F452427

General Info

Members Datasets Scaffolds Average Seq Length
481 248 964 278

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100169806|Ga0207675_1001698062
Length 315
Sequence MIPTAFDYQRATSIDDALAKLQAASGGKLLAGGHSLVPLMKLRLSEPTVLIDVARIPGLSGIREKDGKIEIGAGTTHSDVAGSALLRQVCPVVAETAAEIGDPQVRNRGTLGGSLAHADPAADYPAAMLALDAEIHMKGPKGWRKVKAADFFQGLFTVDLASDEIIAGVQFTPTKAAAYAKLHQRASHFAIVGVAAAVDVTDGVFRSARVGLTGATSHAVRLTAVEQALTGKPATTDTIAGASAAASVDDLNSDIHAVTRLVATAMCCSSRSGAAFSDGPGLACEKIDSEVVRTFRSARHGTPEGLHYTDFFHKL

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 1.66
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100169806 3300026118 Bacteria 2084
2 JGI25156J39149_1000016 3300002705 Bacteria 178691
3 JGI25154J39366_1001191 3300002738 Bacteria 9900
4 JGI25157J39369_1000035 3300002741 Bacteria 136011
5 rootH1_10011774 3300003316 Bacteria 2009
6 rootH1_10011774 3300003323 Bacteria 4316
7 rootH1_10085543 3300003316 Bacteria 2165
8 rootH1_10085543 3300003323 Bacteria 1447
9 Ga0055539_1000124 3300003752 Bacteria 82223
10 Ga0055533_1000024 3300003756 Bacteria 338067
11 Ga0065715_10282006 3300005293 Unclassified 1078
12 Ga0065707_10000853 3300005295 Bacteria 14351
13 Ga0070658_10178188 3300005327 Bacteria 1788
14 Ga0070683_100000032 3300005329 Bacteria 148421
15 Ga0070683_100025821 3300005329 Bacteria 5283
16 Ga0070683_100032166 3300005329 Bacteria 4775
17 Ga0070683_100053140 3300005329 Bacteria 3754
18 Ga0070683_100180790 3300005329 Bacteria 2002
19 Ga0070683_100207517 3300005329 Bacteria 1861
20 Ga0070690_100168912 3300005330 Bacteria 1504
21 Ga0070670_100009642 3300005331 Bacteria 8240
22 Ga0070666_10041149 3300005335 Bacteria 3087
23 Ga0070680_100006751 3300005336 Bacteria 8744
24 Ga0070689_100009786 3300005340 Bacteria 6814
25 Ga0070689_100037470 3300005340 Bacteria 3707
26 Ga0070691_10001836 3300005341 Bacteria 9255
27 Ga0070691_10101965 3300005341 Bacteria 1426
28 Ga0070687_100153458 3300005343 Bacteria 1354
29 Ga0070661_100138247 3300005344 Bacteria 1834
30 Ga0070661_100208320 3300005344 Bacteria 1496
31 Ga0070661_100238020 3300005344 Bacteria 1401
32 Ga0070661_100436294 3300005344 Bacteria 1040
33 Ga0070669_100031571 3300005353 Bacteria 3826
34 Ga0070669_100054313 3300005353 Bacteria 2934
35 Ga0070669_100086642 3300005353 Bacteria 2341
36 Ga0070669_100120269 3300005353 Bacteria 2003
37 Ga0070669_100240453 3300005353 Unclassified 1438
38 Ga0070675_100000434 3300005354 Bacteria 28406
39 Ga0070675_100040857 3300005354 Bacteria 3788
40 Ga0070675_100081786 3300005354 Bacteria 2694
41 Ga0070675_100249532 3300005354 Bacteria 1553
42 Ga0070671_100034443 3300005355 Bacteria 4191
43 Ga0070671_100059229 3300005355 Bacteria 3187
44 Ga0070674_100001822 3300005356 Bacteria 11565
45 Ga0070674_100109337 3300005356 Bacteria 2027
46 Ga0070674_100397882 3300005356 Bacteria 1125
47 Ga0070674_100432487 3300005356 Bacteria 1082
48 Ga0070673_100031714 3300005364 Bacteria 3969
49 Ga0070688_100012115 3300005365 Bacteria 4820
50 Ga0070688_100117419 3300005365 Bacteria 1777
51 Ga0070667_100066273 3300005367 Bacteria 3068
52 Ga0070709_10429317 3300005434 Bacteria 992
53 Ga0070714_100294124 3300005435 Bacteria 1512
54 Ga0070713_100015254 3300005436 Bacteria 5734
55 Ga0070705_100010575 3300005440 Bacteria 4624
56 Ga0070705_100345387 3300005440 Bacteria 1083
57 Ga0070700_100003667 3300005441 Bacteria 7939
58 Ga0070700_100100874 3300005441 Bacteria 1901
59 Ga0070700_100197887 3300005441 Unclassified 1410
60 Ga0070694_100000103 3300005444 Bacteria 41036
61 Ga0070694_100035679 3300005444 Bacteria 3289
62 Ga0070708_100451305 3300005445 Bacteria 1213
63 Ga0070678_100312642 3300005456 Bacteria 1339
64 Ga0070681_10007160 3300005458 Bacteria 10866
65 Ga0070681_10044304 3300005458 Bacteria 4453
66 Ga0068867_100006049 3300005459 Bacteria 8576
67 Ga0068867_100149427 3300005459 Bacteria 1834
68 Ga0070707_100286761 3300005468 Bacteria 1600
69 Ga0070698_100016189 3300005471 Bacteria 7873
70 Ga0070698_100062666 3300005471 Bacteria 3751
71 Ga0070699_100027307 3300005518 Bacteria 4925
72 Ga0070699_100133120 3300005518 Bacteria 2192
73 Ga0070679_100000647 3300005530 Bacteria 29674
74 Ga0070684_100000046 3300005535 Bacteria 83793
75 Ga0070684_100005973 3300005535 Bacteria 9380
76 Ga0070684_100045600 3300005535 Bacteria 3796
77 Ga0070684_100502776 3300005535 Bacteria 1123
78 Ga0068853_100097870 3300005539 Bacteria 2591
79 Ga0070672_100009675 3300005543 Bacteria 6655
80 Ga0070672_100013542 3300005543 Bacteria 5765
81 Ga0070672_100110066 3300005543 Bacteria 2244
82 Ga0070686_100001594 3300005544 Bacteria 12750
83 Ga0070686_100406240 3300005544 Unclassified 1037
84 Ga0070695_100000116 3300005545 Bacteria 35624
85 Ga0070695_100076365 3300005545 Bacteria 2206
86 Ga0070696_100000345 3300005546 Bacteria 28124
87 Ga0070696_100016777 3300005546 Bacteria 4940
88 Ga0070696_100101165 3300005546 Bacteria 2065
89 Ga0070693_100093185 3300005547 Bacteria 1820
90 Ga0070704_100000258 3300005549 Bacteria 23005
91 Ga0070704_100020186 3300005549 Bacteria 4292
92 Ga0070704_100035136 3300005549 Bacteria 3405
93 Ga0070704_100041194 3300005549 Bacteria 3186
94 Ga0068855_100000646 3300005563 Bacteria 42580
95 Ga0068855_100019334 3300005563 Bacteria 8185
96 Ga0068855_100048953 3300005563 Bacteria 4987
97 Ga0068855_100120347 3300005563 Bacteria 3005
98 Ga0068855_100552916 3300005563 Bacteria 1246
99 Ga0070664_100020479 3300005564 Bacteria 5446
100 Ga0070664_100316329 3300005564 Bacteria 1413
101 Ga0068857_100001122 3300005577 Bacteria 20846
102 Ga0068857_100005377 3300005577 Bacteria 10916
103 Ga0068854_100045224 3300005578 Bacteria 3129
104 Ga0068854_100250189 3300005578 Bacteria 1415
105 Ga0068856_100000726 3300005614 Bacteria 35771
106 Ga0068856_100001203 3300005614 Bacteria 27199
107 Ga0068856_100005772 3300005614 Bacteria 12197
108 Ga0068856_100157786 3300005614 Bacteria 2279
109 Ga0068856_100410586 3300005614 Unclassified 1374
110 Ga0070702_100009092 3300005615 Bacteria 4849
111 Ga0070702_100023054 3300005615 Bacteria 3302
112 Ga0068852_100066984 3300005616 Bacteria 3138
113 Ga0068852_100652635 3300005616 Bacteria 1060
114 Ga0068852_100660961 3300005616 Bacteria 1053
115 Ga0068859_100009976 3300005617 Bacteria 9582
116 Ga0068859_100382156 3300005617 Bacteria 1503
117 Ga0068859_100399532 3300005617 Bacteria 1470
118 Ga0068859_100465616 3300005617 Bacteria 1360
119 Ga0068859_100635757 3300005617 Bacteria 1159
120 Ga0068864_100110317 3300005618 Unclassified 2450
121 Ga0068864_100229624 3300005618 Bacteria 1716
122 Ga0068864_100404486 3300005618 Unclassified 1298
123 Ga0068861_100069496 3300005719 Bacteria 2725
124 Ga0068861_100158876 3300005719 Bacteria 1862
125 Ga0068861_100202637 3300005719 Bacteria 1667
126 Ga0068870_10108840 3300005840 Bacteria 1579
127 Ga0068863_100030991 3300005841 Bacteria 5106
128 Ga0068863_100582160 3300005841 Bacteria 1107
129 Ga0068858_100012711 3300005842 Bacteria 7933
130 Ga0068858_100012723 3300005842 Bacteria 7928
131 Ga0068858_100013947 3300005842 Bacteria 7579
132 Ga0068858_100186411 3300005842 Bacteria 1960
133 Ga0068860_100006762 3300005843 Bacteria 11500
134 Ga0068860_100148300 3300005843 Bacteria 2258
135 Ga0068862_100033293 3300005844 Bacteria 4356
136 Ga0068862_100092320 3300005844 Bacteria 2639
137 Ga0070717_10026006 3300006028 Bacteria 4665
138 Ga0070717_10101762 3300006028 Bacteria 2440
139 Ga0075368_10034529 3300006042 Bacteria 1971
140 Ga0075432_10017366 3300006058 Bacteria 2454
141 Ga0075367_10027551 3300006178 Bacteria 3234
142 Ga0097621_100074999 3300006237 Bacteria 2802
143 Ga0097621_100192998 3300006237 Bacteria 1765
144 Ga0068871_100108942 3300006358 Bacteria 2328
145 Ga0075428_100000007 3300006844 Bacteria 273226
146 Ga0075428_100000753 3300006844 Bacteria 33723
147 Ga0075428_100008343 3300006844 Bacteria 11487
148 Ga0075428_100171257 3300006844 Bacteria 2353
149 Ga0075430_100247592 3300006846 Bacteria 1477
150 Ga0075431_100009172 3300006847 Bacteria 9922
151 Ga0075431_100016845 3300006847 Bacteria 7422
152 Ga0075431_100289904 3300006847 Unclassified 1656
153 Ga0075431_100520102 3300006847 Bacteria 1179
154 Ga0075433_10078079 3300006852 Bacteria 2917
155 Ga0075433_10102466 3300006852 Unclassified 2535
156 Ga0075433_10118244 3300006852 Bacteria 2352
157 Ga0075436_100268804 3300006914 Bacteria 1217
158 Ga0097620_100009974 3300006931 Bacteria 9582
159 Ga0097620_100382179 3300006931 Bacteria 1503
160 Ga0097620_100399526 3300006931 Bacteria 1470
161 Ga0097620_100465622 3300006931 Bacteria 1360
162 Ga0097620_100635739 3300006931 Bacteria 1159
163 Ga0075435_100001037 3300007076 Bacteria 17591
164 Ga0075435_100320075 3300007076 Bacteria 1328
165 Ga0075435_100382222 3300007076 Bacteria 1210
166 Ga0105240_10000443 3300009093 Bacteria 76569
167 Ga0105240_10003579 3300009093 Bacteria 24104
168 Ga0111539_10000009 3300009094 Bacteria 375223
169 Ga0111539_10010213 3300009094 Bacteria 11832
170 Ga0111539_10013966 3300009094 Bacteria 10038
171 Ga0105245_10088615 3300009098 Bacteria 2843
172 Ga0105245_10462307 3300009098 Bacteria 1279
173 Ga0105247_10005882 3300009101 Bacteria 7663
174 Ga0114129_10052784 3300009147 Bacteria 5705
175 Ga0114129_10057839 3300009147 Bacteria 5425
176 Ga0114129_10201201 3300009147 Bacteria 2697
177 Ga0114129_10316142 3300009147 Bacteria 2077
178 Ga0114129_10571620 3300009147 Unclassified 1468
179 Ga0105243_10005953 3300009148 Bacteria 9446
180 Ga0105243_10007976 3300009148 Bacteria 8134
181 Ga0105241_10005429 3300009174 Bacteria 9427
182 Ga0105241_10151289 3300009174 Bacteria 1899
183 Ga0105248_10007966 3300009177 Bacteria 11649
184 Ga0105248_10097807 3300009177 Bacteria 3307
185 Ga0105248_10340441 3300009177 Bacteria 1689
186 Ga0105248_10645618 3300009177 Bacteria 1194
187 Ga0105237_10020934 3300009545 Bacteria 6732
188 Ga0105237_10021789 3300009545 Bacteria 6583
189 Ga0105237_10027496 3300009545 Bacteria 5806
190 Ga0105237_10110535 3300009545 Bacteria 2740
191 Ga0105237_10290948 3300009545 Bacteria 1636
192 Ga0105238_10000989 3300009551 Bacteria 29050
193 Ga0105238_10017552 3300009551 Bacteria 7277
194 Ga0105238_10049075 3300009551 Bacteria 4253
195 Ga0105238_10553701 3300009551 Bacteria 1155
196 Ga0105249_10000865 3300009553 Bacteria 26961
197 Ga0105239_10025836 3300010375 Bacteria 6468
198 Ga0105239_10054554 3300010375 Bacteria 4385
199 Ga0157370_10015460 3300013104 Bacteria 7758
200 Ga0157370_10406499 3300013104 Bacteria 1253
201 Ga0157369_10001561 3300013105 Bacteria 28046
202 Ga0157369_10003458 3300013105 Bacteria 18730
203 Ga0157369_10122144 3300013105 Bacteria 2762
204 Ga0157369_10152084 3300013105 Bacteria 2446
205 Ga0157372_10050231 3300013307 Bacteria 4640
206 Ga0157372_10056983 3300013307 Bacteria 4367
207 Ga0157372_10073328 3300013307 Bacteria 3859
208 Ga0157375_10103402 3300013308 Bacteria 2936
209 Ga0157375_10256051 3300013308 Bacteria 1912
210 Ga0157375_10446666 3300013308 Bacteria 1459
211 Ga0163163_10014717 3300014325 Bacteria 7196
212 Ga0163163_10157254 3300014325 Bacteria 2317
213 Ga0163163_10199400 3300014325 Bacteria 2050
214 Ga0163163_10402186 3300014325 Bacteria 1427
215 Ga0163163_10535297 3300014325 Bacteria 1234
216 Ga0157380_10015960 3300014326 Bacteria 5528
217 Ga0157380_10095632 3300014326 Bacteria 2461
218 Ga0157380_10293521 3300014326 Bacteria 1494
219 Ga0157380_10687045 3300014326 Bacteria 1026
220 Ga0157377_10050802 3300014745 Bacteria 2337
221 Ga0157377_10091762 3300014745 Bacteria 1795
222 Ga0157379_10026300 3300014968 Bacteria 5180
223 Ga0163161_10051117 3300017792 Bacteria 2992
224 Ga0209674_100007 3300025226 Bacteria 1077082
225 Ga0209563_100060 3300025230 Bacteria 284876
226 Ga0209646_1000056 3300025246 Bacteria 269860
227 Ga0209026_1000009 3300025250 Bacteria 531812
228 Ga0209677_100108 3300025253 Bacteria 89018
229 Ga0209677_100217 3300025253 Bacteria 42485
230 Ga0209759_1000035 3300025256 Bacteria 264254
231 Ga0207697_10004839 3300025315 Bacteria 6357
232 Ga0207710_10050795 3300025900 Bacteria 1861
233 Ga0207688_10007012 3300025901 Bacteria 6130
234 Ga0207688_10110139 3300025901 Bacteria 1598
235 Ga0207680_10091383 3300025903 Bacteria 1937
236 Ga0207645_10113857 3300025907 Bacteria 1752
237 Ga0207645_10192917 3300025907 Bacteria 1339
238 Ga0207643_10019533 3300025908 Bacteria 3714
239 Ga0207654_10018536 3300025911 Unclassified 3654
240 Ga0207654_10093644 3300025911 Bacteria 1837
241 Ga0207707_10000890 3300025912 Bacteria 29183
242 Ga0207707_10005761 3300025912 Bacteria 10835
243 Ga0207695_10000504 3300025913 Bacteria 83019
244 Ga0207695_10006399 3300025913 Bacteria 15304
245 Ga0207695_10014364 3300025913 Bacteria 9387
246 Ga0207671_10017860 3300025914 Bacteria 5458
247 Ga0207671_10078512 3300025914 Bacteria 2472
248 Ga0207671_10178901 3300025914 Bacteria 1650
249 Ga0207660_10026548 3300025917 Bacteria 3945
250 Ga0207662_10047416 3300025918 Bacteria 2545
251 Ga0207662_10189035 3300025918 Bacteria 1328
252 Ga0207652_10004342 3300025921 Bacteria 11552
253 Ga0207646_10253041 3300025922 Bacteria 1591
254 Ga0207681_10020070 3300025923 Bacteria 4231
255 Ga0207681_10023574 3300025923 Bacteria 3939
256 Ga0207681_10038090 3300025923 Bacteria 3183
257 Ga0207681_10140745 3300025923 Bacteria 1796
258 Ga0207694_10000465 3300025924 Bacteria 37234
259 Ga0207694_10114368 3300025924 Bacteria 2149
260 Ga0207694_10260132 3300025924 Bacteria 1421
261 Ga0207694_10505713 3300025924 Bacteria 1012
262 Ga0207650_10005731 3300025925 Bacteria 8474
263 Ga0207650_10549526 3300025925 Unclassified 968
264 Ga0207659_10008613 3300025926 Bacteria 6344
265 Ga0207659_10101962 3300025926 Bacteria 2166
266 Ga0207659_10135732 3300025926 Bacteria 1904
267 Ga0207659_10214953 3300025926 Bacteria 1543
268 Ga0207687_10000783 3300025927 Bacteria 21433
269 Ga0207687_10389187 3300025927 Bacteria 1144
270 Ga0207700_10005806 3300025928 Bacteria 7412
271 Ga0207700_10038611 3300025928 Bacteria 3467
272 Ga0207644_10007774 3300025931 Bacteria 7000
273 Ga0207644_10201987 3300025931 Bacteria 1568
274 Ga0207644_10387868 3300025931 Bacteria 1140
275 Ga0207706_10048488 3300025933 Bacteria 3756
276 Ga0207709_10038476 3300025935 Bacteria 2849
277 Ga0207669_10010415 3300025937 Bacteria 4475
278 Ga0207669_10017319 3300025937 Bacteria 3692
279 Ga0207669_10448241 3300025937 Bacteria 1022
280 Ga0207704_10385680 3300025938 Bacteria 1101
281 Ga0207691_10016163 3300025940 Bacteria 7088
282 Ga0207691_10052126 3300025940 Bacteria 3738
283 Ga0207711_10001314 3300025941 Bacteria 23503
284 Ga0207711_10335027 3300025941 Bacteria 1400
285 Ga0207689_10009864 3300025942 Bacteria 8231
286 Ga0207661_10000020 3300025944 Bacteria 216011
287 Ga0207661_10030168 3300025944 Bacteria 4173
288 Ga0207661_10046711 3300025944 Bacteria 3433
289 Ga0207661_10083768 3300025944 Bacteria 2639
290 Ga0207661_10357588 3300025944 Bacteria 1319
291 Ga0207679_10480688 3300025945 Bacteria 1106
292 Ga0207667_10000179 3300025949 Bacteria 92219
293 Ga0207667_10001955 3300025949 Bacteria 25829
294 Ga0207667_10045402 3300025949 Bacteria 4654
295 Ga0207667_10265808 3300025949 Bacteria 1754
296 Ga0207651_10035800 3300025960 Bacteria 3233
297 Ga0207651_10395454 3300025960 Bacteria 1174
298 Ga0207651_10536285 3300025960 Bacteria 1016
299 Ga0207640_10036072 3300025981 Bacteria 3101
300 Ga0207640_10226220 3300025981 Bacteria 1436
301 Ga0207658_10040981 3300025986 Unclassified 3351
302 Ga0207658_10558538 3300025986 Bacteria 1025
303 Ga0207703_10050187 3300026035 Bacteria 3376
304 Ga0207703_10078440 3300026035 Bacteria 2744
305 Ga0207703_10234861 3300026035 Bacteria 1645
306 Ga0207639_10051379 3300026041 Bacteria 3135
307 Ga0207639_10087063 3300026041 Bacteria 2489
308 Ga0207639_10284511 3300026041 Bacteria 1455
309 Ga0207678_10043384 3300026067 Bacteria 3892
310 Ga0207708_10005483 3300026075 Bacteria 9366
311 Ga0207708_10080042 3300026075 Unclassified 2511
312 Ga0207708_10164264 3300026075 Bacteria 1755
313 Ga0207702_10000543 3300026078 Bacteria 42119
314 Ga0207702_10024790 3300026078 Bacteria 4977
315 Ga0207702_10117483 3300026078 Bacteria 2375
316 Ga0207702_10209350 3300026078 Unclassified 1812
317 Ga0207641_10012596 3300026088 Bacteria 6934
318 Ga0207641_10045579 3300026088 Bacteria 3693
319 Ga0207641_10519768 3300026088 Bacteria 1158
320 Ga0207648_10043184 3300026089 Bacteria 3958
321 Ga0207648_10077730 3300026089 Bacteria 2894
322 Ga0207676_10030302 3300026095 Bacteria 4060
323 Ga0207676_10109238 3300026095 Bacteria 2311
324 Ga0207674_10004992 3300026116 Bacteria 15860
325 Ga0207674_10008680 3300026116 Bacteria 11701
326 Ga0207674_10660821 3300026116 Bacteria 1009
327 Ga0207675_100089650 3300026118 Bacteria 2890
328 Ga0207675_100112479 3300026118 Bacteria 2570
329 Ga0207683_10112710 3300026121 Bacteria 2436
330 Ga0207683_10226768 3300026121 Bacteria 1703
331 Ga0207698_10399282 3300026142 Bacteria 1313
332 Ga0207428_10000022 3300027907 Bacteria 273333
333 Ga0207428_10018993 3300027907 Bacteria 5862
334 Ga0207428_10026277 3300027907 Bacteria 4860
335 Ga0268265_10056476 3300028380 Bacteria 2987
336 Ga0268265_10447193 3300028380 Bacteria 1206
337 Ga0268264_10002080 3300028381 Bacteria 17874
338 Ga0268264_10077531 3300028381 Bacteria 2831
339 Ga0268264_10139093 3300028381 Bacteria 2163
340 Ga0265338_10197268 3300028800 Bacteria 1521
341 Ga0265340_10076578 3300031247 Unclassified 1580
342 Ga0265313_10000402 3300031595 Bacteria 46531
343 Ga0265314_10000962 3300031711 Bacteria 33827
344 Ga0307412_10272044 3300031911 Unclassified 1326
345 Ga0373930_0004969 3300034816 Bacteria 2190
346 Ga0373948_0000515 3300034817 Bacteria 4838
347 Ga0373950_0000264 3300034818 Bacteria 6610
348 Ga0373958_0002637 3300034819 Bacteria 2533
349 Ga0373926_0075092 3300035083 Bacteria 1245
350 Ga0373928_0007094 3300035084 Bacteria 2160
351 Ga0373929_0001424 3300035085 Bacteria 4586
352 Ga0373940_0000059 3300035088 Bacteria 12422
353 Ga0373949_0002747 3300035090 Bacteria 4393
354 Ga0373952_0001343 3300035092 Bacteria 4503
355 Ga0373932_0000774 3300035112 Bacteria 9476
356 Ga0373939_0001043 3300035114 Bacteria 6835
357 Ga0373941_0000484 3300035115 Bacteria 7945
358 Ga0373957_0029079 3300035120 Bacteria 2017
359 Ga0373960_0000923 3300035121 Bacteria 6261
360 Ga0373943_0090725 3300035170 Bacteria 1582
361 Ga0373942_0001938 3300035207 Bacteria 5181
362 Ga0373961_0000537 3300035241 Bacteria 14427
363 Ga0373961_0005091 3300035241 Bacteria 3162
364 Ga0373962_0004597 3300035242 Bacteria 3334
365 Ga0373962_0084609 3300035242 Bacteria 968
366 Ga0373935_0088904 3300035692 Bacteria 2019
367 Ga0373935_0152166 3300035692 Bacteria 1571
368 Ga0373927_0010365 3300035695 Bacteria 6220
369 Ga0373933_0007374 3300035724 Bacteria 5998
370 Ga0373933_0169759 3300035724 Bacteria 1388
371 Ga0373933_0298220 3300035724 Bacteria 1043
372 Ga0373947_0345292 3300035725 Unclassified 998
373 Ga0373937_0075619 3300036401 Bacteria 3110
374 Ga0373937_0082684 3300036401 Bacteria 2971
375 Ga0373937_1028536 3300036401 Bacteria 772
376 Ga0373925_0003633 3300037068 Bacteria 11884
377 Ga0395899_0082219 3300037312 Bacteria 2343
378 Ga0395901_0001171 3300038443 Bacteria 27879
379 Ga0436362_0585531 3300039453 Bacteria 2841
380 Ga0439448_0018582 3300042005 Bacteria 2133
381 Ga0466959_0215792 3300045049 Bacteria 1332
382 Ga0451576_0031225 3300045051 Bacteria 5682
383 Ga0451576_0048701 3300045051 Bacteria 4449
384 Ga0451576_0212444 3300045051 Bacteria 2020
385 Ga0451576_0668082 3300045051 Bacteria 1092
386 Ga0495592_0108420 3300046454 Unclassified 1968
387 Ga0495592_0123729 3300046454 Bacteria 1817
388 Ga0495629_0365695 3300046459 Unclassified 983
389 Ga0495638_0155369 3300046460 Bacteria 1324
390 Ga0495653_0103069 3300046463 Bacteria 2064
391 Ga0495653_0137633 3300046463 Bacteria 1721
392 Ga0495580_0125517 3300046472 Bacteria 1781
393 Ga0495639_0202631 3300046475 Bacteria 972
394 Ga0495662_0020784 3300046476 Bacteria 3175
395 Ga0495664_0061561 3300046477 Bacteria 2234
396 Ga0495594_0233448 3300046499 Unclassified 1048
397 Ga0495618_0030749 3300046514 Bacteria 3355
398 Ga0495663_0008971 3300046525 Bacteria 2772
399 Ga0495652_0023999 3300046529 Bacteria 5402
400 Ga0495652_0024997 3300046529 Bacteria 5285
401 Ga0495652_0393269 3300046529 Bacteria 983
402 Ga0495665_0029962 3300046531 Bacteria 2913
403 Ga0495640_0028779 3300046533 Unclassified 3996
404 Ga0495586_0184389 3300046535 Bacteria 1181
405 Ga0495587_0007433 3300046536 Bacteria 7092
406 Ga0495587_0098195 3300046536 Bacteria 1688
407 Ga0495645_0086677 3300046543 Bacteria 2240
408 Ga0495645_0197503 3300046543 Bacteria 1367
409 Ga0495645_0198144 3300046543 Bacteria 1364
410 Ga0495645_0265784 3300046543 Unclassified 1134
411 Ga0495645_0365832 3300046543 Bacteria 926
412 Ga0495667_0093142 3300046559 Bacteria 1951
413 Ga0495634_0029465 3300046642 Bacteria 3800
414 Ga0495635_0186620 3300046663 Unclassified 1408
415 Ga0495659_0018296 3300046664 Bacteria 2333
416 Ga0495659_0030897 3300046664 Unclassified 1866
417 Ga0495659_0053647 3300046664 Bacteria 1473
418 Ga0495657_0071952 3300046675 Bacteria 2257
419 Ga0495599_0009193 3300046678 Bacteria 6031
420 Ga0495599_0163159 3300046678 Bacteria 1377
421 Ga0495623_0109778 3300046679 Bacteria 1673
422 Ga0495623_0369755 3300046679 Bacteria 777
423 Ga0495646_0120207 3300046680 Bacteria 1487
424 Ga0495613_0090009 3300046689 Bacteria 2223
425 Ga0495613_0119978 3300046689 Bacteria 1889
426 Ga0495600_0109465 3300046809 Bacteria 1799
427 Ga0495581_0169748 3300047315 Bacteria 1276
428 Ga0495604_0031050 3300047317 Bacteria 4240
429 Ga0495604_0092683 3300047317 Bacteria 2237
430 Ga0495636_0076602 3300047318 Bacteria 1434
431 Ga0495674_0014245 3300047319 Bacteria 7446
432 Ga0495674_0172791 3300047319 Unclassified 1802
433 Ga0495674_0536877 3300047319 Bacteria 932
434 Ga0495680_0036491 3300047322 Bacteria 3945
435 Ga0495680_0126409 3300047322 Bacteria 1882
436 Ga0495675_0064239 3300047444 Bacteria 2322
437 Ga0495675_0150945 3300047444 Unclassified 1436
438 Ga0495675_0153365 3300047444 Bacteria 1422
439 Ga0495685_013373 3300047447 Bacteria 2786
440 Ga0495684_0035572 3300047471 Bacteria 3818
441 Ga0495684_0116325 3300047471 Bacteria 2016
442 Ga0495602_0001449 3300048088 Bacteria 23541
443 Ga0496104_0068708 3300048907 Bacteria 3367
444 Ga0496104_0204506 3300048907 Bacteria 1886
445 Ga0496104_0516515 3300048907 Bacteria 1106
446 Ga0496108_0030688 3300048911 Bacteria 4454
447 Ga0496110_0149935 3300048913 Bacteria 2111
448 Ga0496112_0011607 3300048915 Bacteria 8056
449 Ga0496112_0031741 3300048915 Bacteria 5125
450 Ga0496113_0065310 3300048916 Bacteria 2754
451 Ga0501038_0478074 3300049574 Bacteria 955
452 Ga0501040_0013788 3300049576 Bacteria 5320
453 Ga0501041_0055472 3300049577 Bacteria 2419
454 Ga0501041_0159304 3300049577 Bacteria 1411
455 Ga0501046_0196337 3300049580 Bacteria 1503
456 Ga0501071_0176687 3300049587 Bacteria 1599
457 Ga0501071_0239699 3300049587 Bacteria 1367
458 Ga0501072_0116802 3300049588 Bacteria 2125
459 Ga0501075_0063308 3300049591 Bacteria 2788
460 Ga0501075_0193665 3300049591 Bacteria 1550
461 Ga0501075_0281583 3300049591 Unclassified 1267
462 Ga0501076_0498022 3300049592 Bacteria 1004
463 Ga0501045_0086613 3300049824 Bacteria 2312
464 nmdc:mga05p37_471686_c1 3300050507 Bacteria 1448
465 nmdc:mga09592_150420_c1 3300050508 Bacteria 2008
466 nmdc:mga09592_42903_c1 3300050508 Bacteria 3805
467 nmdc:mga06r32_13308_c1 3300050510 Bacteria 7450
468 nmdc:mga06r32_294184_c1 3300050510 Bacteria 1610
469 nmdc:mga06r32_65664_c1 3300050510 Bacteria 3500
470 nmdc:mga08y16_10361_c1 3300050511 Bacteria 9781
471 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
472 nmdc:mga08y16_363740_c1 3300050511 Bacteria 1485
473 nmdc:mga08y16_564396_c1 3300050511 Bacteria 1151
474 nmdc:mga08y16_9773_c1 3300050511 Bacteria 10074
475 nmdc:mga0rr50_467_c1 3300050513 Bacteria 21522
476 nmdc:mga08x19_249865_c1 3300050514 Bacteria 1224
477 nmdc:mga0a205_116548_c1 3300050515 Bacteria 2570
478 nmdc:mga0a205_168436_c1 3300050515 Unclassified 2086
479 nmdc:mga0a205_38973_c1 3300050515 Bacteria 4573
480 Ga0500647_0024304 3300053091 Bacteria 2849
481 Ga0500568_0018856 3300053139 Bacteria 3009
482 Ga0501084_0312007 3300054114 Bacteria 1328
483 Ga0501082_0003105 3300060353 Bacteria 14474
484 Ga0207675_100169806
485 JGI25156J39149_1000016
486 JGI25154J39366_1001191
487 JGI25157J39369_1000035
488 rootH1_10011774
489 rootH1_10085543
490 Ga0055539_1000124
491 Ga0055533_1000024
492 Ga0065715_10282006
493 Ga0065707_10000853
494 Ga0070658_10178188
495 Ga0070683_100000032
496 Ga0070683_100025821
497 Ga0070683_100032166
498 Ga0070683_100053140
499 Ga0070683_100180790
500 Ga0070683_100207517
501 Ga0070690_100168912
502 Ga0070670_100009642
503 Ga0070666_10041149
504 Ga0070680_100006751
505 Ga0070689_100009786
506 Ga0070689_100037470
507 Ga0070691_10001836
508 Ga0070691_10101965
509 Ga0070687_100153458
510 Ga0070661_100138247
511 Ga0070661_100208320
512 Ga0070661_100238020
513 Ga0070661_100436294
514 Ga0070669_100031571
515 Ga0070669_100054313
516 Ga0070669_100086642
517 Ga0070669_100120269
518 Ga0070669_100240453
519 Ga0070675_100000434
520 Ga0070675_100040857
521 Ga0070675_100081786
522 Ga0070675_100249532
523 Ga0070671_100034443
524 Ga0070671_100059229
525 Ga0070674_100001822
526 Ga0070674_100109337
527 Ga0070674_100397882
528 Ga0070674_100432487
529 Ga0070673_100031714
530 Ga0070688_100012115
531 Ga0070688_100117419
532 Ga0070667_100066273
533 Ga0070709_10429317
534 Ga0070714_100294124
535 Ga0070713_100015254
536 Ga0070705_100010575
537 Ga0070705_100345387
538 Ga0070700_100003667
539 Ga0070700_100100874
540 Ga0070700_100197887
541 Ga0070694_100000103
542 Ga0070694_100035679
543 Ga0070708_100451305
544 Ga0070678_100312642
545 Ga0070681_10007160
546 Ga0070681_10044304
547 Ga0068867_100006049
548 Ga0068867_100149427
549 Ga0070707_100286761
550 Ga0070698_100016189
551 Ga0070698_100062666
552 Ga0070699_100027307
553 Ga0070699_100133120
554 Ga0070679_100000647
555 Ga0070684_100000046
556 Ga0070684_100005973
557 Ga0070684_100045600
558 Ga0070684_100502776
559 Ga0068853_100097870
560 Ga0070672_100009675
561 Ga0070672_100013542
562 Ga0070672_100110066
563 Ga0070686_100001594
564 Ga0070686_100406240
565 Ga0070695_100000116
566 Ga0070695_100076365
567 Ga0070696_100000345
568 Ga0070696_100016777
569 Ga0070696_100101165
570 Ga0070693_100093185
571 Ga0070704_100000258
572 Ga0070704_100020186
573 Ga0070704_100035136
574 Ga0070704_100041194
575 Ga0068855_100000646
576 Ga0068855_100019334
577 Ga0068855_100048953
578 Ga0068855_100120347
579 Ga0068855_100552916
580 Ga0070664_100020479
581 Ga0070664_100316329
582 Ga0068857_100001122
583 Ga0068857_100005377
584 Ga0068854_100045224
585 Ga0068854_100250189
586 Ga0068856_100000726
587 Ga0068856_100001203
588 Ga0068856_100005772
589 Ga0068856_100157786
590 Ga0068856_100410586
591 Ga0070702_100009092
592 Ga0070702_100023054
593 Ga0068852_100066984
594 Ga0068852_100652635
595 Ga0068852_100660961
596 Ga0068859_100009976
597 Ga0068859_100382156
598 Ga0068859_100399532
599 Ga0068859_100465616
600 Ga0068859_100635757
601 Ga0068864_100110317
602 Ga0068864_100229624
603 Ga0068864_100404486
604 Ga0068861_100069496
605 Ga0068861_100158876
606 Ga0068861_100202637
607 Ga0068870_10108840
608 Ga0068863_100030991
609 Ga0068863_100582160
610 Ga0068858_100012711
611 Ga0068858_100012723
612 Ga0068858_100013947
613 Ga0068858_100186411
614 Ga0068860_100006762
615 Ga0068860_100148300
616 Ga0068862_100033293
617 Ga0068862_100092320
618 Ga0070717_10026006
619 Ga0070717_10101762
620 Ga0075368_10034529
621 Ga0075432_10017366
622 Ga0075367_10027551
623 Ga0097621_100074999
624 Ga0097621_100192998
625 Ga0068871_100108942
626 Ga0075428_100000007
627 Ga0075428_100000753
628 Ga0075428_100008343
629 Ga0075428_100171257
630 Ga0075430_100247592
631 Ga0075431_100009172
632 Ga0075431_100016845
633 Ga0075431_100289904
634 Ga0075431_100520102
635 Ga0075433_10078079
636 Ga0075433_10102466
637 Ga0075433_10118244
638 Ga0075436_100268804
639 Ga0097620_100009974
640 Ga0097620_100382179
641 Ga0097620_100399526
642 Ga0097620_100465622
643 Ga0097620_100635739
644 Ga0075435_100001037
645 Ga0075435_100320075
646 Ga0075435_100382222
647 Ga0105240_10000443
648 Ga0105240_10003579
649 Ga0111539_10000009
650 Ga0111539_10010213
651 Ga0111539_10013966
652 Ga0105245_10088615
653 Ga0105245_10462307
654 Ga0105247_10005882
655 Ga0114129_10052784
656 Ga0114129_10057839
657 Ga0114129_10201201
658 Ga0114129_10316142
659 Ga0114129_10571620
660 Ga0105243_10005953
661 Ga0105243_10007976
662 Ga0105241_10005429
663 Ga0105241_10151289
664 Ga0105248_10007966
665 Ga0105248_10097807
666 Ga0105248_10340441
667 Ga0105248_10645618
668 Ga0105237_10020934
669 Ga0105237_10021789
670 Ga0105237_10027496
671 Ga0105237_10110535
672 Ga0105237_10290948
673 Ga0105238_10000989
674 Ga0105238_10017552
675 Ga0105238_10049075
676 Ga0105238_10553701
677 Ga0105249_10000865
678 Ga0105239_10025836
679 Ga0105239_10054554
680 Ga0157370_10015460
681 Ga0157370_10406499
682 Ga0157369_10001561
683 Ga0157369_10003458
684 Ga0157369_10122144
685 Ga0157369_10152084
686 Ga0157372_10050231
687 Ga0157372_10056983
688 Ga0157372_10073328
689 Ga0157375_10103402
690 Ga0157375_10256051
691 Ga0157375_10446666
692 Ga0163163_10014717
693 Ga0163163_10157254
694 Ga0163163_10199400
695 Ga0163163_10402186
696 Ga0163163_10535297
697 Ga0157380_10015960
698 Ga0157380_10095632
699 Ga0157380_10293521
700 Ga0157380_10687045
701 Ga0157377_10050802
702 Ga0157377_10091762
703 Ga0157379_10026300
704 Ga0163161_10051117
705 Ga0209674_100007
706 Ga0209563_100060
707 Ga0209646_1000056
708 Ga0209026_1000009
709 Ga0209677_100108
710 Ga0209677_100217
711 Ga0209759_1000035
712 Ga0207697_10004839
713 Ga0207710_10050795
714 Ga0207688_10007012
715 Ga0207688_10110139
716 Ga0207680_10091383
717 Ga0207645_10113857
718 Ga0207645_10192917
719 Ga0207643_10019533
720 Ga0207654_10018536
721 Ga0207654_10093644
722 Ga0207707_10000890
723 Ga0207707_10005761
724 Ga0207695_10000504
725 Ga0207695_10006399
726 Ga0207695_10014364
727 Ga0207671_10017860
728 Ga0207671_10078512
729 Ga0207671_10178901
730 Ga0207660_10026548
731 Ga0207662_10047416
732 Ga0207662_10189035
733 Ga0207652_10004342
734 Ga0207646_10253041
735 Ga0207681_10020070
736 Ga0207681_10023574
737 Ga0207681_10038090
738 Ga0207681_10140745
739 Ga0207694_10000465
740 Ga0207694_10114368
741 Ga0207694_10260132
742 Ga0207694_10505713
743 Ga0207650_10005731
744 Ga0207650_10549526
745 Ga0207659_10008613
746 Ga0207659_10101962
747 Ga0207659_10135732
748 Ga0207659_10214953
749 Ga0207687_10000783
750 Ga0207687_10389187
751 Ga0207700_10005806
752 Ga0207700_10038611
753 Ga0207644_10007774
754 Ga0207644_10201987
755 Ga0207644_10387868
756 Ga0207706_10048488
757 Ga0207709_10038476
758 Ga0207669_10010415
759 Ga0207669_10017319
760 Ga0207669_10448241
761 Ga0207704_10385680
762 Ga0207691_10016163
763 Ga0207691_10052126
764 Ga0207711_10001314
765 Ga0207711_10335027
766 Ga0207689_10009864
767 Ga0207661_10000020
768 Ga0207661_10030168
769 Ga0207661_10046711
770 Ga0207661_10083768
771 Ga0207661_10357588
772 Ga0207679_10480688
773 Ga0207667_10000179
774 Ga0207667_10001955
775 Ga0207667_10045402
776 Ga0207667_10265808
777 Ga0207651_10035800
778 Ga0207651_10395454
779 Ga0207651_10536285
780 Ga0207640_10036072
781 Ga0207640_10226220
782 Ga0207658_10040981
783 Ga0207658_10558538
784 Ga0207703_10050187
785 Ga0207703_10078440
786 Ga0207703_10234861
787 Ga0207639_10051379
788 Ga0207639_10087063
789 Ga0207639_10284511
790 Ga0207678_10043384
791 Ga0207708_10005483
792 Ga0207708_10080042
793 Ga0207708_10164264
794 Ga0207702_10000543
795 Ga0207702_10024790
796 Ga0207702_10117483
797 Ga0207702_10209350
798 Ga0207641_10012596
799 Ga0207641_10045579
800 Ga0207641_10519768
801 Ga0207648_10043184
802 Ga0207648_10077730
803 Ga0207676_10030302
804 Ga0207676_10109238
805 Ga0207674_10004992
806 Ga0207674_10008680
807 Ga0207674_10660821
808 Ga0207675_100089650
809 Ga0207675_100112479
810 Ga0207683_10112710
811 Ga0207683_10226768
812 Ga0207698_10399282
813 Ga0207428_10000022
814 Ga0207428_10018993
815 Ga0207428_10026277
816 Ga0268265_10056476
817 Ga0268265_10447193
818 Ga0268264_10002080
819 Ga0268264_10077531
820 Ga0268264_10139093
821 Ga0265338_10197268
822 Ga0265340_10076578
823 Ga0265313_10000402
824 Ga0265314_10000962
825 Ga0307412_10272044
826 Ga0373930_0004969
827 Ga0373948_0000515
828 Ga0373950_0000264
829 Ga0373958_0002637
830 Ga0373926_0075092
831 Ga0373928_0007094
832 Ga0373929_0001424
833 Ga0373940_0000059
834 Ga0373949_0002747
835 Ga0373952_0001343
836 Ga0373932_0000774
837 Ga0373939_0001043
838 Ga0373941_0000484
839 Ga0373957_0029079
840 Ga0373960_0000923
841 Ga0373943_0090725
842 Ga0373942_0001938
843 Ga0373961_0000537
844 Ga0373961_0005091
845 Ga0373962_0004597
846 Ga0373962_0084609
847 Ga0373935_0088904
848 Ga0373935_0152166
849 Ga0373927_0010365
850 Ga0373933_0007374
851 Ga0373933_0169759
852 Ga0373933_0298220
853 Ga0373947_0345292
854 Ga0373937_0075619
855 Ga0373937_0082684
856 Ga0373937_1028536
857 Ga0373925_0003633
858 Ga0395899_0082219
859 Ga0395901_0001171
860 Ga0436362_0585531
861 Ga0439448_0018582
862 Ga0466959_0215792
863 Ga0451576_0031225
864 Ga0451576_0048701
865 Ga0451576_0212444
866 Ga0451576_0668082
867 Ga0495592_0108420
868 Ga0495592_0123729
869 Ga0495629_0365695
870 Ga0495638_0155369
871 Ga0495653_0103069
872 Ga0495653_0137633
873 Ga0495580_0125517
874 Ga0495639_0202631
875 Ga0495662_0020784
876 Ga0495664_0061561
877 Ga0495594_0233448
878 Ga0495618_0030749
879 Ga0495663_0008971
880 Ga0495652_0023999
881 Ga0495652_0024997
882 Ga0495652_0393269
883 Ga0495665_0029962
884 Ga0495640_0028779
885 Ga0495586_0184389
886 Ga0495587_0007433
887 Ga0495587_0098195
888 Ga0495645_0086677
889 Ga0495645_0197503
890 Ga0495645_0198144
891 Ga0495645_0265784
892 Ga0495645_0365832
893 Ga0495667_0093142
894 Ga0495634_0029465
895 Ga0495635_0186620
896 Ga0495659_0018296
897 Ga0495659_0030897
898 Ga0495659_0053647
899 Ga0495657_0071952
900 Ga0495599_0009193
901 Ga0495599_0163159
902 Ga0495623_0109778
903 Ga0495623_0369755
904 Ga0495646_0120207
905 Ga0495613_0090009
906 Ga0495613_0119978
907 Ga0495600_0109465
908 Ga0495581_0169748
909 Ga0495604_0031050
910 Ga0495604_0092683
911 Ga0495636_0076602
912 Ga0495674_0014245
913 Ga0495674_0172791
914 Ga0495674_0536877
915 Ga0495680_0036491
916 Ga0495680_0126409
917 Ga0495675_0064239
918 Ga0495675_0150945
919 Ga0495675_0153365
920 Ga0495685_013373
921 Ga0495684_0035572
922 Ga0495684_0116325
923 Ga0495602_0001449
924 Ga0496104_0068708
925 Ga0496104_0204506
926 Ga0496104_0516515
927 Ga0496108_0030688
928 Ga0496110_0149935
929 Ga0496112_0011607
930 Ga0496112_0031741
931 Ga0496113_0065310
932 Ga0501038_0478074
933 Ga0501040_0013788
934 Ga0501041_0055472
935 Ga0501041_0159304
936 Ga0501046_0196337
937 Ga0501071_0176687
938 Ga0501071_0239699
939 Ga0501072_0116802
940 Ga0501075_0063308
941 Ga0501075_0193665
942 Ga0501075_0281583
943 Ga0501076_0498022
944 Ga0501045_0086613
945 nmdc:mga05p37_471686_c1
946 nmdc:mga09592_150420_c1
947 nmdc:mga09592_42903_c1
948 nmdc:mga06r32_13308_c1
949 nmdc:mga06r32_294184_c1
950 nmdc:mga06r32_65664_c1
951 nmdc:mga08y16_10361_c1
952 nmdc:mga08y16_21_c1
953 nmdc:mga08y16_363740_c1
954 nmdc:mga08y16_564396_c1
955 nmdc:mga08y16_9773_c1
956 nmdc:mga0rr50_467_c1
957 nmdc:mga08x19_249865_c1
958 nmdc:mga0a205_116548_c1
959 nmdc:mga0a205_168436_c1
960 nmdc:mga0a205_38973_c1
961 Ga0500647_0024304
962 Ga0500568_0018856
963 Ga0501084_0312007
964 Ga0501082_0003105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

4

174

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

177

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9064 4 199
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8928 4 200
3hrd-assembly1.cif.gz_C crystal structure of nicotinate dehydrogenase 0.8847 1 189
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8846 4 200
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8845 4 200
ID Description Score Start End Superfamily
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9385 54 166 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.928 55 164 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9227 62 164 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8936 55 164 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8931 54 166 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A2S6TG65-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9642 55 201 GO:0016491
GO:0071949
AF-A0A2W5JB97-F1-model_v4 deleted 0.9551 84 201
AF-A0A537DI04-F1-model_v4 Carbon monoxide dehydrogenase 0.9508 121 205 GO:0016491
GO:0050660
AF-A0A2U2CH22-F1-model_v4 Glutathione S-transferase 0.9479 101 201 GO:0016491
GO:0071949
AF-A0A5E4UQ21-F1-model_v4 Carbon-monoxide dehydrogenase (Acceptor) (EC 1.2.7.4) 0.945 4 201 GO:0043885
GO:0071949

Map