bacteria 3636
155 Ga0097620_100001231 3300006931 Bacteria 26157
156 Ga0097620_100005244 3300006931 Bacteria 13170
157 Ga0097620_100057866 3300006931 Bacteria 3904
158 Ga0105250_10008013 3300009092 Bacteria 4505
159 Ga0105240_10610096 3300009093 Bacteria 1200
160 Ga0105245_10000170 3300009098 Bacteria 61721
161 Ga0105248_10000184 3300009177 Bacteria 72728
162 Ga0105248_10000444 3300009177 Bacteria 47003
163 Ga0105248_10002231 3300009177 Bacteria 21411
164 Ga0105248_10004136 3300009177 Bacteria 16054
165 Ga0105248_10037980 3300009177 Bacteria 5387
166 Ga0105248_10060365 3300009177 Bacteria 4257
167 Ga0105248_10164862 3300009177 Bacteria 2499
168 Ga0105238_10118335 3300009551 Bacteria 2629
169 Ga0105249_10088712 3300009553 Bacteria 2889
170 Ga0105239_10063330 3300010375 Bacteria 4060
171 Ga0105246_10129503 3300011119 Bacteria 1882
172 Ga0157373_10005169 3300013100 Bacteria 9805
173 Ga0157371_10000443 3300013102 Bacteria 50736
174 Ga0157371_10002003 3300013102 Bacteria 20140
175 Ga0157371_10010863 3300013102 Bacteria 7063
176 Ga0157371_10092704 3300013102 Bacteria 2140
177 Ga0157370_10038576 3300013104 Bacteria 4620
178 Ga0157369_10633184 3300013105 Bacteria 1103
179 Ga0157374_10005411 3300013296 Bacteria 10726
180 Ga0157374_10132825 3300013296 Bacteria 2410
181 Ga0163162_10008350 3300013306 Bacteria 10096
182 Ga0157372_10059386 3300013307 Bacteria 4277
183 Ga0157372_10123526 3300013307 Bacteria 2976
184 Ga0157372_11273024 3300013307 Unclassified 849
185 Ga0157375_10385127 3300013308 Bacteria 1569
186 Ga0157375_10690793 3300013308 Bacteria 1174
187 Ga0163163_10000131 3300014325 Bacteria 76809
188 Ga0163163_10000169 3300014325 Bacteria 68481
189 Ga0157379_10002480 3300014968 Bacteria 15449
190 Ga0157376_10215819 3300014969 Bacteria 1774
191 Ga0207673_1019353 3300025290 Bacteria 914
192 Ga0207697_10000072 3300025315 Bacteria 43473
193 Ga0207656_10072665 3300025321 Bacteria 1532
194 Ga0207696_1022336 3300025711 Bacteria 2012
195 Ga0207642_10177171 3300025899 Bacteria 1159
196 Ga0207688_10000106 3300025901 Bacteria 33178
197 Ga0207688_10028116 3300025901 Bacteria 3094
198 Ga0207680_10138247 3300025903 Bacteria 1613
199 Ga0207680_10428339 3300025903 Unclassified 937
200 Ga0207647_10000246 3300025904 Bacteria 44259
201 Ga0207647_10002702 3300025904 Bacteria 13390
202 Ga0207699_10201169 3300025906 Bacteria 1350
203 Ga0207645_10009048 3300025907 Bacteria 6911
204 Ga0207645_10012283 3300025907 Bacteria 5815
205 Ga0207645_10025100 3300025907 Bacteria 3859
206 Ga0207645_10336931 3300025907 Bacteria 1008
207 Ga0207643_10045668 3300025908 Bacteria 2474
208 Ga0207705_10000137 3300025909 Bacteria 79174
209 Ga0207705_10045569 3300025909 Bacteria 3152
210 Ga0207705_10074441 3300025909 Bacteria 2465
211 Ga0207695_10549175 3300025913 Bacteria 1037
212 Ga0207657_10000508 3300025919 Bacteria 41139
213 Ga0207657_10008573 3300025919 Bacteria 10358
214 Ga0207657_10014410 3300025919 Bacteria 7721
215 Ga0207657_10020716 3300025919 Bacteria 6207
216 Ga0207657_10051139 3300025919 Bacteria 3592
217 Ga0207649_10000965 3300025920 Bacteria 17825
218 Ga0207649_10062681 3300025920 Bacteria 2345
219 Ga0207649_10115262 3300025920 Bacteria 1802
220 Ga0207649_10118891 3300025920 Bacteria 1778
221 Ga0207652_10274734 3300025921 Bacteria 1520
222 Ga0207681_10028285 3300025923 Bacteria 3630
223 Ga0207681_10032374 3300025923 Bacteria 3422
224 Ga0207681_10063181 3300025923 Bacteria 2552
225 Ga0207681_10143250 3300025923 Bacteria 1782
226 Ga0207694_10122826 3300025924 Bacteria 2074
227 Ga0207650_10041137 3300025925 Bacteria 3385
228 Ga0207650_10043793 3300025925 Bacteria 3287
229 Ga0207650_10077696 3300025925 Bacteria 2510
230 Ga0207650_10255587 3300025925 Bacteria 1420
231 Ga0207659_10096272 3300025926 Bacteria 2222
232 Ga0207659_10110722 3300025926 Bacteria 2087
233 Ga0207659_10167270 3300025926 Bacteria 1732
234 Ga0207687_10001079 3300025927 Bacteria 18514
235 Ga0207664_10130190 3300025929 Bacteria 2117
236 Ga0207664_10179559 3300025929 Bacteria 1816
237 Ga0207664_10453904 3300025929 Bacteria 1144
238 Ga0207644_10006549 3300025931 Bacteria 7589
239 Ga0207644_10013001 3300025931 Bacteria 5540
240 Ga0207644_10242472 3300025931 Bacteria 1435
241 Ga0207690_10000108 3300025932 Bacteria 67599
242 Ga0207690_10072257 3300025932 Bacteria 2382
243 Ga0207706_10000224 3300025933 Bacteria 62043
244 Ga0207706_10000514 3300025933 Bacteria 41167
245 Ga0207706_10002457 3300025933 Bacteria 18092
246 Ga0207706_10009377 3300025933 Bacteria 8986
247 Ga0207706_10018451 3300025933 Bacteria 6278
248 Ga0207706_10049295 3300025933 Bacteria 3722
249 Ga0207706_10183800 3300025933 Bacteria 1836
250 Ga0207709_10011672 3300025935 Bacteria 4843
251 Ga0207670_10607955 3300025936 Bacteria 898
252 Ga0207669_10005104 3300025937 Bacteria 5849
253 Ga0207704_10008603 3300025938 Bacteria 4889
254 Ga0207704_10207970 3300025938 Bacteria 1438
255 Ga0207691_10000750 3300025940 Bacteria 32085
256 Ga0207691_10232352 3300025940 Bacteria 1596
257 Ga0207711_10000105 3300025941 Bacteria 90036
258 Ga0207711_10001099 3300025941 Bacteria 25801
259 Ga0207711_10003265 3300025941 Bacteria 14119
260 Ga0207711_10083575 3300025941 Bacteria 2793
261 Ga0207711_10168691 3300025941 Bacteria 1985
262 Ga0207689_10000051 3300025942 Bacteria 88480
263 Ga0207689_10004140 3300025942 Bacteria 13186
264 Ga0207689_10042762 3300025942 Bacteria 3746
265 Ga0207689_10101764 3300025942 Bacteria 2360
266 Ga0207661_10009086 3300025944 Bacteria 7122
267 Ga0207679_10000114 3300025945 Bacteria 64628
268 Ga0207679_10035461 3300025945 Bacteria 3530
269 Ga0207679_10070111 3300025945 Bacteria 2640
270 Ga0207679_10071708 3300025945 Bacteria 2614
271 Ga0207679_10465579 3300025945 Bacteria 1123
272 Ga0207679_10471543 3300025945 Bacteria 1116
273 Ga0207667_10006612 3300025949 Bacteria 14015
274 Ga0207667_10016322 3300025949 Bacteria 8393
275 Ga0207667_10479957 3300025949 Bacteria 1262
276 Ga0207667_10559324 3300025949 Bacteria 1156
277 Ga0207651_10000232 3300025960 Bacteria 24043
278 Ga0207651_10016970 3300025960 Bacteria 4286
279 Ga0207651_10113802 3300025960 Bacteria 2037
280 Ga0207651_10128271 3300025960 Bacteria 1937
281 Ga0207712_10007168 3300025961 Bacteria 7030
282 Ga0207712_10178784 3300025961 Bacteria 1665
283 Ga0207712_10736407 3300025961 Bacteria 863
284 Ga0207668_10000086 3300025972 Bacteria 69871
285 Ga0207668_10078622 3300025972 Bacteria 2383
286 Ga0207668_10425290 3300025972 Bacteria 1128
287 Ga0207640_10000999 3300025981 Bacteria 15663
288 Ga0207640_10006341 3300025981 Bacteria 6487
289 Ga0207640_10017489 3300025981 Bacteria 4196
290 Ga0207640_10354143 3300025981 Bacteria 1180
291 Ga0207640_10369814 3300025981 Bacteria 1158
292 Ga0207658_10002159 3300025986 Bacteria 14623
293 Ga0207658_10012786 3300025986 Bacteria 5732
294 Ga0207658_10016611 3300025986 Bacteria 5065
295 Ga0207658_10021527 3300025986 Bacteria 4478
296 Ga0207658_10132530 3300025986 Bacteria 2004
297 Ga0207658_10532643 3300025986 Bacteria 1049
298 Ga0207677_10138495 3300026023 Bacteria 1860
299 Ga0207703_10004813 3300026035 Bacteria 10991
300 Ga0207703_10013810 3300026035 Bacteria 6293
301 Ga0207703_10110050 3300026035 Bacteria 2349
302 Ga0207639_10000139 3300026041 Bacteria 54240
303 Ga0207639_10175395 3300026041 Bacteria 1819
304 Ga0207678_10003875 3300026067 Bacteria 13454
305 Ga0207678_10005439 3300026067 Bacteria 11393
306 Ga0207678_10006212 3300026067 Bacteria 10615
307 Ga0207678_10064399 3300026067 Bacteria 3149
308 Ga0207678_10132028 3300026067 Bacteria 2131
309 Ga0207702_10001266 3300026078 Bacteria 25382
310 Ga0207702_10186488 3300026078 Bacteria 1913
311 Ga0207641_10000172 3300026088 Bacteria 90549
312 Ga0207641_10004187 3300026088 Bacteria 12567
313 Ga0207641_10010991 3300026088 Bacteria 7422
314 Ga0207641_10839511 3300026088 Bacteria 910
315 Ga0207648_10000221 3300026089 Bacteria 61280
316 Ga0207648_10003003 3300026089 Bacteria 17824
317 Ga0207648_10018994 3300026089 Bacteria 6206
318 Ga0207648_10061752 3300026089 Bacteria 3267
319 Ga0207676_10000300 3300026095 Bacteria 42535
320 Ga0207676_10008095 3300026095 Bacteria 7471
321 Ga0207676_10017858 3300026095 Bacteria 5147
322 Ga0207676_10029769 3300026095 Bacteria 4091
323 Ga0207674_10002274 3300026116 Bacteria 24350
324 Ga0207674_10002318 3300026116 Bacteria 24105
325 Ga0207674_10004402 3300026116 Bacteria 16970
326 Ga0207674_10032337 3300026116 Bacteria 5489
327 Ga0207675_100031485 3300026118 Bacteria 4940
328 Ga0207675_100331262 3300026118 Bacteria 1488
329 Ga0207683_10146762 3300026121 Bacteria 2128
330 Ga0207683_10168967 3300026121 Bacteria 1980
331 Ga0207683_10203349 3300026121 Bacteria 1801
332 Ga0207698_10000598 3300026142 Bacteria 21116
333 Ga0207698_10011726 3300026142 Bacteria 5696
334 Ga0207698_10012415 3300026142 Bacteria 5572
335 Ga0207698_10214380 3300026142 Bacteria 1735
336 Ga0207698_10290470 3300026142 Bacteria 1517
337 Ga0207698_10661915 3300026142 Bacteria 1035
338 Ga0268266_10000200 3300028379 Bacteria 104456
339 Ga0268266_10020456 3300028379 Bacteria 5641
340 Ga0268266_10025686 3300028379 Bacteria 5011
341 Ga0268266_10296491 3300028379 Bacteria 1507
342 Ga0268265_10006617 3300028380 Bacteria 7844
343 Ga0268265_10021511 3300028380 Bacteria 4520
344 Ga0268265_10058746 3300028380 Bacteria 2938
345 Ga0268265_10203573 3300028380 Bacteria 1719
346 Ga0268265_10276243 3300028380 Bacteria 1501
347 Ga0268264_10001244 3300028381 Bacteria 24285
348 Ga0268264_10003848 3300028381 Bacteria 12879
349 Ga0268264_10004275 3300028381 Bacteria 12190
350 Ga0268264_10016840 3300028381 Bacteria 5983
351 Ga0307513_10089377 3300031456 Bacteria 3145
352 Ga0307513_10207470 3300031456 Bacteria 1794
353 Ga0307413_10059607 3300031824 Bacteria 2346
354 Ga0307413_10091252 3300031824 Bacteria 1984
355 Ga0307413_10112707 3300031824 Bacteria 1824
356 Ga0307410_10023575 3300031852 Bacteria 3829
357 Ga0307407_10127694 3300031903 Bacteria 1622
358 Ga0307412_10216626 3300031911 Bacteria 1465
359 Ga0307409_100023447 3300031995 Bacteria 4277
360 Ga0307409_100999631 3300031995 Bacteria 854
361 Ga0307416_101132481 3300032002 Unclassified 887
362 Ga0307414_10703633 3300032004 Unclassified 915
363 Ga0307411_10035684 3300032005 Bacteria 3108
364 Ga0307411_10046600 3300032005 Bacteria 2796
365 Ga0307411_10164923 3300032005 Bacteria 1664
366 Ga0307411_10192855 3300032005 Bacteria 1557
367 Ga0373941_0036178 3300035115 Bacteria 1500
368 Ga0373960_0060495 3300035121 Unclassified 1148
369 Ga0373931_0022601 3300035691 Bacteria 3167
370 Ga0395899_0002294 3300037312 Bacteria 15602
371 Ga0395899_0020790 3300037312 Bacteria 4976
372 Ga0395899_0029900 3300037312 Bacteria 4099
373 Ga0395899_0084244 3300037312 Bacteria 2311
374 Ga0395899_0110473 3300037312 Bacteria 1977
375 Ga0395899_0151207 3300037312 Bacteria 1645
376 Ga0395899_0236911 3300037312 Bacteria 1257
377 Ga0395899_0287485 3300037312 Bacteria 1116
378 Ga0395899_0304083 3300037312 Bacteria 1078
379 Ga0395900_0010815 3300037418 Bacteria 9336
380 Ga0395900_0015583 3300037418 Bacteria 7748
381 Ga0395900_0043660 3300037418 Bacteria 4621
382 Ga0395900_0043880 3300037418 Bacteria 4608
383 Ga0395900_0056159 3300037418 Bacteria 4053
384 Ga0395900_0069930 3300037418 Bacteria 3608
385 Ga0395900_0115391 3300037418 Bacteria 2755
386 Ga0395900_0148770 3300037418 Bacteria 2393
387 Ga0395900_0267675 3300037418 Bacteria 1704
388 Ga0395900_0448122 3300037418 Bacteria 1247
389 Ga0395898_0011979 3300037466 Bacteria 8977
390 Ga0395898_0027512 3300037466 Bacteria 5706
391 Ga0395898_0053123 3300037466 Bacteria 3957
392 Ga0395898_0110905 3300037466 Bacteria 2629
393 Ga0395898_0153758 3300037466 Bacteria 2201
394 Ga0395898_0181464 3300037466 Bacteria 2012
395 Ga0395905_0007442 3300037471 Bacteria 10890
396 Ga0395905_0008747 3300037471 Bacteria 9958
397 Ga0395905_0036716 3300037471 Bacteria 4603
398 Ga0395905_0089248 3300037471 Bacteria 2889
399 Ga0395905_0105988 3300037471 Bacteria 2639
400 Ga0395905_0147128 3300037471 Bacteria 2216
401 Ga0395905_0165724 3300037471 Bacteria 2077
402 Ga0395905_0184506 3300037471 Unclassified 1958
403 Ga0395905_0198254 3300037471 Bacteria 1882
404 Ga0395905_0313794 3300037471 Bacteria 1456
405 Ga0395905_0382363 3300037471 Bacteria 1301
406 Ga0395905_0768272 3300037471 Bacteria 866
407 Ga0395901_0000131 3300038443 Bacteria 96504
408 Ga0395901_0006236 3300038443 Bacteria 12089
409 Ga0395901_0019963 3300038443 Bacteria 6856
410 Ga0395901_0046920 3300038443 Bacteria 4488
411 Ga0395901_0096643 3300038443 Bacteria 3095
412 Ga0395901_0102313 3300038443 Bacteria 3006
413 Ga0395901_0174945 3300038443 Bacteria 2251
414 Ga0395901_0191200 3300038443 Bacteria 2146
415 Ga0395901_0215054 3300038443 Bacteria 2010
416 Ga0395901_0242512 3300038443 Bacteria 1879
417 Ga0395901_0262426 3300038443 Bacteria 1797
418 Ga0395901_0273679 3300038443 Bacteria 1756
419 Ga0395901_0314319 3300038443 Bacteria 1622
420 Ga0395901_0357015 3300038443 Bacteria 1508
421 Ga0395901_0609936 3300038443 Bacteria 1099
422 Ga0395901_0869692 3300038443 Bacteria 885
423 Ga0439455_0029966 3300042012 Bacteria 1348
424 Ga0439462_0019877 3300042015 Bacteria 1750
425 Ga0450917_001950 3300042120 Bacteria 1469
426 Ga0439464_0096552 3300042439 Unclassified 895
427 Ga0466972_0104153 3300044658 Bacteria 1342
428 Ga0466966_0080825 3300044684 Bacteria 2024
429 Ga0466963_0000479 3300044694 Bacteria 18643
430 Ga0466963_0012188 3300044694 Bacteria 5257
431 Ga0466964_0078900 3300044706 Bacteria 1409
432 Ga0466971_0119613 3300044719 Bacteria 1219
433 Ga0466970_0375061 3300044765 Bacteria 809
434 Ga0466957_0035660 3300044842 Bacteria 2985
435 Ga0466957_0473831 3300044842 Bacteria 865
436 Ga0466957_0478480 3300044842 Unclassified 861
437 Ga0466960_0248168 3300044901 Unclassified 988
438 Ga0466959_0101506 3300045049 Bacteria 2059
439 Ga0466959_0552776 3300045049 Unclassified 776
440 Ga0466967_0004986 3300045976 Bacteria 9090
441 Ga0466967_0007646 3300045976 Bacteria 7823
442 Ga0466967_0012648 3300045976 Bacteria 6472
443 Ga0466967_0069781 3300045976 Bacteria 3142
444 Ga0466967_0203355 3300045976 Bacteria 1876
445 Ga0466967_0715149 3300045976 Unclassified 992
446 Ga0495642_0017701 3300046528 Bacteria 2784
447 Ga0495668_0049915 3300046616 Bacteria 2320
448 Ga0495668_0222305 3300046616 Bacteria 1034
449 Ga0495625_0184806 3300046660 Bacteria 1384
450 Ga0495669_0010224 3300046684 Bacteria 3964
451 Ga0495669_0012549 3300046684 Bacteria 3608
452 Ga0495670_0427029 3300046691 Bacteria 717
453 Ga0496101_0025216 3300048904 Bacteria 4123
454 Ga0496104_0375052 3300048907 Bacteria 1335
455 Ga0496106_0026055 3300048909 Bacteria 4351
456 Ga0496106_0270401 3300048909 Bacteria 1361
457 Ga0496107_0015266 3300048910 Bacteria 5382
458 Ga0496107_0312075 3300048910 Bacteria 1170
459 Ga0496107_0363134 3300048910 Unclassified 1077
460 Ga0496108_0002500 3300048911 Bacteria 14718
461 Ga0496109_0003929 3300048912 Bacteria 12421
462 Ga0496109_0026008 3300048912 Bacteria 5217
463 Ga0496109_0380078 3300048912 Bacteria 1334
464 Ga0496109_0737063 3300048912 Unclassified 923
465 Ga0496110_0005802 3300048913 Bacteria 9705
466 Ga0496110_0385518 3300048913 Bacteria 1277
467 Ga0496111_0001561 3300048914 Bacteria 13211
468 Ga0496111_0014568 3300048914 Bacteria 5376
469 Ga0496111_0155338 3300048914 Bacteria 1698
470 Ga0496111_0195391 3300048914 Bacteria 1504
471 Ga0496111_0263815 3300048914 Bacteria 1278
472 Ga0496112_0003485 3300048915 Bacteria 13028
473 Ga0496112_0043779 3300048915 Bacteria 4383
474 Ga0496113_0001886 3300048916 Bacteria 11957
475 Ga0496113_0011166 3300048916 Bacteria 5977
476 Ga0501071_0517589 3300049587 Unclassified 915
477 Ga0501073_0260336 3300049589 Bacteria 1197
478 Ga0501074_0053411 3300049590 Bacteria 2915
479 Ga0501080_0041297 3300049742 Bacteria 4299
480 Ga0500658_0000032 3300053134 Bacteria 90863
481 Ga0500627_0068152 3300053158 Bacteria 1573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100015427 Ga0070714_1000154272 198
2 3300025929 Ga0207664_10179559 Ga0207664_101795592 198
3 3300037312 Ga0395899_0287485 Ga0395899_0287485_421_1050 208
4 3300037418 Ga0395900_0148770 Ga0395900_0148770_985_1614 208
5 3300037466 Ga0395898_0011979 Ga0395898_0011979_1809_2438 208
6 3300037471 Ga0395905_0382363 Ga0395905_0382363_252_881 208
7 3300005331 Ga0070670_100042084 Ga0070670_1000420846 214
8 3300005544 Ga0070686_100228224 Ga0070686_1002282242 214
9 3300013308 Ga0157375_10385127 Ga0157375_103851272 214
10 3300025926 Ga0207659_10167270 Ga0207659_101672702 214
11 3300025933 Ga0207706_10183800 Ga0207706_101838002 214
12 3300037312 Ga0395899_0236911 Ga0395899_0236911_98_745 214
13 3300037418 Ga0395900_0448122 Ga0395900_0448122_23_670 214
14 3300037466 Ga0395898_0053123 Ga0395898_0053123_2106_2753 214
15 3300037471 Ga0395905_0105988 Ga0395905_0105988_1105_1752 214
16 3300038443 Ga0395901_0215054 Ga0395901_0215054_924_1571 214
17 3300038443 Ga0395901_0242512 Ga0395901_0242512_309_956 214
18 3300038443 Ga0395901_0262426 Ga0395901_0262426_10_657 214
19 3300044765 Ga0466970_0375061 Ga0466970_0375061_101_748 214
20 3300045049 Ga0466959_0552776 Ga0466959_0552776_25_672 214
21 3300046616 Ga0495668_0049915 Ga0495668_0049915_1152_1796 214
22 3300046691 Ga0495670_0427029 Ga0495670_0427029_30_674 214
23 3300048910 Ga0496107_0312075 Ga0496107_0312075_12_659 214
24 3300048912 Ga0496109_0737063 Ga0496109_0737063_87_734 214
25 3300048913 Ga0496110_0385518 Ga0496110_0385518_124_771 214
26 3300053158 Ga0500627_0068152 Ga0500627_0068152_32_676 214
27 3300038443 Ga0395901_0006236 Ga0395901_0006236_17_667 215
28 3300005548 Ga0070665_100048833 Ga0070665_1000488337 220
29 3300046684 Ga0495669_0010224 Ga0495669_0010224_3057_3725 221
30 3300005457 Ga0070662_100035154 Ga0070662_1000351543 223
31 3300025907 Ga0207645_10336931 Ga0207645_103369312 223
32 3300025933 Ga0207706_10018451 Ga0207706_100184512 223
33 3300037471 Ga0395905_0007442 Ga0395905_0007442_4951_5691 227
34 3300038443 Ga0395901_0046920 Ga0395901_0046920_1425_2165 227
35 3300032005 Ga0307411_10164923 Ga0307411_101649232 230
36 3300049587 Ga0501071_0517589 Ga0501071_0517589_32_736 233
37 3300049589 Ga0501073_0260336 Ga0501073_0260336_21_725 233
38 3300013307 Ga0157372_10123526 Ga0157372_101235265 235
39 3300025945 Ga0207679_10465579 Ga0207679_104655791 235
40 3300026088 Ga0207641_10839511 Ga0207641_108395112 235
41 3300005327 Ga0070658_10144665 Ga0070658_101446651 236
42 3300005335 Ga0070666_10172552 Ga0070666_101725521 236
43 3300005339 Ga0070660_100773877 Ga0070660_1007738771 236
44 3300005344 Ga0070661_100034090 Ga0070661_1000340901 236
45 3300005355 Ga0070671_100386749 Ga0070671_1003867492 236
46 3300005355 Ga0070671_100539720 Ga0070671_1005397202 236
47 3300005367 Ga0070667_100006202 Ga0070667_10000620213 236
48 3300005367 Ga0070667_100330597 Ga0070667_1003305972 236
49 3300005564 Ga0070664_100001195 Ga0070664_10000119520 236
50 3300009177 Ga0105248_10037980 Ga0105248_100379805 236
51 3300013102 Ga0157371_10092704 Ga0157371_100927041 236
52 3300013296 Ga0157374_10132825 Ga0157374_101328252 236
53 3300025903 Ga0207680_10428339 Ga0207680_104283392 236
54 3300025909 Ga0207705_10074441 Ga0207705_100744412 236
55 3300025919 Ga0207657_10020716 Ga0207657_1002071611 236
56 3300025920 Ga0207649_10115262 Ga0207649_101152622 236
57 3300025920 Ga0207649_10118891 Ga0207649_101188914 236
58 3300025933 Ga0207706_10002457 Ga0207706_1000245711 236
59 3300025941 Ga0207711_10083575 Ga0207711_100835753 236
60 3300025945 Ga0207679_10070111 Ga0207679_100701112 236
61 3300025972 Ga0207668_10425290 Ga0207668_104252901 236
62 3300025981 Ga0207640_10369814 Ga0207640_103698142 236
63 3300025986 Ga0207658_10016611 Ga0207658_100166114 236
64 3300026067 Ga0207678_10064399 Ga0207678_100643992 236
65 3300026089 Ga0207648_10061752 Ga0207648_100617524 236
66 3300026116 Ga0207674_10032337 Ga0207674_100323375 236
67 3300028380 Ga0268265_10276243 Ga0268265_102762432 236
68 3300048909 Ga0496106_0270401 Ga0496106_0270401_531_1244 236
69 3300048910 Ga0496107_0363134 Ga0496107_0363134_243_956 236
70 3300048914 Ga0496111_0155338 Ga0496111_0155338_114_827 236
71 3300048915 Ga0496112_0043779 Ga0496112_0043779_3277_3993 236
72 3300048916 Ga0496113_0001886 Ga0496113_0001886_2690_3406 236
73 3300001979 JGI24740J21852_10016226 JGI24740J21852_100162265 237
74 3300001989 JGI24739J22299_10000653 JGI24739J22299_100006537 237
75 3300001990 JGI24737J22298_10000027 JGI24737J22298_1000002741 237
76 3300001990 JGI24737J22298_10015450 JGI24737J22298_100154504 237
77 3300002067 JGI24735J21928_10073124 JGI24735J21928_100731242 237
78 3300002075 JGI24738J21930_10004592 JGI24738J21930_100045921 237
79 3300002075 JGI24738J21930_10005479 JGI24738J21930_100054792 237
80 3300005327 Ga0070658_10000177 Ga0070658_1000017738 237
81 3300005327 Ga0070658_10031868 Ga0070658_100318682 237
82 3300005327 Ga0070658_10064999 Ga0070658_100649994 237
83 3300005328 Ga0070676_10001875 Ga0070676_100018757 237
84 3300005329 Ga0070683_100004360 Ga0070683_10000436012 237
85 3300005330 Ga0070690_100039143 Ga0070690_1000391432 237
86 3300005331 Ga0070670_100003382 Ga0070670_10000338211 237
87 3300005331 Ga0070670_100060498 Ga0070670_1000604985 237
88 3300005331 Ga0070670_100093882 Ga0070670_1000938821 237
89 3300005331 Ga0070670_100338758 Ga0070670_1003387582 237
90 3300005333 Ga0070677_10019132 Ga0070677_100191321 237
91 3300005334 Ga0068869_100000085 Ga0068869_1000000857 237
92 3300005334 Ga0068869_100105697 Ga0068869_1001056972 237
93 3300005334 Ga0068869_100914475 Ga0068869_1009144751 237
94 3300005335 Ga0070666_10002806 Ga0070666_100028062 237
95 3300005335 Ga0070666_10227641 Ga0070666_102276412 237
96 3300005337 Ga0070682_100016463 Ga0070682_1000164633 237
97 3300005337 Ga0070682_100258652 Ga0070682_1002586522 237
98 3300005338 Ga0068868_100002300 Ga0068868_1000023002 237
99 3300005338 Ga0068868_100264533 Ga0068868_1002645333 237
100 3300005339 Ga0070660_100000065 Ga0070660_10000006537 237
101 3300005339 Ga0070660_100002055 Ga0070660_10000205512 237
102 3300005339 Ga0070660_100017432 Ga0070660_1000174327 237
103 3300005339 Ga0070660_100099476 Ga0070660_1000994762 237
104 3300005340 Ga0070689_100473380 Ga0070689_1004733801 237
105 3300005340 Ga0070689_100671150 Ga0070689_1006711502 237
106 3300005344 Ga0070661_100000084 Ga0070661_10000008419 237
107 3300005344 Ga0070661_100124616 Ga0070661_1001246163 237
108 3300005347 Ga0070668_100004743 Ga0070668_1000047432 237
109 3300005347 Ga0070668_100026394 Ga0070668_1000263946 237
110 3300005347 Ga0070668_100040102 Ga0070668_1000401022 237
111 3300005353 Ga0070669_100005573 Ga0070669_1000055732 237
112 3300005353 Ga0070669_100013210 Ga0070669_1000132103 237
113 3300005353 Ga0070669_100038445 Ga0070669_1000384452 237
114 3300005353 Ga0070669_100050589 Ga0070669_1000505891 237
115 3300005353 Ga0070669_100075266 Ga0070669_1000752664 237
116 3300005354 Ga0070675_100002909 Ga0070675_10000290914 237
117 3300005354 Ga0070675_100182332 Ga0070675_1001823323 237
118 3300005355 Ga0070671_100008513 Ga0070671_1000085132 237
119 3300005355 Ga0070671_100027725 Ga0070671_1000277258 237
120 3300005356 Ga0070674_100028634 Ga0070674_1000286342 237
121 3300005364 Ga0070673_100000058 Ga0070673_10000005814 237
122 3300005364 Ga0070673_100019209 Ga0070673_1000192097 237
123 3300005364 Ga0070673_100020640 Ga0070673_1000206402 237
124 3300005364 Ga0070673_100064938 Ga0070673_1000649383 237
125 3300005366 Ga0070659_100001520 Ga0070659_10000152019 237
126 3300005366 Ga0070659_100001878 Ga0070659_1000018782 237
127 3300005366 Ga0070659_100108109 Ga0070659_1001081094 237
128 3300005367 Ga0070667_100021891 Ga0070667_1000218915 237
129 3300005367 Ga0070667_100042270 Ga0070667_1000422705 237
130 3300005367 Ga0070667_100047561 Ga0070667_1000475614 237
131 3300005367 Ga0070667_100120434 Ga0070667_1001204343 237
132 3300005367 Ga0070667_100272294 Ga0070667_1002722941 237
133 3300005436 Ga0070713_100035859 Ga0070713_1000358592 237
134 3300005455 Ga0070663_100001477 Ga0070663_1000014775 237
135 3300005455 Ga0070663_100020745 Ga0070663_1000207452 237
136 3300005456 Ga0070678_100041993 Ga0070678_1000419932 237
137 3300005457 Ga0070662_100000017 Ga0070662_10000001756 237
138 3300005457 Ga0070662_100034247 Ga0070662_1000342475 237
139 3300005457 Ga0070662_100067670 Ga0070662_1000676703 237
140 3300005458 Ga0070681_10602622 Ga0070681_106026222 237
141 3300005459 Ga0068867_100002374 Ga0068867_10000237413 237
142 3300005459 Ga0068867_100002594 Ga0068867_1000025945 237
143 3300005459 Ga0068867_100058883 Ga0068867_1000588832 237
144 3300005466 Ga0070685_10402415 Ga0070685_104024151 237
145 3300005530 Ga0070679_100299129 Ga0070679_1002991292 237
146 3300005535 Ga0070684_100008650 Ga0070684_1000086504 237
147 3300005539 Ga0068853_100126119 Ga0068853_1001261192 237
148 3300005539 Ga0068853_100135385 Ga0068853_1001353853 237
149 3300005543 Ga0070672_100072969 Ga0070672_1000729692 237
150 3300005543 Ga0070672_100189555 Ga0070672_1001895553 237
151 3300005543 Ga0070672_100390817 Ga0070672_1003908171 237
152 3300005546 Ga0070696_100052620 Ga0070696_1000526202 237
153 3300005546 Ga0070696_100659392 Ga0070696_1006593922 237
154 3300005547 Ga0070693_100003637 Ga0070693_1000036373 237
155 3300005547 Ga0070693_100262719 Ga0070693_1002627191 237
156 3300005548 Ga0070665_100009518 Ga0070665_10000951810 237
157 3300005548 Ga0070665_100010899 Ga0070665_1000108993 237
158 3300005548 Ga0070665_100021178 Ga0070665_10002117810 237
159 3300005548 Ga0070665_100340925 Ga0070665_1003409253 237
160 3300005563 Ga0068855_100000194 Ga0068855_10000019466 237
161 3300005563 Ga0068855_100013882 Ga0068855_1000138827 237
162 3300005564 Ga0070664_100000098 Ga0070664_10000009837 237
163 3300005564 Ga0070664_100004600 Ga0070664_10000460014 237
164 3300005564 Ga0070664_100029056 Ga0070664_1000290562 237
165 3300005564 Ga0070664_100077120 Ga0070664_1000771202 237
166 3300005577 Ga0068857_100000665 Ga0068857_10000066513 237
167 3300005577 Ga0068857_100019565 Ga0068857_1000195659 237
168 3300005578 Ga0068854_100000173 Ga0068854_10000017341 237
169 3300005578 Ga0068854_100020658 Ga0068854_1000206585 237
170 3300005578 Ga0068854_100023454 Ga0068854_1000234545 237
171 3300005578 Ga0068854_100288988 Ga0068854_1002889882 237
172 3300005614 Ga0068856_100000098 Ga0068856_10000009854 237
173 3300005614 Ga0068856_100032252 Ga0068856_1000322525 237
174 3300005614 Ga0068856_100046194 Ga0068856_1000461942 237
175 3300005615 Ga0070702_100158595 Ga0070702_1001585952 237
176 3300005616 Ga0068852_100000440 Ga0068852_10000044018 237
177 3300005616 Ga0068852_100003637 Ga0068852_10000363714 237
178 3300005616 Ga0068852_100028817 Ga0068852_1000288177 237
179 3300005616 Ga0068852_100433493 Ga0068852_1004334931 237
180 3300005617 Ga0068859_100001231 Ga0068859_1000012317 237
181 3300005617 Ga0068859_100005244 Ga0068859_10000524415 237
182 3300005617 Ga0068859_100057868 Ga0068859_1000578686 237
183 3300005618 Ga0068864_100000235 Ga0068864_10000023550 237
184 3300005618 Ga0068864_100000953 Ga0068864_10000095322 237
185 3300005618 Ga0068864_100006611 Ga0068864_1000066115 237
186 3300005618 Ga0068864_100464188 Ga0068864_1004641882 237
187 3300005719 Ga0068861_100097816 Ga0068861_1000978162 237
188 3300005834 Ga0068851_10017630 Ga0068851_100176302 237
189 3300005834 Ga0068851_10101549 Ga0068851_101015492 237
190 3300005840 Ga0068870_10072294 Ga0068870_100722943 237
191 3300005840 Ga0068870_10115878 Ga0068870_101158782 237
192 3300005841 Ga0068863_100004123 Ga0068863_10000412319 237
193 3300005841 Ga0068863_100094773 Ga0068863_1000947732 237
194 3300005841 Ga0068863_100111816 Ga0068863_1001118162 237
195 3300005842 Ga0068858_100000695 Ga0068858_10000069523 237
196 3300005842 Ga0068858_100037523 Ga0068858_1000375235 237
197 3300005843 Ga0068860_100006046 Ga0068860_1000060465 237
198 3300005843 Ga0068860_100027907 Ga0068860_1000279075 237
199 3300005843 Ga0068860_100046582 Ga0068860_1000465825 237
200 3300005843 Ga0068860_100656940 Ga0068860_1006569401 237
201 3300005844 Ga0068862_100009816 Ga0068862_1000098165 237
202 3300005844 Ga0068862_100164749 Ga0068862_1001647493 237
203 3300005844 Ga0068862_100334861 Ga0068862_1003348612 237
204 3300005985 Ga0081539_10020238 Ga0081539_100202382 237
205 3300006028 Ga0070717_10017659 Ga0070717_100176597 237
206 3300006173 Ga0070716_100070302 Ga0070716_1000703022 237
207 3300006175 Ga0070712_100017015 Ga0070712_1000170152 237
208 3300006237 Ga0097621_100041530 Ga0097621_1000415302 237
209 3300006237 Ga0097621_100228977 Ga0097621_1002289772 237
210 3300006358 Ga0068871_100070166 Ga0068871_1000701665 237
211 3300006844 Ga0075428_100301138 Ga0075428_1003011383 237
212 3300006881 Ga0068865_100029596 Ga0068865_1000295965 237
213 3300006931 Ga0097620_100001231 Ga0097620_10000123124 237
214 3300006931 Ga0097620_100005244 Ga0097620_10000524415 237
215 3300006931 Ga0097620_100057866 Ga0097620_1000578666 237
216 3300009092 Ga0105250_10008013 Ga0105250_100080134 237
217 3300009093 Ga0105240_10610096 Ga0105240_106100962 237
218 3300009098 Ga0105245_10000170 Ga0105245_1000017047 237
219 3300009177 Ga0105248_10000184 Ga0105248_1000018436 237
220 3300009177 Ga0105248_10000444 Ga0105248_1000044417 237
221 3300009177 Ga0105248_10002231 Ga0105248_1000223113 237
222 3300009177 Ga0105248_10004136 Ga0105248_1000413611 237
223 3300009177 Ga0105248_10060365 Ga0105248_100603655 237
224 3300009177 Ga0105248_10164862 Ga0105248_101648624 237
225 3300009551 Ga0105238_10118335 Ga0105238_101183353 237
226 3300009553 Ga0105249_10088712 Ga0105249_100887122 237
227 3300010375 Ga0105239_10063330 Ga0105239_100633303 237
228 3300011119 Ga0105246_10129503 Ga0105246_101295032 237
229 3300013100 Ga0157373_10005169 Ga0157373_100051692 237
230 3300013102 Ga0157371_10000443 Ga0157371_1000044316 237
231 3300013102 Ga0157371_10002003 Ga0157371_100020031 237
232 3300013102 Ga0157371_10010863 Ga0157371_100108635 237
233 3300013104 Ga0157370_10038576 Ga0157370_100385769 237
234 3300013105 Ga0157369_10633184 Ga0157369_106331842 237
235 3300013296 Ga0157374_10005411 Ga0157374_100054115 237
236 3300013306 Ga0163162_10008350 Ga0163162_100083503 237
237 3300013307 Ga0157372_10059386 Ga0157372_100593862 237
238 3300013307 Ga0157372_11273024 Ga0157372_112730242 237
239 3300013308 Ga0157375_10690793 Ga0157375_106907932 237
240 3300014325 Ga0163163_10000131 Ga0163163_1000013128 237
241 3300014325 Ga0163163_10000169 Ga0163163_1000016954 237
242 3300014968 Ga0157379_10002480 Ga0157379_1000248012 237
243 3300014969 Ga0157376_10215819 Ga0157376_102158191 237
244 3300025290 Ga0207673_1019353 Ga0207673_10193531 237
245 3300025315 Ga0207697_10000072 Ga0207697_100000727 237
246 3300025321 Ga0207656_10072665 Ga0207656_100726652 237
247 3300025711 Ga0207696_1022336 Ga0207696_10223362 237
248 3300025899 Ga0207642_10177171 Ga0207642_101771712 237
249 3300025901 Ga0207688_10000106 Ga0207688_1000010634 237
250 3300025901 Ga0207688_10028116 Ga0207688_100281165 237
251 3300025903 Ga0207680_10138247 Ga0207680_101382472 237
252 3300025904 Ga0207647_10000246 Ga0207647_1000024645 237
253 3300025904 Ga0207647_10002702 Ga0207647_100027027 237
254 3300025906 Ga0207699_10201169 Ga0207699_102011692 237
255 3300025907 Ga0207645_10009048 Ga0207645_100090485 237
256 3300025907 Ga0207645_10012283 Ga0207645_100122832 237
257 3300025907 Ga0207645_10025100 Ga0207645_100251002 237
258 3300025908 Ga0207643_10045668 Ga0207643_100456684 237
259 3300025909 Ga0207705_10000137 Ga0207705_1000013754 237
260 3300025909 Ga0207705_10045569 Ga0207705_100455695 237
261 3300025913 Ga0207695_10549175 Ga0207695_105491752 237
262 3300025919 Ga0207657_10000508 Ga0207657_100005088 237
263 3300025919 Ga0207657_10008573 Ga0207657_100085738 237
264 3300025919 Ga0207657_10014410 Ga0207657_1001441011 237
265 3300025919 Ga0207657_10051139 Ga0207657_100511392 237
266 3300025920 Ga0207649_10000965 Ga0207649_1000096516 237
267 3300025920 Ga0207649_10062681 Ga0207649_100626812 237
268 3300025921 Ga0207652_10274734 Ga0207652_102747342 237
269 3300025923 Ga0207681_10028285 Ga0207681_100282856 237
270 3300025923 Ga0207681_10032374 Ga0207681_100323742 237
271 3300025923 Ga0207681_10063181 Ga0207681_100631812 237
272 3300025923 Ga0207681_10143250 Ga0207681_101432503 237
273 3300025924 Ga0207694_10122826 Ga0207694_101228263 237
274 3300025925 Ga0207650_10041137 Ga0207650_100411375 237
275 3300025925 Ga0207650_10043793 Ga0207650_100437932 237
276 3300025925 Ga0207650_10077696 Ga0207650_100776962 237
277 3300025925 Ga0207650_10255587 Ga0207650_102555872 237
278 3300025926 Ga0207659_10096272 Ga0207659_100962721 237
279 3300025926 Ga0207659_10110722 Ga0207659_101107222 237
280 3300025927 Ga0207687_10001079 Ga0207687_1000107924 237
281 3300025929 Ga0207664_10130190 Ga0207664_101301902 237
282 3300025929 Ga0207664_10453904 Ga0207664_104539042 237
283 3300025931 Ga0207644_10006549 Ga0207644_100065492 237
284 3300025931 Ga0207644_10013001 Ga0207644_100130015 237
285 3300025931 Ga0207644_10242472 Ga0207644_102424722 237
286 3300025932 Ga0207690_10000108 Ga0207690_1000010825 237
287 3300025932 Ga0207690_10072257 Ga0207690_100722572 237
288 3300025933 Ga0207706_10000224 Ga0207706_1000022461 237
289 3300025933 Ga0207706_10000514 Ga0207706_1000051437 237
290 3300025933 Ga0207706_10009377 Ga0207706_1000937713 237
291 3300025933 Ga0207706_10049295 Ga0207706_100492952 237
292 3300025935 Ga0207709_10011672 Ga0207709_100116725 237
293 3300025936 Ga0207670_10607955 Ga0207670_106079552 237
294 3300025937 Ga0207669_10005104 Ga0207669_100051042 237
295 3300025938 Ga0207704_10008603 Ga0207704_100086032 237
296 3300025938 Ga0207704_10207970 Ga0207704_102079702 237
297 3300025940 Ga0207691_10000750 Ga0207691_1000075032 237
298 3300025940 Ga0207691_10232352 Ga0207691_102323523 237
299 3300025941 Ga0207711_10000105 Ga0207711_1000010577 237
300 3300025941 Ga0207711_10001099 Ga0207711_100010998 237
301 3300025941 Ga0207711_10003265 Ga0207711_100032657 237
302 3300025941 Ga0207711_10168691 Ga0207711_101686913 237
303 3300025942 Ga0207689_10000051 Ga0207689_1000005141 237
304 3300025942 Ga0207689_10004140 Ga0207689_100041407 237
305 3300025942 Ga0207689_10042762 Ga0207689_100427624 237
306 3300025942 Ga0207689_10101764 Ga0207689_101017643 237
307 3300025944 Ga0207661_10009086 Ga0207661_100090868 237
308 3300025945 Ga0207679_10000114 Ga0207679_1000011413 237
309 3300025945 Ga0207679_10035461 Ga0207679_100354612 237
310 3300025945 Ga0207679_10071708 Ga0207679_100717081 237
311 3300025945 Ga0207679_10471543 Ga0207679_104715432 237
312 3300025949 Ga0207667_10006612 Ga0207667_1000661211 237
313 3300025949 Ga0207667_10016322 Ga0207667_1001632213 237
314 3300025949 Ga0207667_10479957 Ga0207667_104799572 237
315 3300025949 Ga0207667_10559324 Ga0207667_105593242 237
316 3300025960 Ga0207651_10000232 Ga0207651_1000023223 237
317 3300025960 Ga0207651_10016970 Ga0207651_100169704 237
318 3300025960 Ga0207651_10113802 Ga0207651_101138022 237
319 3300025960 Ga0207651_10128271 Ga0207651_101282712 237
320 3300025961 Ga0207712_10007168 Ga0207712_100071686 237
321 3300025961 Ga0207712_10178784 Ga0207712_101787842 237
322 3300025961 Ga0207712_10736407 Ga0207712_107364071 237
323 3300025972 Ga0207668_10000086 Ga0207668_1000008613 237
324 3300025972 Ga0207668_10078622 Ga0207668_100786222 237
325 3300025981 Ga0207640_10000999 Ga0207640_1000099917 237
326 3300025981 Ga0207640_10006341 Ga0207640_100063419 237
327 3300025981 Ga0207640_10017489 Ga0207640_100174892 237
328 3300025981 Ga0207640_10354143 Ga0207640_103541431 237
329 3300025986 Ga0207658_10002159 Ga0207658_100021594 237
330 3300025986 Ga0207658_10012786 Ga0207658_100127862 237
331 3300025986 Ga0207658_10021527 Ga0207658_100215277 237
332 3300025986 Ga0207658_10132530 Ga0207658_101325302 237
333 3300025986 Ga0207658_10532643 Ga0207658_105326432 237
334 3300026023 Ga0207677_10138495 Ga0207677_101384953 237
335 3300026035 Ga0207703_10004813 Ga0207703_100048137 237
336 3300026035 Ga0207703_10013810 Ga0207703_1001381011 237
337 3300026035 Ga0207703_10110050 Ga0207703_101100504 237
338 3300026041 Ga0207639_10000139 Ga0207639_1000013914 237
339 3300026041 Ga0207639_10175395 Ga0207639_101753953 237
340 3300026067 Ga0207678_10003875 Ga0207678_100038752 237
341 3300026067 Ga0207678_10005439 Ga0207678_100054397 237
342 3300026067 Ga0207678_10006212 Ga0207678_100062126 237
343 3300026067 Ga0207678_10132028 Ga0207678_101320281 237
344 3300026078 Ga0207702_10001266 Ga0207702_1000126618 237
345 3300026078 Ga0207702_10186488 Ga0207702_101864882 237
346 3300026088 Ga0207641_10000172 Ga0207641_1000017218 237
347 3300026088 Ga0207641_10004187 Ga0207641_100041877 237
348 3300026088 Ga0207641_10010991 Ga0207641_1001099112 237
349 3300026089 Ga0207648_10000221 Ga0207648_1000022141 237
350 3300026089 Ga0207648_10003003 Ga0207648_1000300315 237
351 3300026089 Ga0207648_10018994 Ga0207648_1001899411 237
352 3300026095 Ga0207676_10000300 Ga0207676_1000030044 237
353 3300026095 Ga0207676_10008095 Ga0207676_100080958 237
354 3300026095 Ga0207676_10017858 Ga0207676_100178582 237
355 3300026095 Ga0207676_10029769 Ga0207676_100297692 237
356 3300026116 Ga0207674_10002274 Ga0207674_100022744 237
357 3300026116 Ga0207674_10002318 Ga0207674_1000231814 237
358 3300026116 Ga0207674_10004402 Ga0207674_100044028 237
359 3300026118 Ga0207675_100031485 Ga0207675_1000314854 237
360 3300026118 Ga0207675_100331262 Ga0207675_1003312622 237
361 3300026121 Ga0207683_10146762 Ga0207683_101467622 237
362 3300026121 Ga0207683_10168967 Ga0207683_101689672 237
363 3300026121 Ga0207683_10203349 Ga0207683_102033492 237
364 3300026142 Ga0207698_10000598 Ga0207698_100005988 237
365 3300026142 Ga0207698_10011726 Ga0207698_100117262 237
366 3300026142 Ga0207698_10012415 Ga0207698_100124159 237
367 3300026142 Ga0207698_10214380 Ga0207698_102143801 237
368 3300026142 Ga0207698_10290470 Ga0207698_102904702 237
369 3300026142 Ga0207698_10661915 Ga0207698_106619152 237
370 3300028379 Ga0268266_10000200 Ga0268266_1000020042 237
371 3300028379 Ga0268266_10020456 Ga0268266_100204563 237
372 3300028379 Ga0268266_10025686 Ga0268266_100256862 237
373 3300028379 Ga0268266_10296491 Ga0268266_102964913 237
374 3300028380 Ga0268265_10006617 Ga0268265_100066172 237
375 3300028380 Ga0268265_10021511 Ga0268265_100215112 237
376 3300028380 Ga0268265_10058746 Ga0268265_100587462 237
377 3300028380 Ga0268265_10203573 Ga0268265_102035733 237
378 3300028381 Ga0268264_10001244 Ga0268264_1000124424 237
379 3300028381 Ga0268264_10003848 Ga0268264_1000384811 237
380 3300028381 Ga0268264_10004275 Ga0268264_100042755 237
381 3300028381 Ga0268264_10016840 Ga0268264_100168406 237
382 3300031456 Ga0307513_10089377 Ga0307513_100893771 237
383 3300031456 Ga0307513_10207470 Ga0307513_102074703 237
384 3300031824 Ga0307413_10059607 Ga0307413_100596071 237
385 3300031824 Ga0307413_10091252 Ga0307413_100912523 237
386 3300031824 Ga0307413_10112707 Ga0307413_101127072 237
387 3300031852 Ga0307410_10023575 Ga0307410_100235755 237
388 3300031903 Ga0307407_10127694 Ga0307407_101276943 237
389 3300031911 Ga0307412_10216626 Ga0307412_102166262 237
390 3300031995 Ga0307409_100023447 Ga0307409_1000234474 237
391 3300031995 Ga0307409_100999631 Ga0307409_1009996312 237
392 3300032002 Ga0307416_101132481 Ga0307416_1011324812 237
393 3300032004 Ga0307414_10703633 Ga0307414_107036332 237
394 3300032005 Ga0307411_10035684 Ga0307411_100356845 237
395 3300032005 Ga0307411_10046600 Ga0307411_100466005 237
396 3300032005 Ga0307411_10192855 Ga0307411_101928552 237
397 3300035115 Ga0373941_0036178 Ga0373941_0036178_659_1375 237
398 3300035121 Ga0373960_0060495 Ga0373960_0060495_305_1021 237
399 3300035691 Ga0373931_0022601 Ga0373931_0022601_1035_1751 237
400 3300037312 Ga0395899_0002294 Ga0395899_0002294_3423_4139 237
401 3300037312 Ga0395899_0020790 Ga0395899_0020790_2349_3065 237
402 3300037312 Ga0395899_0029900 Ga0395899_0029900_1215_1931 237
403 3300037312 Ga0395899_0084244 Ga0395899_0084244_291_1007 237
404 3300037312 Ga0395899_0110473 Ga0395899_0110473_1005_1718 237
405 3300037312 Ga0395899_0151207 Ga0395899_0151207_671_1384 237
406 3300037312 Ga0395899_0304083 Ga0395899_0304083_183_899 237
407 3300037418 Ga0395900_0010815 Ga0395900_0010815_280_993 237
408 3300037418 Ga0395900_0015583 Ga0395900_0015583_325_1041 237
409 3300037418 Ga0395900_0043660 Ga0395900_0043660_3610_4326 237
410 3300037418 Ga0395900_0043880 Ga0395900_0043880_3840_4553 237
411 3300037418 Ga0395900_0056159 Ga0395900_0056159_2307_3023 237
412 3300037418 Ga0395900_0069930 Ga0395900_0069930_2693_3409 237
413 3300037418 Ga0395900_0115391 Ga0395900_0115391_639_1376 237
414 3300037418 Ga0395900_0267675 Ga0395900_0267675_499_1215 237
415 3300037466 Ga0395898_0027512 Ga0395898_0027512_2314_3030 237
416 3300037466 Ga0395898_0110905 Ga0395898_0110905_1108_1824 237
417 3300037466 Ga0395898_0153758 Ga0395898_0153758_720_1433 237
418 3300037466 Ga0395898_0181464 Ga0395898_0181464_473_1189 237
419 3300037471 Ga0395905_0008747 Ga0395905_0008747_3193_3906 237
420 3300037471 Ga0395905_0036716 Ga0395905_0036716_2206_2919 237
421 3300037471 Ga0395905_0089248 Ga0395905_0089248_1759_2475 237
422 3300037471 Ga0395905_0147128 Ga0395905_0147128_24_740 237
423 3300037471 Ga0395905_0165724 Ga0395905_0165724_565_1281 237
424 3300037471 Ga0395905_0184506 Ga0395905_0184506_871_1587 237
425 3300037471 Ga0395905_0198254 Ga0395905_0198254_1041_1757 237
426 3300037471 Ga0395905_0313794 Ga0395905_0313794_627_1343 237
427 3300037471 Ga0395905_0768272 Ga0395905_0768272_101_817 237
428 3300038443 Ga0395901_0000131 Ga0395901_0000131_4689_5402 237
429 3300038443 Ga0395901_0019963 Ga0395901_0019963_672_1388 237
430 3300038443 Ga0395901_0096643 Ga0395901_0096643_1891_2628 237
431 3300038443 Ga0395901_0102313 Ga0395901_0102313_503_1219 237
432 3300038443 Ga0395901_0174945 Ga0395901_0174945_59_775 237
433 3300038443 Ga0395901_0191200 Ga0395901_0191200_504_1217 237
434 3300038443 Ga0395901_0273679 Ga0395901_0273679_549_1265 237
435 3300038443 Ga0395901_0314319 Ga0395901_0314319_569_1285 237
436 3300038443 Ga0395901_0357015 Ga0395901_0357015_501_1217 237
437 3300038443 Ga0395901_0609936 Ga0395901_0609936_44_760 237
438 3300038443 Ga0395901_0869692 Ga0395901_0869692_131_847 237
439 3300042012 Ga0439455_0029966 Ga0439455_0029966_416_1132 237
440 3300042015 Ga0439462_0019877 Ga0439462_0019877_749_1501 237
441 3300042120 Ga0450917_001950 Ga0450917_001950_104_847 237
442 3300042439 Ga0439464_0096552 Ga0439464_0096552_41_784 237
443 3300044658 Ga0466972_0104153 Ga0466972_0104153_548_1264 237
444 3300044684 Ga0466966_0080825 Ga0466966_0080825_258_974 237
445 3300044694 Ga0466963_0000479 Ga0466963_0000479_16262_16978 237
446 3300044694 Ga0466963_0012188 Ga0466963_0012188_1574_2290 237
447 3300044706 Ga0466964_0078900 Ga0466964_0078900_127_843 237
448 3300044719 Ga0466971_0119613 Ga0466971_0119613_424_1161 237
449 3300044842 Ga0466957_0035660 Ga0466957_0035660_855_1571 237
450 3300044842 Ga0466957_0473831 Ga0466957_0473831_105_821 237
451 3300044842 Ga0466957_0478480 Ga0466957_0478480_69_806 237
452 3300044901 Ga0466960_0248168 Ga0466960_0248168_202_939 237
453 3300045049 Ga0466959_0101506 Ga0466959_0101506_952_1668 237
454 3300045976 Ga0466967_0004986 Ga0466967_0004986_825_1541 237
455 3300045976 Ga0466967_0007646 Ga0466967_0007646_2442_3188 237
456 3300045976 Ga0466967_0012648 Ga0466967_0012648_5009_5725 237
457 3300045976 Ga0466967_0069781 Ga0466967_0069781_1381_2097 237
458 3300045976 Ga0466967_0203355 Ga0466967_0203355_697_1413 237
459 3300045976 Ga0466967_0715149 Ga0466967_0715149_231_947 237
460 3300046528 Ga0495642_0017701 Ga0495642_0017701_1295_2011 237
461 3300046616 Ga0495668_0222305 Ga0495668_0222305_249_968 237
462 3300046660 Ga0495625_0184806 Ga0495625_0184806_43_759 237
463 3300046684 Ga0495669_0012549 Ga0495669_0012549_817_1533 237
464 3300048904 Ga0496101_0025216 Ga0496101_0025216_1290_2006 237
465 3300048907 Ga0496104_0375052 Ga0496104_0375052_150_866 237
466 3300048909 Ga0496106_0026055 Ga0496106_0026055_2063_2779 237
467 3300048910 Ga0496107_0015266 Ga0496107_0015266_2788_3504 237
468 3300048911 Ga0496108_0002500 Ga0496108_0002500_7320_8033 237
469 3300048912 Ga0496109_0003929 Ga0496109_0003929_3181_3897 237
470 3300048912 Ga0496109_0026008 Ga0496109_0026008_224_940 237
471 3300048912 Ga0496109_0380078 Ga0496109_0380078_274_993 237
472 3300048913 Ga0496110_0005802 Ga0496110_0005802_8423_9139 237
473 3300048914 Ga0496111_0001561 Ga0496111_0001561_8558_9274 237
474 3300048914 Ga0496111_0014568 Ga0496111_0014568_1966_2682 237
475 3300048914 Ga0496111_0195391 Ga0496111_0195391_70_786 237
476 3300048914 Ga0496111_0263815 Ga0496111_0263815_491_1207 237
477 3300048915 Ga0496112_0003485 Ga0496112_0003485_8788_9504 237
478 3300048916 Ga0496113_0011166 Ga0496113_0011166_2735_3451 237
479 3300049590 Ga0501074_0053411 Ga0501074_0053411_425_1141 237
480 3300049742 Ga0501080_0041297 Ga0501080_0041297_375_1091 237
481 3300053134 Ga0500658_0000032 Ga0500658_0000032_26790_27506 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01863

YgjP-like

YgjP-like, metallopeptidase domain

28

220

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.847 135 226
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7992 135 234
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7842 135 227
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7593 135 234
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7526 135 226
ID Description Score Start End Superfamily
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.847 135 226 3.30.2010.10
af_Q2FWJ6_6_112_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8028 136 214 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7992 135 234 3.30.2010.10
af_Q9P7G4_129_209_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7771 130 197 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7593 135 234 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A522YFA9-F1-model_v4 M48 family peptidase 0.963 131 232
AF-A0A3A9JT86-F1-model_v4 M48 family peptidase 0.9614 130 235
AF-A0A539EIM5-F1-model_v4 Putative metal-dependent hydrolase 0.9575 131 232 GO:0016787
AF-A0A7X2TI66-F1-model_v4 deleted 0.9565 138 232
AF-A0A2G9YYW1-F1-model_v4 YgjP-like metallopeptidase domain-containing protein 0.9565 123 231

Feature Viewer

pLDDT pTM Quality
93.82 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map