F452414

General Info

Members Datasets Scaffolds Average Seq Length
481 200 962 138

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10039352|Ga0207707_100393522
Length 164
Sequence VSDSERRLDGARPGAEVPASPAPERETVRDAMVSEPTMLSVAANAQEAGQCLENEDVRAVFVVEEDGALVGVLTRKTLVREVVAAGRDPREVRLREIAEPPLFTLDAALPLEEGFRQLEEHDLERVPVVEGSRLVGVLSRAVVQRRLAEDEPPELDPDPGSLVL

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 2.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.56
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 7.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10039352 3300025912 Bacteria 4133
2 Ga0070658_10043622 3300005327 Bacteria 3622
3 Ga0070658_10170920 3300005327 Bacteria 1826
4 Ga0070658_10209477 3300005327 Bacteria 1646
5 Ga0070658_10233302 3300005327 Bacteria 1558
6 Ga0070658_10577286 3300005327 Archaea 974
7 Ga0070683_100003255 3300005329 Bacteria 13122
8 Ga0070683_100263154 3300005329 Bacteria 1641
9 Ga0070683_100343148 3300005329 Bacteria 1422
10 Ga0070690_100259182 3300005330 Bacteria 1233
11 Ga0070682_100081901 3300005337 Bacteria 2091
12 Ga0070660_100037271 3300005339 Bacteria 3686
13 Ga0070660_100074619 3300005339 Bacteria 2654
14 Ga0070660_100076320 3300005339 Bacteria 2624
15 Ga0070660_100194917 3300005339 Bacteria 1642
16 Ga0070660_100286352 3300005339 Bacteria 1349
17 Ga0070660_101366681 3300005339 Bacteria 601
18 Ga0070661_100044444 3300005344 Bacteria 3245
19 Ga0070661_101653479 3300005344 Bacteria 542
20 Ga0070692_10733239 3300005345 Bacteria 668
21 Ga0070671_100114839 3300005355 Bacteria 2263
22 Ga0070659_100038460 3300005366 Bacteria 3731
23 Ga0070714_100123371 3300005435 Bacteria 2307
24 Ga0070714_100214023 3300005435 Bacteria 1768
25 Ga0070714_100227006 3300005435 Bacteria 1719
26 Ga0070713_100005268 3300005436 Bacteria 8821
27 Ga0070694_100420482 3300005444 Archaea 1050
28 Ga0070708_100017256 3300005445 Bacteria 6014
29 Ga0070708_100802056 3300005445 Bacteria 885
30 Ga0070708_101466491 3300005445 Unclassified 636
31 Ga0070678_100209056 3300005456 Bacteria 1616
32 Ga0070681_10031963 3300005458 Bacteria 5283
33 Ga0070681_10092680 3300005458 Bacteria 2969
34 Ga0070681_10108642 3300005458 Bacteria 2714
35 Ga0070681_10253652 3300005458 Bacteria 1671
36 Ga0070681_10451584 3300005458 Archaea 1197
37 Ga0070681_11901575 3300005458 Bacteria 522
38 Ga0070706_100374869 3300005467 Bacteria 1326
39 Ga0070706_100688868 3300005467 Archaea 948
40 Ga0070706_101066398 3300005467 Bacteria 744
41 Ga0070706_101249449 3300005467 Bacteria 682
42 Ga0070707_100173698 3300005468 Bacteria 2100
43 Ga0070707_100323022 3300005468 Bacteria 1500
44 Ga0070698_100108538 3300005471 Bacteria 2742
45 Ga0070698_100132666 3300005471 Archaea 2445
46 Ga0070698_100324882 3300005471 Archaea 1469
47 Ga0070699_100045698 3300005518 Bacteria 3790
48 Ga0070699_100600264 3300005518 Bacteria 1004
49 Ga0070679_100001045 3300005530 Bacteria 24132
50 Ga0070679_100043113 3300005530 Bacteria 4495
51 Ga0070679_100251284 3300005530 Bacteria 1724
52 Ga0070679_100458738 3300005530 Bacteria 1219
53 Ga0070684_100134343 3300005535 Bacteria 2233
54 Ga0070684_100344325 3300005535 Bacteria 1371
55 Ga0070684_100374579 3300005535 Archaea 1311
56 Ga0068853_100622435 3300005539 Bacteria 1026
57 Ga0070693_100391556 3300005547 Bacteria 961
58 Ga0068855_100037971 3300005563 Bacteria 5724
59 Ga0068855_100066322 3300005563 Bacteria 4208
60 Ga0068857_100494673 3300005577 Bacteria 1147
61 Ga0068856_100441039 3300005614 Bacteria 1323
62 Ga0068856_101953022 3300005614 Unclassified 597
63 Ga0070702_100908252 3300005615 Bacteria 690
64 Ga0068852_100267248 3300005616 Bacteria 1644
65 Ga0068852_101518735 3300005616 Unclassified 692
66 Ga0068866_10523589 3300005718 Bacteria 788
67 Ga0081455_10049997 3300005937 Bacteria 3599
68 Ga0081455_10134895 3300005937 Bacteria 1925
69 Ga0070717_10273324 3300006028 Bacteria 1497
70 Ga0070715_10282141 3300006163 Unclassified 881
71 Ga0070716_100658517 3300006173 Bacteria 795
72 Ga0068871_100506402 3300006358 Bacteria 1089
73 Ga0075433_10151514 3300006852 Bacteria 2063
74 Ga0075434_100134811 3300006871 Bacteria 2489
75 Ga0075434_100326971 3300006871 Bacteria 1554
76 Ga0075436_100504787 3300006914 Bacteria 885
77 Ga0075436_100548985 3300006914 Bacteria 848
78 Ga0075435_100059322 3300007076 Bacteria 3102
79 Ga0105240_10023029 3300009093 Bacteria 8249
80 Ga0105240_10254559 3300009093 Bacteria 2029
81 Ga0105240_10879951 3300009093 Bacteria 965
82 Ga0105240_12442771 3300009093 Bacteria 541
83 Ga0114129_11450088 3300009147 Bacteria 845
84 Ga0105243_10062582 3300009148 Bacteria 2979
85 Ga0105243_11383519 3300009148 Bacteria 724
86 Ga0105241_10163672 3300009174 Bacteria 1831
87 Ga0105242_10089028 3300009176 Bacteria 2594
88 Ga0105242_12587773 3300009176 Unclassified 556
89 Ga0105238_10944694 3300009551 Bacteria 882
90 Ga0105238_11145493 3300009551 Bacteria 801
91 Ga0157373_10350582 3300013100 Bacteria 1053
92 Ga0157371_10420798 3300013102 Bacteria 979
93 Ga0157370_10042519 3300013104 Bacteria 4378
94 Ga0157370_10525124 3300013104 Bacteria 1086
95 Ga0157370_10581866 3300013104 Bacteria 1026
96 Ga0157369_10100961 3300013105 Bacteria 3076
97 Ga0157369_10127932 3300013105 Bacteria 2692
98 Ga0157369_10247161 3300013105 Bacteria 1862
99 Ga0157369_10363352 3300013105 Bacteria 1503
100 Ga0157369_10453834 3300013105 Bacteria 1327
101 Ga0157369_10910504 3300013105 Bacteria 902
102 Ga0157369_12269752 3300013105 Unclassified 550
103 Ga0157372_10284781 3300013307 Bacteria 1922
104 Ga0157372_10385293 3300013307 Bacteria 1633
105 Ga0157372_10588212 3300013307 Bacteria 1297
106 Ga0157372_12337820 3300013307 Unclassified 614
107 Ga0157380_10746313 3300014326 Bacteria 990
108 Ga0182008_10343897 3300014497 Archaea 790
109 Ga0182006_1056696 3300015261 Bacteria 1491
110 Ga0197907_10658192 3300020069 Unclassified 604
111 Ga0197907_11003145 3300020069 Unclassified 858
112 Ga0206356_10626314 3300020070 Bacteria 1800
113 Ga0206356_11386261 3300020070 Bacteria 1981
114 Ga0206356_11769102 3300020070 Bacteria 1013
115 Ga0206356_11808796 3300020070 Bacteria 728
116 Ga0206354_10014569 3300020081 Bacteria 2316
117 Ga0206354_10761226 3300020081 Bacteria 1031
118 Ga0206354_10932083 3300020081 Bacteria 2006
119 Ga0206353_10590963 3300020082 Bacteria 4866
120 Ga0206353_11732424 3300020082 Bacteria 2300
121 Ga0206353_11820817 3300020082 Unclassified 775
122 Ga0206353_12041574 3300020082 Bacteria 1155
123 Ga0224712_10381214 3300022467 Unclassified 670
124 Ga0207699_10122406 3300025906 Bacteria 1685
125 Ga0207705_10050648 3300025909 Bacteria 2990
126 Ga0207705_10057117 3300025909 Bacteria 2815
127 Ga0207705_10398577 3300025909 Bacteria 1064
128 Ga0207705_10687789 3300025909 Unclassified 795
129 Ga0207684_10973076 3300025910 Bacteria 711
130 Ga0207654_10375930 3300025911 Bacteria 983
131 Ga0207707_10048924 3300025912 Bacteria 3684
132 Ga0207707_10070392 3300025912 Bacteria 3048
133 Ga0207707_10175847 3300025912 Bacteria 1870
134 Ga0207707_10242337 3300025912 Bacteria 1567
135 Ga0207707_10244974 3300025912 Bacteria 1558
136 Ga0207707_10433800 3300025912 Bacteria 1125
137 Ga0207707_11012379 3300025912 Bacteria 681
138 Ga0207695_10119990 3300025913 Bacteria 2599
139 Ga0207695_11222130 3300025913 Bacteria 632
140 Ga0207693_10031904 3300025915 Bacteria 4162
141 Ga0207693_10271730 3300025915 Bacteria 1328
142 Ga0207693_10400564 3300025915 Bacteria 1073
143 Ga0207663_10249231 3300025916 Bacteria 1306
144 Ga0207660_10173136 3300025917 Bacteria 1672
145 Ga0207660_10301763 3300025917 Bacteria 1275
146 Ga0207660_10788961 3300025917 Bacteria 775
147 Ga0207657_10065237 3300025919 Bacteria 3105
148 Ga0207657_10070854 3300025919 Bacteria 2953
149 Ga0207657_10131472 3300025919 Bacteria 2051
150 Ga0207657_10216329 3300025919 Bacteria 1536
151 Ga0207657_10225925 3300025919 Bacteria 1498
152 Ga0207657_10475452 3300025919 Bacteria 980
153 Ga0207657_10626566 3300025919 Unclassified 838
154 Ga0207649_10038475 3300025920 Bacteria 2896
155 Ga0207652_10113336 3300025921 Bacteria 2407
156 Ga0207652_10149775 3300025921 Bacteria 2089
157 Ga0207652_10365251 3300025921 Bacteria 1303
158 Ga0207652_10455647 3300025921 Bacteria 1153
159 Ga0207646_10085322 3300025922 Bacteria 2825
160 Ga0207646_10204682 3300025922 Bacteria 1783
161 Ga0207700_10003351 3300025928 Bacteria 9293
162 Ga0207700_11420743 3300025928 Unclassified 617
163 Ga0207664_10253301 3300025929 Bacteria 1537
164 Ga0207664_10269837 3300025929 Bacteria 1490
165 Ga0207664_10275315 3300025929 Bacteria 1476
166 Ga0207664_10517734 3300025929 Bacteria 1069
167 Ga0207664_10620233 3300025929 Bacteria 972
168 Ga0207664_10707085 3300025929 Bacteria 906
169 Ga0207664_10724460 3300025929 Bacteria 894
170 Ga0207664_11050990 3300025929 Bacteria 729
171 Ga0207644_10089751 3300025931 Bacteria 2288
172 Ga0207690_10415529 3300025932 Bacteria 1075
173 Ga0207690_11252791 3300025932 Unclassified 620
174 Ga0207709_11496307 3300025935 Bacteria 560
175 Ga0207661_10112103 3300025944 Bacteria 2308
176 Ga0207661_10300448 3300025944 Bacteria 1439
177 Ga0207667_10342600 3300025949 Bacteria 1525
178 Ga0207667_10485798 3300025949 Archaea 1253
179 Ga0207667_10808969 3300025949 Bacteria 933
180 Ga0207640_10899202 3300025981 Bacteria 773
181 Ga0207702_10590306 3300026078 Bacteria 1089
182 Ga0207674_10193147 3300026116 Bacteria 1986
183 Ga0207683_10114356 3300026121 Bacteria 2418
184 Ga0207698_10299395 3300026142 Bacteria 1497
185 Ga0207698_10928650 3300026142 Bacteria 878
186 Ga0207698_11680334 3300026142 Bacteria 650
187 Ga0207428_10309397 3300027907 Bacteria 1168
188 Ga0307408_101338607 3300031548 Unclassified 672
189 Ga0307407_10165397 3300031903 Bacteria 1452
190 Ga0307409_100060308 3300031995 Bacteria 2958
191 Ga0307416_100163918 3300032002 Bacteria 2059
192 Ga0307416_100808766 3300032002 Bacteria 1033
193 Ga0307416_100962749 3300032002 Bacteria 956
194 Ga0307416_101617034 3300032002 Bacteria 753
195 Ga0373944_0048459 3300035089 Bacteria 1333
196 Ga0373936_0478702 3300035113 Unclassified 578
197 Ga0373936_0622676 3300035113 Bacteria 508
198 Ga0373943_0004315 3300035170 Bacteria 6448
199 Ga0373943_0458607 3300035170 Bacteria 741
200 Ga0373946_0026197 3300035171 Bacteria 2298
201 Ga0373935_0035145 3300035692 Bacteria 3127
202 Ga0373947_0001819 3300035725 Bacteria 13046
203 Ga0373937_0154004 3300036401 Bacteria 2154
204 Ga0373925_0001681 3300037068 Bacteria 18616
205 Ga0395899_0010154 3300037312 Bacteria 7220
206 Ga0395899_0082987 3300037312 Bacteria 2330
207 Ga0395900_0012913 3300037418 Bacteria 8531
208 Ga0395900_0067735 3300037418 Bacteria 3667
209 Ga0395900_0154028 3300037418 Bacteria 2348
210 Ga0395900_0167833 3300037418 Bacteria 2236
211 Ga0395900_0275993 3300037418 Bacteria 1674
212 Ga0395900_0484562 3300037418 Bacteria 1189
213 Ga0395900_0828624 3300037418 Archaea 852
214 Ga0395900_1307958 3300037418 Bacteria 639
215 Ga0395898_0002924 3300037466 Bacteria 19431
216 Ga0395898_0017618 3300037466 Bacteria 7292
217 Ga0395898_0093584 3300037466 Bacteria 2888
218 Ga0395898_0150089 3300037466 Bacteria 2230
219 Ga0395898_0417680 3300037466 Archaea 1278
220 Ga0395905_0018031 3300037471 Bacteria 6702
221 Ga0395905_0018508 3300037471 Bacteria 6612
222 Ga0395905_0156246 3300037471 Bacteria 2145
223 Ga0395905_0371008 3300037471 Archaea 1324
224 Ga0395905_0610051 3300037471 Bacteria 993
225 Ga0395901_0001747 3300038443 Bacteria 22452
226 Ga0395901_0012594 3300038443 Bacteria 8583
227 Ga0395901_0047713 3300038443 Bacteria 4446
228 Ga0395901_0095090 3300038443 Bacteria 3122
229 Ga0395901_0113786 3300038443 Bacteria 2842
230 Ga0395901_0176994 3300038443 Bacteria 2237
231 Ga0395901_0345405 3300038443 Unclassified 1537
232 Ga0451853_3963593 3300041512 Unclassified 516
233 Ga0466972_0098931 3300044658 Bacteria 1381
234 Ga0466972_0260353 3300044658 Bacteria 811
235 Ga0466966_0020280 3300044684 Bacteria 4374
236 Ga0466963_0000774 3300044694 Bacteria 15856
237 Ga0466963_0011553 3300044694 Bacteria 5376
238 Ga0466963_0019879 3300044694 Bacteria 4218
239 Ga0466963_0122155 3300044694 Bacteria 1793
240 Ga0466963_0430131 3300044694 Bacteria 931
241 Ga0466964_0015459 3300044706 Bacteria 2905
242 Ga0466964_0303139 3300044706 Bacteria 806
243 Ga0466971_0029164 3300044719 Bacteria 2468
244 Ga0466971_0175597 3300044719 Archaea 1006
245 Ga0466971_0440768 3300044719 Bacteria 638
246 Ga0466968_0042943 3300044735 Bacteria 1913
247 Ga0466968_0045360 3300044735 Bacteria 1865
248 Ga0466970_0150268 3300044765 Bacteria 1286
249 Ga0466957_0694632 3300044842 Bacteria 718
250 Ga0466957_1027845 3300044842 Bacteria 592
251 Ga0466960_0702015 3300044901 Unclassified 607
252 Ga0466959_0040125 3300045049 Bacteria 3458
253 Ga0466959_0075780 3300045049 Bacteria 2430
254 Ga0466959_0210585 3300045049 Bacteria 1351
255 Ga0451576_0173609 3300045051 Bacteria 2250
256 Ga0466958_0017818 3300045836 Bacteria 4113
257 Ga0466958_0106505 3300045836 Bacteria 1748
258 Ga0466958_0114191 3300045836 Bacteria 1687
259 Ga0466958_0143411 3300045836 Bacteria 1505
260 Ga0466958_0151464 3300045836 Bacteria 1463
261 Ga0466967_0000176 3300045976 Bacteria 26402
262 Ga0466967_0003259 3300045976 Bacteria 10512
263 Ga0466967_0008636 3300045976 Bacteria 7490
264 Ga0466967_0009459 3300045976 Bacteria 7232
265 Ga0466967_0031430 3300045976 Bacteria 4468
266 Ga0466967_0046155 3300045976 Bacteria 3791
267 Ga0466967_0052279 3300045976 Bacteria 3585
268 Ga0466967_0095317 3300045976 Bacteria 2712
269 Ga0466967_1093441 3300045976 Bacteria 794
270 Ga0466967_1179432 3300045976 Bacteria 763
271 Ga0466967_1569395 3300045976 Bacteria 656
272 Ga0466967_1690377 3300045976 Unclassified 630
273 Ga0495592_0028563 3300046454 Bacteria 4225
274 Ga0495592_0158945 3300046454 Bacteria 1557
275 Ga0495592_0770557 3300046454 Bacteria 573
276 Ga0495629_0001451 3300046459 Bacteria 18698
277 Ga0495629_0108789 3300046459 Bacteria 1933
278 Ga0495629_0243354 3300046459 Bacteria 1238
279 Ga0495641_0000455 3300046461 Bacteria 34086
280 Ga0495651_0004556 3300046462 Bacteria 10594
281 Ga0495651_0175647 3300046462 Bacteria 1521
282 Ga0495651_0213861 3300046462 Bacteria 1339
283 Ga0495653_0065659 3300046463 Bacteria 2731
284 Ga0495653_0066524 3300046463 Bacteria 2711
285 Ga0495653_0120036 3300046463 Bacteria 1875
286 Ga0495582_0000050 3300046473 Bacteria 59164
287 Ga0495582_0109203 3300046473 Bacteria 1553
288 Ga0495639_0001239 3300046475 Bacteria 11505
289 Ga0495639_0295894 3300046475 Bacteria 806
290 Ga0495662_0000824 3300046476 Bacteria 15070
291 Ga0495662_0090569 3300046476 Bacteria 1491
292 Ga0495662_0138095 3300046476 Unclassified 1199
293 Ga0495608_0032318 3300046511 Bacteria 3537
294 Ga0495608_0040904 3300046511 Bacteria 3104
295 Ga0495608_0355284 3300046511 Unclassified 901
296 Ga0495608_0503069 3300046511 Bacteria 734
297 Ga0495618_0040764 3300046514 Bacteria 2924
298 Ga0495628_0092784 3300046516 Bacteria 2335
299 Ga0495628_0107730 3300046516 Bacteria 2145
300 Ga0495628_0197114 3300046516 Bacteria 1519
301 Ga0495628_0631846 3300046516 Bacteria 762
302 Ga0495630_0004424 3300046517 Bacteria 9859
303 Ga0495630_0086484 3300046517 Bacteria 2367
304 Ga0495630_0144340 3300046517 Bacteria 1810
305 Ga0495630_0149900 3300046517 Bacteria 1774
306 Ga0495666_0051825 3300046526 Bacteria 1971
307 Ga0495666_0064425 3300046526 Bacteria 1749
308 Ga0495652_0087890 3300046529 Archaea 2548
309 Ga0495652_0185256 3300046529 Bacteria 1593
310 Ga0495652_0355596 3300046529 Bacteria 1048
311 Ga0495665_0001699 3300046531 Bacteria 11799
312 Ga0495640_0073359 3300046533 Bacteria 2291
313 Ga0495640_0092111 3300046533 Bacteria 1999
314 Ga0495640_0117159 3300046533 Bacteria 1734
315 Ga0495586_0263797 3300046535 Bacteria 984
316 Ga0495586_0285411 3300046535 Bacteria 945
317 Ga0495587_0241688 3300046536 Bacteria 1016
318 Ga0495645_0155740 3300046543 Bacteria 1583
319 Ga0495645_0206955 3300046543 Bacteria 1327
320 Ga0495645_0501742 3300046543 Bacteria 758
321 Ga0495667_0026150 3300046559 Bacteria 3931
322 Ga0495667_0030787 3300046559 Bacteria 3605
323 Ga0495667_0039809 3300046559 Bacteria 3123
324 Ga0495667_0085670 3300046559 Bacteria 2045
325 Ga0495667_0162648 3300046559 Bacteria 1436
326 Ga0495634_0040061 3300046642 Bacteria 3188
327 Ga0495634_0103365 3300046642 Bacteria 1839
328 Ga0495634_0606396 3300046642 Unclassified 635
329 Ga0495635_0025414 3300046663 Bacteria 4125
330 Ga0495635_0059813 3300046663 Bacteria 2620
331 Ga0495635_0141050 3300046663 Bacteria 1641
332 Ga0495635_0343813 3300046663 Bacteria 996
333 Ga0495657_0060338 3300046675 Bacteria 2513
334 Ga0495657_0080768 3300046675 Bacteria 2104
335 Ga0495623_0140378 3300046679 Bacteria 1438
336 Ga0495646_0123837 3300046680 Bacteria 1461
337 Ga0495647_0018950 3300046681 Bacteria 2456
338 Ga0495658_0000020 3300046683 Bacteria 87200
339 Ga0495613_0002778 3300046689 Bacteria 13142
340 Ga0495613_0073241 3300046689 Bacteria 2496
341 Ga0495613_0356344 3300046689 Bacteria 1004
342 Ga0495624_0004740 3300046690 Bacteria 9897
343 Ga0495600_0126220 3300046809 Bacteria 1664
344 Ga0495600_0245608 3300046809 Bacteria 1139
345 Ga0495600_0345380 3300046809 Bacteria 933
346 Ga0495581_0001354 3300047315 Bacteria 13552
347 Ga0495604_0041991 3300047317 Bacteria 3586
348 Ga0495604_0049679 3300047317 Bacteria 3257
349 Ga0495604_0093201 3300047317 Bacteria 2229
350 Ga0495604_0101172 3300047317 Bacteria 2117
351 Ga0495674_0004130 3300047319 Bacteria 14020
352 Ga0495674_0027119 3300047319 Bacteria 5239
353 Ga0495674_0073129 3300047319 Bacteria 2956
354 Ga0495674_0082084 3300047319 Bacteria 2764
355 Ga0495674_0101269 3300047319 Bacteria 2450
356 Ga0495674_0204638 3300047319 Bacteria 1637
357 Ga0495676_0000506 3300047321 Bacteria 31895
358 Ga0495676_0546961 3300047321 Unclassified 757
359 Ga0495680_0000280 3300047322 Bacteria 57136
360 Ga0495680_0013214 3300047322 Bacteria 7213
361 Ga0495680_0025732 3300047322 Bacteria 4866
362 Ga0495680_0206388 3300047322 Bacteria 1408
363 Ga0495680_1079895 3300047322 Unclassified 508
364 Ga0495675_0690131 3300047444 Bacteria 572
365 Ga0495684_0019791 3300047471 Bacteria 5186
366 Ga0495684_0043368 3300047471 Bacteria 3444
367 Ga0495684_0051615 3300047471 Bacteria 3138
368 Ga0495684_0343934 3300047471 Bacteria 1061
369 Ga0495593_0647573 3300047673 Bacteria 530
370 Ga0495602_0144225 3300048088 Bacteria 1881
371 Ga0495602_0214517 3300048088 Bacteria 1458
372 Ga0495602_0278260 3300048088 Bacteria 1234
373 Ga0496100_0010749 3300048903 Bacteria 5190
374 Ga0496100_0017700 3300048903 Bacteria 4212
375 Ga0496101_0007236 3300048904 Bacteria 7181
376 Ga0496101_0094969 3300048904 Unclassified 2223
377 Ga0496101_0693719 3300048904 Unclassified 804
378 Ga0496101_0892227 3300048904 Unclassified 700
379 Ga0496101_1158917 3300048904 Bacteria 606
380 Ga0496102_0046243 3300048905 Bacteria 3952
381 Ga0496102_0090450 3300048905 Bacteria 2833
382 Ga0496102_0112451 3300048905 Bacteria 2540
383 Ga0496103_0040394 3300048906 Bacteria 2866
384 Ga0496103_0200472 3300048906 Bacteria 1283
385 Ga0496103_0569931 3300048906 Unclassified 722
386 Ga0496104_0141173 3300048907 Bacteria 2314
387 Ga0496104_0195341 3300048907 Bacteria 1936
388 Ga0496106_0030495 3300048909 Bacteria 4020
389 Ga0496106_0094682 3300048909 Bacteria 2309
390 Ga0496106_0096986 3300048909 Bacteria 2282
391 Ga0496107_0016880 3300048910 Bacteria 5131
392 Ga0496107_0019550 3300048910 Bacteria 4778
393 Ga0496108_0617096 3300048911 Archaea 944
394 Ga0496109_0053911 3300048912 Bacteria 3669
395 Ga0496109_0104247 3300048912 Bacteria 2633
396 Ga0496109_0306512 3300048912 Unclassified 1498
397 Ga0496109_0353981 3300048912 Bacteria 1387
398 Ga0496109_0697283 3300048912 Archaea 953
399 Ga0496110_0384654 3300048913 Bacteria 1279
400 Ga0496110_0688346 3300048913 Archaea 923
401 Ga0496111_0133748 3300048914 Bacteria 1836
402 Ga0496111_0202274 3300048914 Bacteria 1476
403 Ga0496111_1067873 3300048914 Bacteria 577
404 Ga0496112_0006912 3300048915 Bacteria 10013
405 Ga0496112_0260402 3300048915 Bacteria 1684
406 Ga0496112_0299259 3300048915 Bacteria 1554
407 Ga0496113_0097384 3300048916 Bacteria 2276
408 Ga0496113_0200373 3300048916 Bacteria 1587
409 Ga0496113_0447696 3300048916 Bacteria 1038
410 Ga0496114_0026063 3300048917 Bacteria 4784
411 Ga0496114_0046398 3300048917 Bacteria 3610
412 Ga0496114_0049195 3300048917 Bacteria 3507
413 Ga0496114_0179839 3300048917 Bacteria 1847
414 Ga0496115_0013650 3300048918 Bacteria 6148
415 Ga0496115_0127961 3300048918 Bacteria 2093
416 Ga0496115_0233855 3300048918 Bacteria 1515
417 Ga0496115_1234919 3300048918 Bacteria 560
418 Ga0496115_1294154 3300048918 Unclassified 543
419 Ga0501031_0243861 3300049568 Bacteria 1168
420 Ga0501034_0055781 3300049571 Bacteria 3976
421 Ga0501038_0334620 3300049574 Bacteria 1182
422 Ga0501039_0208177 3300049575 Bacteria 1538
423 Ga0501039_0899077 3300049575 Bacteria 689
424 Ga0501039_1215339 3300049575 Unclassified 583
425 Ga0501041_0077533 3300049577 Bacteria 2045
426 Ga0501041_0725850 3300049577 Bacteria 636
427 Ga0501042_0265511 3300049578 Bacteria 1239
428 Ga0501067_0040019 3300049583 Bacteria 2603
429 Ga0501067_0052123 3300049583 Bacteria 2267
430 Ga0501067_0305954 3300049583 Bacteria 885
431 Ga0501067_0543863 3300049583 Bacteria 650
432 Ga0501069_0057983 3300049585 Archaea 2159
433 Ga0501069_0622309 3300049585 Bacteria 649
434 Ga0501070_0251796 3300049586 Bacteria 1445
435 Ga0501070_0737586 3300049586 Bacteria 777
436 Ga0501070_1392215 3300049586 Unclassified 533
437 Ga0501071_0119301 3300049587 Bacteria 1954
438 Ga0501072_0033023 3300049588 Bacteria 4054
439 Ga0501072_0138714 3300049588 Bacteria 1939
440 Ga0501072_0227363 3300049588 Bacteria 1486
441 Ga0501073_0104184 3300049589 Bacteria 1969
442 Ga0501074_0011834 3300049590 Bacteria 6344
443 Ga0501074_0196100 3300049590 Bacteria 1439
444 Ga0501076_0789672 3300049592 Bacteria 783
445 Ga0501077_0273650 3300049593 Bacteria 1074
446 Ga0501080_0001377 3300049742 Bacteria 20352
447 Ga0501080_0628009 3300049742 Bacteria 952
448 Ga0501083_0025253 3300049744 Bacteria 4112
449 Ga0501045_0172849 3300049824 Bacteria 1609
450 Ga0501045_0711271 3300049824 Bacteria 741
451 nmdc:mga05p37_1215044_c1 3300050507 Bacteria 777
452 nmdc:mga05p37_1790144_c1 3300050507 Bacteria 593
453 nmdc:mga0n895_103972_c1 3300050512 Bacteria 2852
454 nmdc:mga0n895_26270_c1 3300050512 Bacteria 5512
455 nmdc:mga0rr50_15756_c1 3300050513 Bacteria 4998
456 nmdc:mga08x19_52766_c1 3300050514 Bacteria 2615
457 nmdc:mga0a205_64789_c1 3300050515 Bacteria 3530
458 Ga0495601_0040303 3300053077 Bacteria 2925
459 Ga0495601_0179985 3300053077 Bacteria 1382
460 Ga0495601_0201582 3300053077 Archaea 1300
461 Ga0495601_0202033 3300053077 Bacteria 1298
462 Ga0495601_0211745 3300053077 Bacteria 1266
463 Ga0495612_0076878 3300053078 Unclassified 1399
464 Ga0495612_0109842 3300053078 Bacteria 1179
465 Ga0495655_0007263 3300053083 Bacteria 2052
466 Ga0495595_0011552 3300053084 Bacteria 3694
467 Ga0495595_0148892 3300053084 Bacteria 1151
468 Ga0495595_0213573 3300053084 Bacteria 962
469 Ga0495619_0002318 3300053085 Bacteria 12538
470 Ga0495619_0002661 3300053085 Bacteria 11686
471 Ga0495619_0016889 3300053085 Bacteria 4623
472 Ga0495619_0373493 3300053085 Bacteria 985
473 Ga0495619_1045388 3300053085 Bacteria 545
474 Ga0501084_0170893 3300054114 Bacteria 1835
475 Ga0501084_0177875 3300054114 Bacteria 1796
476 Ga0501082_0133716 3300060353 Bacteria 2152
477 Ga0501082_0201235 3300060353 Bacteria 1733
478 Ga0501082_1533597 3300060353 Bacteria 582
479 Ga0466962_0008163 3300061719 Bacteria 5020
480 Ga0466962_0085718 3300061719 Bacteria 1508
481 Ga0530510_0099808 3300061734 Bacteria 2123
482 Ga0207707_10039352
483 Ga0070658_10043622
484 Ga0070658_10170920
485 Ga0070658_10209477
486 Ga0070658_10233302
487 Ga0070658_10577286
488 Ga0070683_100003255
489 Ga0070683_100263154
490 Ga0070683_100343148
491 Ga0070690_100259182
492 Ga0070682_100081901
493 Ga0070660_100037271
494 Ga0070660_100074619
495 Ga0070660_100076320
496 Ga0070660_100194917
497 Ga0070660_100286352
498 Ga0070660_101366681
499 Ga0070661_100044444
500 Ga0070661_101653479
501 Ga0070692_10733239
502 Ga0070671_100114839
503 Ga0070659_100038460
504 Ga0070714_100123371
505 Ga0070714_100214023
506 Ga0070714_100227006
507 Ga0070713_100005268
508 Ga0070694_100420482
509 Ga0070708_100017256
510 Ga0070708_100802056
511 Ga0070708_101466491
512 Ga0070678_100209056
513 Ga0070681_10031963
514 Ga0070681_10092680
515 Ga0070681_10108642
516 Ga0070681_10253652
517 Ga0070681_10451584
518 Ga0070681_11901575
519 Ga0070706_100374869
520 Ga0070706_100688868
521 Ga0070706_101066398
522 Ga0070706_101249449
523 Ga0070707_100173698
524 Ga0070707_100323022
525 Ga0070698_100108538
526 Ga0070698_100132666
527 Ga0070698_100324882
528 Ga0070699_100045698
529 Ga0070699_100600264
530 Ga0070679_100001045
531 Ga0070679_100043113
532 Ga0070679_100251284
533 Ga0070679_100458738
534 Ga0070684_100134343
535 Ga0070684_100344325
536 Ga0070684_100374579
537 Ga0068853_100622435
538 Ga0070693_100391556
539 Ga0068855_100037971
540 Ga0068855_100066322
541 Ga0068857_100494673
542 Ga0068856_100441039
543 Ga0068856_101953022
544 Ga0070702_100908252
545 Ga0068852_100267248
546 Ga0068852_101518735
547 Ga0068866_10523589
548 Ga0081455_10049997
549 Ga0081455_10134895
550 Ga0070717_10273324
551 Ga0070715_10282141
552 Ga0070716_100658517
553 Ga0068871_100506402
554 Ga0075433_10151514
555 Ga0075434_100134811
556 Ga0075434_100326971
557 Ga0075436_100504787
558 Ga0075436_100548985
559 Ga0075435_100059322
560 Ga0105240_10023029
561 Ga0105240_10254559
562 Ga0105240_10879951
563 Ga0105240_12442771
564 Ga0114129_11450088
565 Ga0105243_10062582
566 Ga0105243_11383519
567 Ga0105241_10163672
568 Ga0105242_10089028
569 Ga0105242_12587773
570 Ga0105238_10944694
571 Ga0105238_11145493
572 Ga0157373_10350582
573 Ga0157371_10420798
574 Ga0157370_10042519
575 Ga0157370_10525124
576 Ga0157370_10581866
577 Ga0157369_10100961
578 Ga0157369_10127932
579 Ga0157369_10247161
580 Ga0157369_10363352
581 Ga0157369_10453834
582 Ga0157369_10910504
583 Ga0157369_12269752
584 Ga0157372_10284781
585 Ga0157372_10385293
586 Ga0157372_10588212
587 Ga0157372_12337820
588 Ga0157380_10746313
589 Ga0182008_10343897
590 Ga0182006_1056696
591 Ga0197907_10658192
592 Ga0197907_11003145
593 Ga0206356_10626314
594 Ga0206356_11386261
595 Ga0206356_11769102
596 Ga0206356_11808796
597 Ga0206354_10014569
598 Ga0206354_10761226
599 Ga0206354_10932083
600 Ga0206353_10590963
601 Ga0206353_11732424
602 Ga0206353_11820817
603 Ga0206353_12041574
604 Ga0224712_10381214
605 Ga0207699_10122406
606 Ga0207705_10050648
607 Ga0207705_10057117
608 Ga0207705_10398577
609 Ga0207705_10687789
610 Ga0207684_10973076
611 Ga0207654_10375930
612 Ga0207707_10048924
613 Ga0207707_10070392
614 Ga0207707_10175847
615 Ga0207707_10242337
616 Ga0207707_10244974
617 Ga0207707_10433800
618 Ga0207707_11012379
619 Ga0207695_10119990
620 Ga0207695_11222130
621 Ga0207693_10031904
622 Ga0207693_10271730
623 Ga0207693_10400564
624 Ga0207663_10249231
625 Ga0207660_10173136
626 Ga0207660_10301763
627 Ga0207660_10788961
628 Ga0207657_10065237
629 Ga0207657_10070854
630 Ga0207657_10131472
631 Ga0207657_10216329
632 Ga0207657_10225925
633 Ga0207657_10475452
634 Ga0207657_10626566
635 Ga0207649_10038475
636 Ga0207652_10113336
637 Ga0207652_10149775
638 Ga0207652_10365251
639 Ga0207652_10455647
640 Ga0207646_10085322
641 Ga0207646_10204682
642 Ga0207700_10003351
643 Ga0207700_11420743
644 Ga0207664_10253301
645 Ga0207664_10269837
646 Ga0207664_10275315
647 Ga0207664_10517734
648 Ga0207664_10620233
649 Ga0207664_10707085
650 Ga0207664_10724460
651 Ga0207664_11050990
652 Ga0207644_10089751
653 Ga0207690_10415529
654 Ga0207690_11252791
655 Ga0207709_11496307
656 Ga0207661_10112103
657 Ga0207661_10300448
658 Ga0207667_10342600
659 Ga0207667_10485798
660 Ga0207667_10808969
661 Ga0207640_10899202
662 Ga0207702_10590306
663 Ga0207674_10193147
664 Ga0207683_10114356
665 Ga0207698_10299395
666 Ga0207698_10928650
667 Ga0207698_11680334
668 Ga0207428_10309397
669 Ga0307408_101338607
670 Ga0307407_10165397
671 Ga0307409_100060308
672 Ga0307416_100163918
673 Ga0307416_100808766
674 Ga0307416_100962749
675 Ga0307416_101617034
676 Ga0373944_0048459
677 Ga0373936_0478702
678 Ga0373936_0622676
679 Ga0373943_0004315
680 Ga0373943_0458607
681 Ga0373946_0026197
682 Ga0373935_0035145
683 Ga0373947_0001819
684 Ga0373937_0154004
685 Ga0373925_0001681
686 Ga0395899_0010154
687 Ga0395899_0082987
688 Ga0395900_0012913
689 Ga0395900_0067735
690 Ga0395900_0154028
691 Ga0395900_0167833
692 Ga0395900_0275993
693 Ga0395900_0484562
694 Ga0395900_0828624
695 Ga0395900_1307958
696 Ga0395898_0002924
697 Ga0395898_0017618
698 Ga0395898_0093584
699 Ga0395898_0150089
700 Ga0395898_0417680
701 Ga0395905_0018031
702 Ga0395905_0018508
703 Ga0395905_0156246
704 Ga0395905_0371008
705 Ga0395905_0610051
706 Ga0395901_0001747
707 Ga0395901_0012594
708 Ga0395901_0047713
709 Ga0395901_0095090
710 Ga0395901_0113786
711 Ga0395901_0176994
712 Ga0395901_0345405
713 Ga0451853_3963593
714 Ga0466972_0098931
715 Ga0466972_0260353
716 Ga0466966_0020280
717 Ga0466963_0000774
718 Ga0466963_0011553
719 Ga0466963_0019879
720 Ga0466963_0122155
721 Ga0466963_0430131
722 Ga0466964_0015459
723 Ga0466964_0303139
724 Ga0466971_0029164
725 Ga0466971_0175597
726 Ga0466971_0440768
727 Ga0466968_0042943
728 Ga0466968_0045360
729 Ga0466970_0150268
730 Ga0466957_0694632
731 Ga0466957_1027845
732 Ga0466960_0702015
733 Ga0466959_0040125
734 Ga0466959_0075780
735 Ga0466959_0210585
736 Ga0451576_0173609
737 Ga0466958_0017818
738 Ga0466958_0106505
739 Ga0466958_0114191
740 Ga0466958_0143411
741 Ga0466958_0151464
742 Ga0466967_0000176
743 Ga0466967_0003259
744 Ga0466967_0008636
745 Ga0466967_0009459
746 Ga0466967_0031430
747 Ga0466967_0046155
748 Ga0466967_0052279
749 Ga0466967_0095317
750 Ga0466967_1093441
751 Ga0466967_1179432
752 Ga0466967_1569395
753 Ga0466967_1690377
754 Ga0495592_0028563
755 Ga0495592_0158945
756 Ga0495592_0770557
757 Ga0495629_0001451
758 Ga0495629_0108789
759 Ga0495629_0243354
760 Ga0495641_0000455
761 Ga0495651_0004556
762 Ga0495651_0175647
763 Ga0495651_0213861
764 Ga0495653_0065659
765 Ga0495653_0066524
766 Ga0495653_0120036
767 Ga0495582_0000050
768 Ga0495582_0109203
769 Ga0495639_0001239
770 Ga0495639_0295894
771 Ga0495662_0000824
772 Ga0495662_0090569
773 Ga0495662_0138095
774 Ga0495608_0032318
775 Ga0495608_0040904
776 Ga0495608_0355284
777 Ga0495608_0503069
778 Ga0495618_0040764
779 Ga0495628_0092784
780 Ga0495628_0107730
781 Ga0495628_0197114
782 Ga0495628_0631846
783 Ga0495630_0004424
784 Ga0495630_0086484
785 Ga0495630_0144340
786 Ga0495630_0149900
787 Ga0495666_0051825
788 Ga0495666_0064425
789 Ga0495652_0087890
790 Ga0495652_0185256
791 Ga0495652_0355596
792 Ga0495665_0001699
793 Ga0495640_0073359
794 Ga0495640_0092111
795 Ga0495640_0117159
796 Ga0495586_0263797
797 Ga0495586_0285411
798 Ga0495587_0241688
799 Ga0495645_0155740
800 Ga0495645_0206955
801 Ga0495645_0501742
802 Ga0495667_0026150
803 Ga0495667_0030787
804 Ga0495667_0039809
805 Ga0495667_0085670
806 Ga0495667_0162648
807 Ga0495634_0040061
808 Ga0495634_0103365
809 Ga0495634_0606396
810 Ga0495635_0025414
811 Ga0495635_0059813
812 Ga0495635_0141050
813 Ga0495635_0343813
814 Ga0495657_0060338
815 Ga0495657_0080768
816 Ga0495623_0140378
817 Ga0495646_0123837
818 Ga0495647_0018950
819 Ga0495658_0000020
820 Ga0495613_0002778
821 Ga0495613_0073241
822 Ga0495613_0356344
823 Ga0495624_0004740
824 Ga0495600_0126220
825 Ga0495600_0245608
826 Ga0495600_0345380
827 Ga0495581_0001354
828 Ga0495604_0041991
829 Ga0495604_0049679
830 Ga0495604_0093201
831 Ga0495604_0101172
832 Ga0495674_0004130
833 Ga0495674_0027119
834 Ga0495674_0073129
835 Ga0495674_0082084
836 Ga0495674_0101269
837 Ga0495674_0204638
838 Ga0495676_0000506
839 Ga0495676_0546961
840 Ga0495680_0000280
841 Ga0495680_0013214
842 Ga0495680_0025732
843 Ga0495680_0206388
844 Ga0495680_1079895
845 Ga0495675_0690131
846 Ga0495684_0019791
847 Ga0495684_0043368
848 Ga0495684_0051615
849 Ga0495684_0343934
850 Ga0495593_0647573
851 Ga0495602_0144225
852 Ga0495602_0214517
853 Ga0495602_0278260
854 Ga0496100_0010749
855 Ga0496100_0017700
856 Ga0496101_0007236
857 Ga0496101_0094969
858 Ga0496101_0693719
859 Ga0496101_0892227
860 Ga0496101_1158917
861 Ga0496102_0046243
862 Ga0496102_0090450
863 Ga0496102_0112451
864 Ga0496103_0040394
865 Ga0496103_0200472
866 Ga0496103_0569931
867 Ga0496104_0141173
868 Ga0496104_0195341
869 Ga0496106_0030495
870 Ga0496106_0094682
871 Ga0496106_0096986
872 Ga0496107_0016880
873 Ga0496107_0019550
874 Ga0496108_0617096
875 Ga0496109_0053911
876 Ga0496109_0104247
877 Ga0496109_0306512
878 Ga0496109_0353981
879 Ga0496109_0697283
880 Ga0496110_0384654
881 Ga0496110_0688346
882 Ga0496111_0133748
883 Ga0496111_0202274
884 Ga0496111_1067873
885 Ga0496112_0006912
886 Ga0496112_0260402
887 Ga0496112_0299259
888 Ga0496113_0097384
889 Ga0496113_0200373
890 Ga0496113_0447696
891 Ga0496114_0026063
892 Ga0496114_0046398
893 Ga0496114_0049195
894 Ga0496114_0179839
895 Ga0496115_0013650
896 Ga0496115_0127961
897 Ga0496115_0233855
898 Ga0496115_1234919
899 Ga0496115_1294154
900 Ga0501031_0243861
901 Ga0501034_0055781
902 Ga0501038_0334620
903 Ga0501039_0208177
904 Ga0501039_0899077
905 Ga0501039_1215339
906 Ga0501041_0077533
907 Ga0501041_0725850
908 Ga0501042_0265511
909 Ga0501067_0040019
910 Ga0501067_0052123
911 Ga0501067_0305954
912 Ga0501067_0543863
913 Ga0501069_0057983
914 Ga0501069_0622309
915 Ga0501070_0251796
916 Ga0501070_0737586
917 Ga0501070_1392215
918 Ga0501071_0119301
919 Ga0501072_0033023
920 Ga0501072_0138714
921 Ga0501072_0227363
922 Ga0501073_0104184
923 Ga0501074_0011834
924 Ga0501074_0196100
925 Ga0501076_0789672
926 Ga0501077_0273650
927 Ga0501080_0001377
928 Ga0501080_0628009
929 Ga0501083_0025253
930 Ga0501045_0172849
931 Ga0501045_0711271
932 nmdc:mga05p37_1215044_c1
933 nmdc:mga05p37_1790144_c1
934 nmdc:mga0n895_103972_c1
935 nmdc:mga0n895_26270_c1
936 nmdc:mga0rr50_15756_c1
937 nmdc:mga08x19_52766_c1
938 nmdc:mga0a205_64789_c1
939 Ga0495601_0040303
940 Ga0495601_0179985
941 Ga0495601_0201582
942 Ga0495601_0202033
943 Ga0495601_0211745
944 Ga0495612_0076878
945 Ga0495612_0109842
946 Ga0495655_0007263
947 Ga0495595_0011552
948 Ga0495595_0148892
949 Ga0495595_0213573
950 Ga0495619_0002318
951 Ga0495619_0002661
952 Ga0495619_0016889
953 Ga0495619_0373493
954 Ga0495619_1045388
955 Ga0501084_0170893
956 Ga0501084_0177875
957 Ga0501082_0133716
958 Ga0501082_0201235
959 Ga0501082_1533597
960 Ga0466962_0008163
961 Ga0466962_0085718
962 Ga0530510_0099808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

28

84

0.94

PF00571

CBS

CBS domain

94

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gk9-assembly1.cif.gz_D inhibited structure of impdh from pseudomonas aeruginosa 0.8915 8 122
3ghd-assembly1.cif.gz_A crystal structure of a cystathionine beta-synthase domain protein fused to a zn-ribbon-like domain 0.8895 12 79
6gjv-assembly1.cif.gz_E apo-structure of impdh from pseudomonas aeruginosa 0.8891 8 122
5iip-assembly1.cif.gz_D staphylococcus aureus opuca 0.8831 8 126
5iip-assembly2.cif.gz_B staphylococcus aureus opuca 0.8825 4 126
ID Description Score Start End Superfamily
5iipB00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8825 4 126 3.10.580.10
3oi8B01 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8818 82 120 3.10.580.10
5iipB00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8614 4 126 3.10.580.10
4gqvA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8579 4 128 3.10.580.10
af_Q6YYV0_61_223_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8532 1 126 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A6J6P644-F1-model_v4 Unannotated protein 0.9639 9 133
AF-A0A538J2V5-F1-model_v4 CBS domain-containing protein 0.9446 2 135 GO:0004352
GO:0006538
AF-A0A538JMF3-F1-model_v4 CBS domain-containing protein 0.9424 1 134
AF-A0A6J6P644-F1-model_v4 Unannotated protein 0.9418 9 133
AF-A0A538GC93-F1-model_v4 CBS domain-containing protein 0.9364 2 141

Map